ilovepdf_merged (2)

August - November 2022, Volume II MRG BITS

Table of CONTENTS 1] MESSAGES 11] PARENT CONNECT 2] 10 YEARS LOGO LAUNCH 12] INTERSCHOOL 3] SCHOOL AWARDS 13] INTERHOUSE 4] COMMUNITY OUTREACH 14] WORKSHOPS 5] EVENTS & CELEBRATIONS 15] MRG IN THE NEWS 6] SPECIAL ASSEMBLIES 7] CLASS ACTIVITIES 8] CLUBS 9] EXCURSIONS 10] CAIE

01 MESSAGE FROM DIRECTOR’S DESK Namaste! We are delighted to share an exclusive publication of our newsletter MRG BITS, Volume II celebrating the numerous achievements by our students and staff in varied spheres of academics and non- academics learnt at MRG School. It is with even more happiness and pride that I announce the completion of 10 years of MRG. A meaningful milestone marking the love, dedication and care of staff members, our students and parents. It is such a symbolic time for the school and to celebrate the occasion we inaugurated our SPARK- centre that shall cater to the co-scholastic education at the school and provide state of art infrastructure. The intention and objective of a holistic education today is to provide opportunities that will prepare young minds for a future in rapidly changing and evolving environment. At MRG we engage students in learning through innovative ways through which they are able to display empathy, compassion, respect and gratitude. With the association of our academic partner Shri Educare Ltd, we will be able to instil a love for learning in students and excel in academics. I am grateful to our parent community for their constant support and encouragement. We wish to achieve high level of success with your support. Happy Reading!

02 “ MESSAGE“ FROM PRINCIPAL’S PODIUM Learning Gives Creativity Creativity Leads To Thinking Thinking Provides Knowledge Knowledge Makes You Great . -APJ ABDUL KALAM Excellence cannot be quantified but is visible in all new endeavors. It gives me immense pleasure to share that MRGians have once again lived up to its expectations and have sustained excellent academic standards in the Midterm Assessments. They have also participated enthusiastically in extracurricular activities in this quarter thereby ensuring an all-round and balanced development. I’m also pleased to share that the parents associated with the school have also been very encouraging and supporting various forms of learnings at the school in their own ways. I wish to express my gratitude to all the parents who completed the Parent Satisfaction Survey Form shared by the school in this quarter and approximately 85% of parents have shared a satisfied response for the school. The school is always striving to create innovative spaces for learning. Our newly introduced SPARK Centre is designed to stimulate the learners to discover their own true potential and will lend them a sense of enterprise, whilst developing aesthetic sensibilities and a spirit of sportsmanship. We are extremely proud to present a glimpse of the activities in this edition of MRG BITS organized in the 3rd Quarter. Have a enjoyable reading experience!

MRG School 03 Celebrates the launch of its 10 years Logo 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of learning 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 1 10 Years of Preserverance 10 Yeras of Growth 10 Years of Excellence 10 Years of learning 1 10 Years of Growth 10 Years of Excellence 10 Years of learning 10 Years of Preserverance 1

04 SCHOOL AWARDS Brainfeed School Excellence Awards 2022-23 MRG School has been recognized under Top 500 Schools of India at Brainfeed School Excellence Awards 2022-23 on 10th Nov. This recognition is an honour for the entire learning community of MRG School. Career Counselling Leaders MRG School has been ranked No. 1 as \"Career Counselling Leaders\" at the Education World Grand Jury India School Rankings 2022-23. Our educators Ms. Jyoti & Ms. Pallavi received the award on behalf of MRG School. Holistic Education at North India School Merit Awards 2022-23 MRG School Ranked No. 1 in Holistic Education at North India School Merit Awards 2022-23 organized by Education Today. Our Principal Ms. Anshu Mital received the prestigious award on 11th October at Radisson Blu Plaza. The school is committed & will continue its endeavour to impart quality education.

MRG School is elated to share MRG school proudly announces that 05 that Ms. Pooja Goel (Faculty of Ms. Nisha Mehra (PRT Yoga ) is Biology) has been recognized qualified as a Judge in Indraprastha as a Climate Leader during Yogasana Sports Association 'The Climate Convocation' held affiliated to National Yogasana at AAETI in Nimli, Rajasthan by eminent Mr. Souparno Banerjee, Sports Federation recognised by Senior director for Environment Ministry of Youth Affairs & Sports, Education at Centre for Science Govt. Of India. & Environment. MRG is enthralled to announce its \"Perfection is not attainable, but if we collaboration with Indo-American chase perfection we can catch Green School Network ( IAGSN) as a excellence\" founding member. IAGSN is a forum MRG School is enchanted to that allows Schools of India & the United States to lead the World in the congratulate Ms. KANIKA SHARMA area of responsible education that (Faculty - Computer Science) for accepts accountability of pupils & becoming the proud recipient of Edu- responsibility to the planet. Excellence Award presented by Educlouds and Skill share India in the ceremony organised by Noida International University . “ Teaching is a very noble profession that shapes the character, caliber, “ and future of the individual. If the people remember me as a good teacher, that will be the biggest honor for me. – APJ Abdul Kalam MRG School was enthralled to Savitribai Phule Samman is an congratulate Ms. Juhi Dabra award meant to be endowed to (English Faculty) for becoming teachers with exceptional talent, consistently making significant the proud recipient of the contributions in the field of education. Teacher Par Excellence Award MRG is delighted to congratulate Ms Jyoti (academic coordinator) & in the ceremony organized by IIHM on the occasion of Ms Sakshi (PGT English) for becoming the proud recipients of this Teachers' Day at coveted award in the ceremony held The Ambassador Hotel, New Delhi. at the noted MPS, Shalimar Bagh. “The battles that count aren't the \"Patience, Persistence & ones for gold medals. The struggles Perspiration makes an within yourself—the invisible, unbeatable combination for inevitable battles inside all of us— success \" MRG School that's where it's at.\" MRG School congratulates Ms. Bhavna Grover congratulates Ms. Bhavna Grover (Faculty - Political Science) (Faculty - Political Science) for being the proud recipient of for being the proud recipient of Global Teachers Excellence “Best Mentor” in Gurukul Academic Awards-2022, organized by NITI Aayog Award 2022, presented by AKS organization. & UGC .

COMMUNITY OUTREACH Blood Donation Camp 06 MRG School in collaboration with the “We make a living Rotary Club successfully organized a by what we get, Blood Donation Camp Cum Drive for Zero but we make a Hunger on 3rd September 2022, on the school grounds. In these unique life by what we give. circumstances, the goal of the camp was - Winston Churchill to serve as a beacon of hope for those who come from underprivileged social “If you have groups or need blood in case of any been blessed, unforeseen situation. It was wonderful to be a blessing to see so many parents supporting the worthy charity by donating blood and others.” supporting the charity. The noble initiative - Bill Campbell was a great success and drew praise from all the stakeholders. MRG is celebrating Shanti Devi Children’s Home 75 years of It was a matter of great contentment for Independence in the newly elected Student Council to visit Shanti Devi Children’s Home. The a quaint way. students during their visit extended their love and care for the children through their small contribution and offerings. The visit was indeed life changing and created a sense of belongingness in the students. Prabhat Pheri To spread the jingoistic aura and patriotic fervor all around, the school organized a Prabhat Pheri. The morning march aimed to sensitize people about promoting healthy living and rebuffing the use of plastics in our daily lives. We aimed at instilling the love for the Indian culture and tradition in our wards that will support them as lifelong learners and also motivating them to become a responsible citizen.

To celebrate the arrival of the monsoon season, MRG School celebrated Teachers' Day on the 5th of MRG School successfully held a Teej Mela on the September 2022. It was organised by the student grounds of the school. The atrium of the school was council in honour of their teachers. The students bustling with activity from numerous vendors expressed their love and affection through different selling a range of goods. Children couldn't wait to cultural performances. The teachers extended their play on the swings and eat a variety of delicious gratitude to the students, school management & foods. They learned a great deal from their the principal for making their day memorable, experience. It was a massive success. special & endearing. Leaders are not born but are made by their The International Day of the Girl Child reminds us experiences in life. To unveil the journey of the that it is our responsibility to give them the scholars who stood the test of time and emerged as importance they deserve and work together for the best, the investiture ceremony of student their happier lives.”International Girl Child Day is council was organized on 10th August 2022 by celebrated on October 11th every year. Young MRG School. The distinguished chief guests learners of MRG dressed up as famous national congratulated the newly elected council members and international women personalities and made and admonished them to be impartial and honest in an effort to spread awareness about the discharging their duties. With new hopes and new importance of girls' education, health, and nutrition aspirations the whole ambience was vibrant with by creating posters on the theme. cheers and applause of the proud learners. Save the tiger, save the pride of the country The tiger represents bravery, power, and nationalism. International Tiger Day is observed on July 29th every year to raise awareness about tiger conservation. Our kindergarten students were sensitive to the urgent need to safeguard tigers during the celebration. Numerous art and craft activities were organised for students to raise awareness of the importance of preserving tigers. They also enjoyed playing games like tiger run, tiger puzzle and dressing up as tigers. They understood the fact that we should do everything in our power to safeguard tigers since they hold a particular place in both the world, our lives and pledged to do the same.

The school honoured the Chairman, Mr. Davender Avisha Jain of class VII was awarded with a Kumar's altruistic dedication and contribution to the trophy for securing First Position in poster making area of education during the ‘Gratitude Week’ from competition. October 8 to October 15, 2022. The week long celebration was held to mark the birth anniversary The learners of kindergarten celebrated Halloween of the man who created the human character, Mr. with fun and fanfare. The students during the Davender Kumar. celebration came dressed in various outfits to mark the welcoming of good spirits and driving away of The school during the celebration held a number of the bad spirits in their lives. The students got the enjoyable events for the parent community and opportunity to go trick or treating, enjoy candy, and students to instil a sense of thankfulness in them. dance at a Halloween party. The celebration was The school’s fundraising intiative \"Knock the conducted to help students pursue an education in Doors\" inspired the participants to support the goal a fun-filled manner and encourage them to of community improvement through volunteerism. appreciate differences in cultures, customs and The amount raised by the students was given to a also to make them aware of global festivals and non-profit organisation called HelpAge India. The values. students happily participated in each activity and generously donated to the charity. The students of the MRG School celebrated the festival of Diwali with great enthusiasm. The young learners demonstrated that ability and ingenuity know no bounds. To mark the occasion, various class activities were organized that permeated the school premises with an atmosphere of togetherness and hope. The celebration not only gave the pupils a sense of the triumph of light over darkness, but it also implanted in them the Diwali spirit. Over and above the students enjoyed the celebrations wholeheartedly. On the occasion of National Sports Day EKAL RUN was organized on 28 August 2022. The event was flagged off by Olympic bronze medalist Mr. Yogeshwar Dutt. It had various categories: (i)10 km Ekal Run (ii)5 km Fun Run (iii)1 km Fun/Mass Run. Apart from the marathon, poster making competition on sports-related themes was also held. MRGians actively participated in the marathon.

SPECIAL ASSEMBLIES 09 Quit India Movement To remember the sacrifices of heroes, class VI A students presented a special assembly where they showcased the determination of the people of India to free themselves from British rule through a small skit. The assembly depicted the struggle of freedom fighters. It was concluded by a patriotic dance to cherish the freedom of our country. ‘ SDG 3 GOOD HEALTH WELL BEING : Achieve universal health coverage’ The students of class VI- B presented an assembly centered on SDG-3 Good Health and Wellbeing. The students through a presentation showcased the importance of good health and wellbeing. The assembly focussed on promoting healthy lifestyles and sharing preventive measures for everyone. Swachh Bharat Swasth Bharat Students of class VI C showcased their assembly on Swachh Bharat Abhiyan. It was an effort of the students to present the value of cleanliness in the form of “Nukkad Natak” & a dance performance. Through the presentation, the students made the audience aware of cleanliness and presented their solutions to clean the environment. Janmashtami Assembly Our little MRGians celebrated Janmashtami with a flurry of excitement! They gave the entire celebration a traditional touch and filled the air with delight by dancing to the beat of Janmashtami songs.

10 National Unity Day As school resumed after the Diwali break, students of class XI-B were proud to present an assembly on the theme of “National Unity Day” A special skit was prepared by all the students of XI- B, keeping the audience glued to the stage, as students showcased the unity in diversity in India. Students also expressed the sacrifices of our freedom fighters and even the sacrifices made by common men from different religions in India. Then students emphasized the importance of 31 October, celebrated as “National Unity Day” to commemorate the birth anniversary of Sardar Vallabh Bhai Patel. Students solemnly took the “Unity Pledge” to honor Sardar Vallabh Bhai Patel’s contribution to the unity of India.The assemblay portrayed a strong message in a subtle way. Theme- Fighting Communicable Diseases The CAIE IV students put on a magnificent Special Assembly centered on SDG 3-Good Health and Wellbeing as part of a series of efforts to promote healthy living. During the presentation, the students raised awareness of communicable diseases and how they can be prevented by taking care of and upholding social and personal hygiene. The pupils’ propagation of the good message was certainly a delight. “The greatness of a culture can be found in its festivals.” The enthusiastic learners of grade II displayed the true colours of Indian culture through a presentation titled ‘Festivals of India’. The presentation was aimed at exposing the learners to culturally rich experiences so that they can imbibe imperative values early on in their life. The objective was to engage them in experiential learning which adds on to their holistic development. The constant smile and the incessant applause of the parents was a testimony of them thoroughly savouring the performance of their children.

11 On the occasion of Diwali, Students of Grade I enthusiastically participated in the special assembly. The students dressed up as different characters from the Ramayana and showcased mesmerizing performances of the story. They also presented their concerns and discussed the dangerous effects of lighting firecrackers and promoted \"Green Diwali\" by performing a skit and foot-tapping dance show. The audience was enthralled by their performance. \"Without justice and love, peace will always be a great illusion.” Class IX B presented a special assembly on the theme of SDG-16 'Peace,Justice and Strong Institutions.' They showcased the feelings that the citizens of Russia and Ukraine might be having because of the ongoing war. The students tried to spread the message of peace and love. They motivated the students to make the world a fairer place for all. “ “

CLASS ACTIVITIES 12 Healthy and Unhealthy Food ंजन हा ाच Our diet is a bank account. आओ िमलकर ंजन सीखे , Good food choices are good investments . सही उचारण के साथ | िमलजुल कर खेले हम , ंजन हा ाच एक साथ | ंजन हा ाच खेल से बचो ने सही ंजन की पहचान करना सीखा और उनके उचारण को समझ कर श ों के साथ बोलने का अ ास करवाया गया | Observe & Arrange MY CK WORD BLAST Our little scholars observed and sorted out Learners of Grade 1 various shapes given them. They portrayed carried out an a thorough understanding of the concept. activity and made a नारा लेखन flower full of spellings, अधम पर धम की जीत अ ाय पर ाय की िवजय बुरे पर which reinforced अ े की जय जयकार यही है दशहरा का ोहार!” their phonetic दशहरा के िवषय से संबंिधत हेतु क ा: ।। के छा ों ने नारा िलखकर कला क ढं ग से अपनी क ना श का abilities and enhanced िवकास िकया।ब ों ने रावण का मुखौटा बनाकर अपनी their voicing skills. सृजना क कौशल का दशन भी िकया एवम् बड़े उ ाहपूवक िह ा िलया

Spin and Solve 13 Lemonade Making e\"nSShpntuaiunLdnmeecabeannertdtsnrhsesmero,istralhvdcpeerean\"itritatcswiccauotilbpivttsahriptatiyenicndkwteiwnaedghsns,etchmpeourlansosldibliaenulsercwtmnticehuadsimclolfhybolveratihnrntsehgdyefareholnenamdajovraeybnneiewgadrgrslyitethottrieecfnnacaulldcamtithsfifbvsienietrIkyreIisnnt.ogt . Process Writing Class III learnt about the process of making lemonade using Adjectives. They prepared a vibrant and creative lemonade picture cards and described their refreshing drink using describing words. They wrote the process presentably and marked adjectives in it. This activity enhanced their vocabulary and enriched their creative skills. Poster Making Activity LES OBJET ET LES GENS (the objects and the people) The students of class VIII were involved in a peer learning activity in which they created a Students of class V actively participated in poster depicting the problems the eldest in the activity. their families face. The students provided It was a game which enhanced their exemplary solutions to the problems and vocabulary and they learnt lots of new words. discussed how the same can be All the students were able to read and play implemented at home to ensure a contented the game. living for the elderly.

14 Imagery- A descriptive & figurative language The students of Class VII indulged themselves in the world of figure of speech. They explored imagery in the poem ‘In the Bazaars of Hyderabad’ written by Sarojini Naidu. They identified the five senses of the human body that the poet has used to describe the splendor of the Indian traditional bazaar. VOCAL FOR LOCAL Warli Art Class VIII students were engaged in peer Students of grade IX engaged in an art activity in which they had to make unique integration activity to understand the concept of products and items promoting the congruence of triangles and to explore how the Government of India ideology “vocal for local”. congruent triangles can be used to create art Exhibition took place in the Bio lab and forms like Warli Art. Through this activity, they students from class 8-10 were invited to visit pondered upon techniques of creating art along with the teachers. pieces of animals or human figures using different congruent triangles Class Constitution

15 The school conducts a multi hued spectrum of club activities which amalgamates in itself various creative events, displaying the creative acumen of young MRGians. Activities conducted in various clubs reflect the keen learning and progress that the students make in the chosen arena of activity. School has broadly categorized various clubs which lay focus on different aspects of skill and creativity. These clubs aim at providing a wonderful opportunity and platform to students to churn their creativity in the chosen domain and showcase their learning through various activities.

EXCURSIONS 16 A VISIT TO LORD GANESHA PANDAL MRG SCHOOL To seek the divine blessing of Lord Ganesha, the students of Elementary Wing of our school attended the Ganesh Utsav. The students during the visit were found singing hymns, chants and devotional songs enthusiastically. The visit not only brought devotion in the learners but also instiled in them the cultural values which are the essence of education. A VISIT TO THE GURUDWARA SAHIB “Let no man in the world live in delusion. Without a Guru none can cross over to the other shore.“ -Guru Nanak Dev ji A visit to the Gurudwara Sahib was organised for MRGians on the occasion of Gurupurab. It was heartening to see the kids sitting solemnly and showing great respect to the traditions practised at the holy place. AN ADVENTUROUS ROCK SPORT CAMP & TRIP TO VISHALGARH The students at MRG had a gala time during the commemoration of Children’s Day. The students of classes Pre School to VII rejoiced an adventurous Rock Sport Camp whereas the students from VIII onwards went on a trip to Vishalgarh Farms. Their cheerful faces showed the amount of fun they had! A TRIP TO DUBAI Educational trips are a perfect platform for students to bond with peers. MRG organised an educational trip to Dubai for the students of grade VIII-XII. The trip helped the students to socialize and explore the Museum of Future, Burj Khalifa ,Desert Safari and many more. The students felt energetic, excited and thrilled in anticipation of fresh perspectives and informal environments.

17 Class Activities CAIE I CHICKEN LICKEN In this activity, learners read and summarized the story of Chicken Licken as they prepared beautiful mind maps of the story characters. Through this they revised and recalled the story really well. They immensely enjoyed doing this activity. छोटी सी आशा इसम ब ों ने ब त ही मज़े के साथ काय िकया | ब ों ने जो वो बड़े होकर बना चाहत है उस पर कु छ पांिकितयाँ पर ूत करी। यह गितिविध ब त ही लाभदायक और रोमांचक थी | इसम सभी ब ों ने कथनी के मा म से अपना सपना सभी िव ािथयों के साथ साँझा िकया । FINDING MATERIAL This activity made learning more fun and interesting for the learners as they were engaged in the hunting process. In this activity they searched for the things made up of different materials around them in the classroom. LET’S HALF The learners underwent a great learning process as they applied the concept of fractions (halves) in their day to day life by doing the halves of different shapes. Now, they are able to do halves of almost all the things and this will help them in fair sharing of things. MY EARTH This activity was a great learning experience for the learners as they applied the facts that they learned about their planet Earth. They created a model of planet Earth. With this they learned about the surface covered with water and land.

18 CAIE II PAMPHLET ON HEALTHY HABITS The learners exhibited their creativity by creating pamphlets on the theme of keeping healthy in connection with one of the challenges of Global Perspectives. The learners through the activity understood the importance of fruits and vegetables in their diet and how they help us to fight infections. कोिशश करने वालोंकी हार नही ंहोती, लहरोंसे डर कर नौका पार नही ंहोती। छा और छा ाओं ने अपनी िहंदी गितिविध सु िस किव और कविय ी के अिभनय के मा म से इस बात को सािबत कर िदया की कोिशश करने वाला कभी हारता नहींहै। LIGHT SOURCES The learners investigated different types of light sources and conducted experiments. It enhanced their natural curiosity to wonder about everything in the world. INVESTIGATE NUMBER ZERO The learners understood the application of the number zero in various mathematical operations. They closely observed the patterns followed and attained knowledge about how the value changes when a different application is applied. MENU CARD MAKING Learners created nutritional menu cards. Highlighting the amount of nutrition they are getting from healthy sandwiches they made in class. The learners were excited to make the menu card which reflected upon their learning.

19 CAIE III COMPLETE COMPLEMENTS Learners got to know about the complements of 10 and 100 which helped them find the estimates of numbers easily and eased mental calculations. मुहावरा चाट मुहावरे िवशेष प से उपयोगी होते ह, ोिं क वे यं को अिभ करने का एक नया, रचना क तरीका दान करते ह । मुहावरे भाषा को सु ढ़, गितशील और िचकर बनाते ह। मुहावरों के योग से भाषा म अद् भुत िच मयता आती है। मुहावरों के िबना भाषा िन ेज, नीरस और िन ाण हो जाती हैl GETTING TO KNOW METALS Learners were engaged in researching the metals. They conducted an inquiry based on different metals and presented their findings to their peers. Through this activity, they developed skills based on researching, identifying and classifying materials into different metals. RE GROUPING Students used Dienes block to understand the regrouping in addition and subtraction. This made them understand the purpose of carrying forward and borrowing the numbers while finding the sum and difference. CHOOSING EQUIPMENT - SIEVING The learners, during the engaging activity developed the skills that involved evaluating and analyzing the properties of the materials. The learners learnt to use the equipment correctly to separate mixtures and apply their critical thinking skills by sorting the materials.

20 CAIE IV MY 2D WORLD Learners opened the gates to their creative minds and imaginative world. They made different things using 24D shapes and explained their properties. This activity brought out their innovative side. INCORPORATING INFOGRAPHICS! The students enhanced their research abilities as they worked upon to compile the data based on the Indian National Flag. As part of the enjoyable learning exercise, the children read about the evolution of the Indian flag and its journey as well as the importance of its three colors. RANGOMETRY CREATION Learners created different patterns and things using rangometry 2D shapes. This helped them understand the concept of 2D shapes better and the fact that we are surrounded with shapes. ROLL, RECORD AND TALLY It's true that practical knowledge stays for a longer period of time. Hence, hands-on activity like this made students understand the importance of data collection, recording and representing by rolling the dice and recording the data and representing it in a tally chart. SCIM! SCAN! SUMMARIZE! When students are actively involved in a thorough and enjoyable learning process, reading becomes enjoyable. It was a pleasure to observe the students as they summarized knowledge in a mind-map and enjoyed learning things about different birds and animals. The students organized the information in a creative and thorough manner by working both independently and in groups.

21 STUDENT LED CONFERENCE (SLC) “We don’t learn from experience. We learn from reflecting on experience.” - John Dewey The learners of Cambridge Wing left everyone astounded with their incredible academic journey during the Student Led Conference. The learners during the conference, unveiled their extraordinary experience and reflected upon their learning as they shared their bits with their parents. The students wondrously presented the portfolio of work from each subject and showcased their work samples. Not only this, they also shared their learning target mastery, goals and action plan for improvement. It was an enthralling experience to witness the young minds exhibiting their mesmerising journey. INQUIRY PROJECT The pursuit of one's interests, learning something new, improving one's problem-solving abilities, and engaging in novel challenges are all made possible through research. Throughout the academic year, the Cambridge Wing students were engaged in stimulating and fascinating inquiry-based projects. The projects not only assisted the students in gaining a thorough understanding of the subject matter, but also in integrating the principles learned across other subject areas. As they were absorbed in many projects linked to plants, health and vaccines, waste management, habitat, and trendy sustainable energy, the students' curiosity increased. It was a delight to see the learners reflecting back upon the knowledge and skilled attained.

Parent Connect 22 Grandparents Day Grandparents are a family’s greatest treasure, the founders of a loving legacy, the greatest storytellers and the keepers of traditions. To honour them, MRG School celebrated Grandparents Day on 10th September, 2022. The event won hearts as it consisted of Retro Walk, Retro Dance, Race, Potter’s Wheel, and Secret Recipe. The grandparents were exhilarated to perform with their grandchildren. Not only did participation came in huge numbers but also the words of appreciation. Team MRG School would be elated to host more such events to acknowledge the importance of each and every relation! Gratitude Week MRG School celebrated the Gratitude week to commemorate the Birth Anniversary of our honorable chairman Sir Mr. Davender Kumar Ji. A week long celebration was held where children along with parents participated in different activities such as Cricket League for Fathers, Musical Evening for Grandparents & Shake a leg for our lovely mothers. The school was enthused with happiness and joy.

INTERSCHOOL 23

INTERSCHOOL 24

INTERHOUSE 25

26 Workshops for Teachers Date Subject Topic of the workshop Participant Resource Person Classes 02.09.2022- Life Science Ms. Shivani Arora Dr. Romila Rawat, 04.09.2022 Science Ms. Pallavi Jain Dr Monika Kaul, Dr. Anuradha Sindhwani VIII-XI 06.09.2022- Coding Ms. Deepali Nagpal Ms.Sudhi Agrawal VI-VIII 14.09.2022 ICT 06.09.2022- Data Science Ms. Deepali Nagpal Mr.Anip Sharma VI-VIII 14.09.2022 ICT 07.09.2022- Integration of Art in Ms. Gayatri Mr. Ravi Kumar,CBSE I-X 09.09.2022 Art teaching mathematics Dr. Rakesh Bhatia 12.09.2022- Vedic mathemMatsic. sSwati Ms. Divya Sethi VI-VIII 14.09.2022 Maths 13.09.2022 Report Card Writing Teachers of Nur- XII Ms. Nidhi Kaushik,SEL Nur-XII Ms Juhi 17.09.2022 Action research Ms Surabhi. Ms. Sapna Yadav Ms.Sucharita. Ms. Sapna Ray, SEL 19.09.2022 - Life Science Ms Aastha. 21.09.2022 Science Ms.Simran. CAIE 1-4 Ms Deepa. Dr. Romila Rawat (Prof 21.09.2022 - Special Capacity Building Program Ms Jyoti Botany Hansraj 22.09.2022 Education on Inclusive Education College New Delhi), Dr Ms. Vaishali Talwar Inderdeep Kaur(Prof Ms. Simran Kaur Botany Guru Teg Bhadur College Delhi) Ms.Raashika Sahdev , Dr Monika Kaul(Prof Botany Hansraj College Delhi), Dr. Anuradha Sindhwani(Assoc Proc Education Dept Bhiwani CBSE V-X Ms. Archana Narain and Dr.C.B. Mishra All Interactive Interactive session with a All Teaching Staff Smt.B.K Santosh Nur-XII 19.11.2022 Session team of Brahma Kumaris Mr.Naveen Mishra All 22.11.2022 - Capacity Building Program 23.11.2022 Education on Classroom Management Mr. Naveen Mishra

27 Workshops for Students Date Topic/Agenda of workshop Classes Participant Resource Person 02.09.2022 To create awareness amongs IX-XII IX -XII Varisha Kamal, Counseling 02.10.2022 Students Psychologist in the Department 30.10.2022 students regarding Anti Bullying of Mental Health and Behaviour Sciences, Fortis Hospital, Delhi Anti Bullying Workshop III-VII III-VIII Ms.Anoushka Jolly,a 13 year Students old girl from Delhi founded anti bullying squad that works on creating awareness against bullying anongst children Career Counselling Session by IX-XII IX-XII Japan Embassy Students Dignitories from Japan Embassy 22.11.2022 Rocket - Lift off I-II I-II Students Mr. Yogesh - Space India 22.11.2022 Rocket - A Space Vehicle III-V III-V Ms. Shikha - Space India 22.11.2022 Students 30.11.2022 26.09.2022 Hydro - Rocketry VI-X VI-X Ms. Shikha - Space India Students Career Fair IX-XII IX-XII Representatives from domestic Students and International Universities visit to O. P. Jindal University XI-XII IX-XII Representative from OP Jindal Students University

MRG In News