Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore The Rip APRIL WEB

The Rip APRIL WEB

Published by catilm, 2019-04-06 18:08:56

Description: The Rip APRIL WEB

Search

Read the Text Version

Queenscliff April 2019 No. 313 and Point Lonsdale Your Community Voice Riding High... IN THIS EDITION: Point Lonsdale’s Lucy Naylor will this month CLUB FUNDING compete for a prized spot in the Bells Beach Rip SHORTFALL p12 Curl Pro. The talented teen continues to carve out a name for herself in the surfing world, with a win PREMIERSHIP GLORY p41 in the prestigious Victorian Open Series. Photo courtesy Surfing Victoria David McDonald Builders David McDonald Builders sets the standard in prestige homes. Specialising in unique design and renovations of outstanding scale and style. Building with Excellence The Rip April 2019 Page 1 www.davidmcdonaldbuilders.com.au • p: 0418 599620 • e: [email protected]

The Rip April 2019 Page 2

\"Give them something to stop for!\" Ferry CEO challenges business The head of Searoad Ferries has challenged “We’re doing a lot to encourage people to Queenscliff's new local business to deliver something worth come into the town and more and more are ferry terminal is a visitors stopping for. stopping,” he said. modern interpretation of the town's original CEO Matt McDonald has rejected recent The company recently launched a walking pier - built in 1857 claims, made by Queenscliff Councillors, that and touring map and was working with other and later demolished. as much as 99 per cent of the service's car traffic business to promote events and activities. was driving straight through the town, robbing tourism.” it of tourist revenue. A new ferry had been commissioned to Work on the Queenscliff terminal will replace the ageing MV Queenscliff in 2023 and Federal and State Governments last month new terminals in Queenscliff and Sorrento commence within months and according to Mr officially signed off on the $355m Geelong would further boost the attractiveness of both McDonald will create 188 jobs in construction City deal, incorporating $10 million for a new towns, Mr McDonald said. phase and a further 96 ongoing. Queenscliff ferry terminal. “An iconic location needs iconic or world- The controversial design, approved by a In outlining the development plans and the class infrastructure. It needs to continue to government-appointed planning panel, has company’s vision for the futureat a recent drive those people who want to come here, attracted a negative response from some Point Lonsdale Civic Association meeting those high-yielding, self driving people, and sections of the community. Mr McDonald said the company was not growing those jobs that we rely on in terms of competing with other business, but rather \"Our architect uses a lot of different words. It’s playing a key part in keeping Queenscliff on essentially a marine shape so it could be like a the tourist map by aiming to deliver a “world- ray or it could be upturned boat, but the correct class” transportation experience. term for it is a barrel-vaulted shape and it’s the same shape as the old pilot pier, the original “I would put the challenge to people in the Queenscliff launch pier, so it gets its roots from main street and people in business, people will there.” stop if there’s a compelling reason to stop and if a shop isn’t open no one stops,” Mr McDonald said. “People say ‘oh it’s the ferry’s fault,’ but visitors go where there is good stuff happening and good stuff happens not by one person doing a good job, it comes by many people doing a good job.” Mr McDonald said the service last year carried more than 950,000 people - many of those foot passengers. “If you take a typical ferry in summer, there’s 80 vehicles and around 2.3 people per vehicle,” he said. “A ferry would have somewhere between 400 and 600 passengers in total, so there’s another 200 to 300 people per hour walking off those ferries. \"Put cars to one side - maybe one per cent of cars stop, I still dispute that - but the rest of them are walking up the street. The Rip April 2019 Page 3

Railway and trail to close for development works The Bellarine Railway track will be closed how water flows from Top: The planned water canal construction and the rail trail re-routed as part of a new wetlands through the works. Above, the new bridge stretching across round of major works for Point Lonsdale’s The canal-style estate. water within The Point estate. Point estate. Construction of a dam Development firm Moremac has announced to the north of the railway construction will commence this month on inlet line will also commence and outlet waterways between the Bellarine shortly and is aimed at Highway and Laker’s Cutting. The works preventing water from include installation of new culverts under the flowing through the rail line, immediately west of Fellows Road. construction site to Lakers Cutting. The project would involve removal of vegetation and the disruption of activities “We will commence associated with the railway line, said Project excavation works south Director Doug Vallance. of the railway line. This will enable excavation The Bellarine Rail Trail will be diverted to the of the area where the south, approximately 60m south of the Fellows culverts are to be installed across the Road - Murray Road intersection, around railway reserve. The culverts will then the proposed works area. It will reconnect be installed, followed by backfilling and approximately 350 metres west of Fellows re-instatement of the rail lines to enable Road. the railway to be reopened,” Mr Vallance said. The railway line itself will be closed from Monday 3rd to Friday 28th June. The excavation process is expected to continue through to October. “It’s a fairly significant piece of work,” said Moremac Director Bryce Moore. “There’s an The company will erect signage enormous amount of planning gone into this and undertake a letter drop advising because obviously we’re shutting down the residents of the works and their likely railway and that involves some important impacts. approvals and disruption to people and disruption to tourism services and the like. Other major works underway as part of the 600-home development include “We’re pretty confident we’ve got the construction of a second Point Boulevard planning right and we’ll be doing night and Bridge over the canal and a new Community weekend work to ensure the railway stays Centre, opposite the Project entrance from the closed for the shortest possible time,” he said. Bellarine Highway. The works are associated with a change in The Rip April 2019 Page 4

Looking for retirement by the sea? (Secure your dream today) The Breeze at Point Lonsdale is selling fast. With over 50% of all homes reserved, now is the time to secure your dream seachange retirement. Designed with you and your lifestyle in mind, our beautiful, low maintenance homes let you live your best life today and into the future – at a price that’s within your means. Don’t miss your chance to enjoy a perfect retirement in this prized coastal location. Construction has commenced on these stunning architecturally designed retirement villas. The Breeze by Sencia. A better retirement in every sense. Hurry, secure your opportunity to live in Point Lonsdale today. Find out more at senciathebreeze.com.au or call us on 1300 144 712. The Rip April 2019 Page 5

98A High St, Belmont 3216 I 5241 2664 NECTRE MK1 NECTRE OSBURN 2300 MASPORT BAKER’S OVEN ADENA MASPORT Meet the MASPORT REDCLIFF Glen Dimplex ROMSEY The Rip April 2019 Page 6 Family of wood heaters... On display in our show room! 99 WEST FYANS ST, NEWTOWN VIC 3220 03 5222 1688

Corangamite MP Sarah Henderson, Queenscliffe Historical Mueum President Gary Spry and Leesa McVinish and Deb Moloughney are Mayor Bob Merriman join locals in celebrating the funding announcement participating in the Jalopy Derby All systems go for cultural hub Lonnie duo heads outback in support of A new look cultural hub in the heart of “[It] will ensure that a functional, elegant farmers Queenscliff has moved a step closer, with the and uplifting edifice will eventually emerge on federal government contributing $1.45 million the site. It will embody a significant upgrade Two Point Lonsdale women will drive a 33 to the project. of the Museum, the Library and the Visitor year old camper van across outback Australia Information Centre,” said Museum President to help raise awareness of the plight of farmers And a community control group has also Gary Spry. in drought and flood-ravaged communities. been set up, under the guidance of Bellarine MP Lisa Neville, to help design and drive the Once completed, the new Hub will link Leesa McVinish and Deb Moloughney have much anticipated initiative which will include the museum, library and information centre, signed up for the inaugural Rural Aid Jalopy a redeveloped Historical Museum, library and providing: Derby - a seven night, eight day rally across visitor information centre. remote rural Australia. • A fully accessible multi-purpose The long-overlooked development was meeting room The event’s mission is to raise as much money identified as a priority by the Queenscliffe as possible for rural Australians currently doing Council in 2015 but failed to attract wider • Expanded spaces for exhibitions and it tough. government support. research “We wanted to challenge ourselves and give Ms Neville gave new life to project in • Additional library space, and back to our regional communities,” said Leesa, September last year, when she controversially • A capacity to host more people a hearing specialist and Deb a police officer transferred $1.2 in state funding, previously \"There are many positive examples of - friends since they were to Point Lonsdale earmarked for the $7 million tourism initiative Hub type developments across Victoria and Primary School together. Destination Queenscliff. Australia,\" said the Borough of Queenscliffe. \" The Geelong Regional Library Corporation “The challenges for us will be getting our In announcing the federal contribution last has undertaken several ‘best practice’ tours Jalopy to the finish line, navigating more than month, Corangamite MP Sarah Henderson said to investigate the design, management and 2000km on roads not usually travelled by two the Hub would improve visitation and enhance operational learning from both library facilities, wheel drives and raising money for Rural Aid.” Queenscliffe’s cultural experience. particularly where there is a set of integrated functions and activities. It will be important to To get to the start line the girls must raise The extra funding builds on a total of $4.2 draw in this knowledge and expertise.\" $5,000. They’re hoping our community will million already approved through various pitch in to assist with fundraising efforts. state government grant channels and takes the overall project budget to $5. - well above the “The Derby will not only raise funds for Rural originally estimated $3.2 million. Aid, but will also bring fun, colour and support to our remote farming communities,” they said. Along the way they will be participating in different Rural Aid projects. The Derby commences in Sydney on August 24th and travels through outback NSW and Queensland, finishing in Airlie Beach on August 31st. To sponsor the girls email [email protected] gmail.com or log onto jalopyderby.com.au The Rip April 2019 Page 7

SARAH HENDERSON MP Delivering for Queenscliff and Point Lonsdale Just announced: $1.45m for Queenscliff Cultural Hub $650,000 for Pt Lonsdale surf club redevelopment Upgrading Hesse St south and Queenscliff Lighthouse Reserve Funding Cottage by the Sea upgrade Building Queenscliff’s new ferry terminal Fixing local roads Fighting for national heritage recognition Announcing the Queenscliff Ferry Terminal upgrade Sarah with Lucy, Max and Indigo announcing a $650,000 Announcing a $1.45m Building Better Regions Fund grant for with (L-R) Cr Ross Ebbels, Matt McDonald of Searoad grant for the Point Lonsdale Surf Life Saving Club Queenscliff Cultural Hub. redevelopment. Ferries and Cr Bob Merriman SARAH HENDERSON MP 3A/195 Colac Road, Waurn Ponds VIC 3216 03 5243 1444 [email protected] Federal Member for Corangamite sarahhenderson.com.au SarahHendersonMP Authorised by S. Henderson, Liberal Party of Australia, 3A/195 Colac Rd, Waurn Ponds VIC 3216. The Rip April 2019 Page 8

A Selection of our Easter Listings 8 The Esplanade | Queenscliff | 59 Winterley Road | Point Lonsdale | Expressions of Interest Closing 8th April 5.00pm Expressions of Interest Closing 29th April 5.00pm (Unless Sold Prior) (Unless Sold Prior) 11 McNaught Street | Point Lonsdale | 6 Gill Road | Point Lonsdale | Expressions of Interest Closing 29th April 5.00pm Expressions of Interest Closing 8th April 5.00pm (Unless Sold Prior) (Unless Sold Prior) With a long history of over 20 years, selling the Bellarine Peninsula's finest coastal and rural properties, our success is built on a solid foundation of consistently exceptional results and a premium level of service. Get in touch with our Point Lonsdale Team today! Felix Hakins 0400 035 000 [email protected] | Thomas Rogan 0438 965 594 [email protected] Point Lonsdale Office | 03 5258 1811 | 1/83 Point Lonsdale Road, Point Lonsdale | rtedgar.com.au The Rip April 2019 Page 9

LLOONNSSDDAALLEE $$883399,,000000 HOLIDAY tooffrroonnttaannddbbaacckkbbeeaacchheess,,ggoollffccoouurrsseeaannddsshhooppssaanndd IInnssppeecctt This renovated is your gatewa hheeddhhaarrddwwoooodd oooorrss,,hhiigghhcceeiilliinnggss,,aannooppeenn rreeppllaacceeffoorr SSaattuurrddaayy11ssttMMaarr33..0000––33..3300ppmm ssoouutthhffaacciinnggddeecckkssiiddeeaallttoossooaakkuupptthheessuunnoorreenntteerrttaaiinn.. Renovatedbyl nndd lliivviinngg aarreeaass lleeaaddiinngg ttoo aa llaarrggee pprriivvaattee nnoorrtthh ffaacciinngg CCoonnttaacctt cosywintereve The focal poin For Salemmooddaattiioonn.. CCaammppbbeelllPPoottttss 00441188551133330099 deck. Three be riivvaatteeffrroonnttaannddrreeaarrggaarrddeennsspplluussaa$hh8u3ug9ge,e0g0g0aarraaggeeiiddeeaall SSuueePPoottttss 00440000004499443355 OO ccee 5522558811557799 43 Kirk Road,Inspect Point33Lon1s1 da3l3e Further featur Saturday 1st Mar 3.00 – 3.30pm as a studio or Contact 43 Kirk Road, Point Lonsdale 43 Kirk Road, Point Lonsdale 43 Kirk Road, Point LonsdaleTHhiOsCOSuaremeLcPnpeobIoteDtv5sll2aP5Ato8e0t14tdYs5070c90hH40a94r14Ia83Gc55t1e3Hr3h09oLmIeFiEn thINe heTarHt THoEfhH4OiOsHOl3dreLLLKEnoIIDiAnorDsAvkdRaYAaRtTleeHoYdiIsOaGcadHhHnFa,eILraOaGIsFcyLtEHwePDarINlohkLoitLTonImHOFftreEoELNniHontSIaEntNnhADsdedRbAhTTaaecLHlOakeErbFtEeoOafcHLhODeElsd,LgAOLoolNRfncSsoTdDuarAOsleeLaEiFnsdaOsnheoLpaDssyanwLdaOlk tNo fSroDntAanLdEback iRseyno3ouvragteadtebw1yaloyctaolpa3rgemreaiutmlifbeustiyldleerinDvaevsitdmMecRbnDteeiTR.oHTsnhaehnyinicsooOsaourhrvvelerLdanneagto,IoeatsDvvdteha,eabtwAtedgeyeadhldYooybcocthlhaoHmyfalaparrcaIlaregeoGccofmrtteeeceuHairrauathrhmtllsooiuLfmbmeeprIuseeeFtriaylseiidnEnlnepemttriodhhnIDeNevliaiuehhsvsseeihhmtdTaameMorrHttedcbpoonDEhfftus.oOOanHillarddladdlnLLdEwooe,dtAnnhorssedRdioDhsaadoTlleeaymiiosvOseoafaiuoendnFarreetsuaMaOg,srsheyyacLsiwwgptDDaoeahlllkkoiwcstLtheonoaeOifdfalryrioohnlNndnatgtrtoSda,sawnnt,DadahodnobAebgdaoacLrchpkoekEbooebaernesmtaa,chclhiehirgefeehessf,pc,egsegloitaaolylifncltflcgeuceosofur,ouaeirnrsnrsesoevpaapneendnsodstshrlmehiospophlpesasceaneandnftdo.drhardwood 43 Kirk Road, Point Lonsdalecosywinterevenings,andcleveropeningofroomcisossyvyoiwuariFngtraeetreenwvceahnyidtnogoaso,garnresdatctolelinfveeosrtorytpleheinaninvnegdsotsmfrooeuonmtt.hsvfaiacFirnengchddeocokrsstiodneorathltaonsdosoaukthufpactinhgedseucknsiodreealntotseoratkauipnth. esunorentertain. HOLIDAY HIGH LIFE IN THE HEART OF OLD LONSDThe focal point of the home is a spacious kFitrcTeRhheneencofnovhcawateldidptobohyionlootrcposafelpttnhoremphnilouaommnrebtduihsiilandaesinnprDagdacvioaisdunoMsdkuciDtltciohhvneiannfladgw,ctihatihenrheogopamesdnelfeepealacatndukridsenisng-pinoitlgdiosaheneaadhlllaiavtrriodngwgesoaoopredaraiskvolaoeuratsed,phininggthohtcoreetiahlisnlafgurasgn,ceainpnoorgiprveaentenrnetoperltarhctefaafocinirng. HOLIDAY HIGH LIFE IN THE HEART OF OLD LONSDALE For SaleBRdFaAsueNrcatkDhs.teTurNhdTicTdRfNsroEehhieeeoyTsaiecnWOesoeyktoofuwru.boRlverrlTHriaceinntTehngtaodoIHtesralGever,dtLspoareegtFbeaHotwoobaAevyimrnnaedseleQoCyntdaecsciyorthnnUaIooa,oNfalgdonpAutaPrsGmhardsr,geoLacelscimrtnIameTieWhaandaYsirronucmtsthlAmdmli,lTenoiLaTbfaevOmbeeoEreosustirheRsWmatniocyletiadepansl,VaNeerndsectttrpIinhatiHnEDcanraireveanWOaacgelnhlgviev,ostbeioUaStrdrTtaFghuameaafnoMSsucrhoralvtoFadtecTdFaEahobkerecrasuleoohsuoneiitndSaDrrrcasmterdcamhfttosytkctfldkh.soheOshfa.woeWh.aoetoesteTmnuTruanrierlcvcmhrynrcohdda$dgaflnifIrstryeailoaolelieTfoet7LodaecpateFecmrwleHrpodtoet,ho9olrouabtubapevrneirpihlera5tenrcmepteuttneshoodaentoodrtsusducprsi,i0oriih,pmsnisoooroahgvrsgtnftogo0iolopaelauacdatpennesmrtmmshrs0eoe,aesolttaegah.ieasonsee0sy,nlneoynnthaoauosdhffgaderddptnonueunsc.nhgodmsdtilsrtlartaaetllohhoeclicieateaievmsmniaaouendeearssarirrsrmtmnsaossldglaaoicei,h,ynnTciTaFdahRriicynpababcssanneteohshurcrwseeeoopoohtfdtityprhoghnsaaniercanacrocaamaasomeeittytma,eenkg,,lncoclaahssgfkunnwirpccgpi.ttmsodomveitleaaettiiaorTthninnrerurpuirracsnmnoaafriaanggohogesrovdg,iltalivvodo,,fnsdtfdebdbkraaualreiroireveieeaandognadlohtttlatdmpaavvcititraeeehtvanhsaahntehebeetoisoetwninfi.rorrrruetvsbfevonoyaeossadrdidrcnineaepnraoaeocdgelnowlteaakon.Fmwimcyhcntodalnn.lraysc6yalold.ceiLiecortctgtc,tcctrhnonssaThhlhooloAeobgeedfatciCaeadlegmmhaoooohaapaaeaatntrRuupssidcpimhprraiOcsurhrrssde,oneokslgGeellukaccueceeneasooiostaostgrmabtnLtesryaerunenlperienlEehsakweDodddhs,hdlttddairdaaboanh,ooiheuuoiircihAntttnthrecnliemaliidesiiemLlrccioidooholgddeaggollaLinOvtanchidricafaeevckhnmotmabiLyteciyaencohsneeiororcsosOntNusgi,rtagordrCrmeoserrmmngstglna,,aaiosiyipSae,pldpomTpnotialmadeporianbkpllwsrnoDMpnnilaeeomioveifurvsedionsrudgantcutdaicArpgpihsgnhtaEtagltstnapsoDyeicrhsehetattve,sitteLNit.vueahcnoliff.io,acfaonarau,pErenrnonehlocgvocnigTrtsnesorn.sPiosan.teieineoipLatntudrvduIatprgoarmNaaafOaaaneageyMsdernrhlnnativoiaoet,noednernsbdkCudacFcrroonrlkuieecsarDnAnegtepssemrftAanvamctooreihae.VodLdOarhlehtrrpTosaencigennotgnrgraOelvIalpharonasdOagadadlatrnrintsercdaoalrotUfrtdiLdedaaeoasNaissFtmewcnocnoncRfi,l,dgnraiyotlos.aienendisbnhEceklttcrpaannpsnhhuigleolDroenuidlgpciuedlthmsneoetaahgsraheaouapgalptdiepeahrm,rsalsheio,ulluvuccuiebnngsapneoogaatteodafeaerrnlprregsinteghnad$latvtahlnaaohroioviet6aatrvnrtaeuetgnlaaiot4hgirioedtrenosdneaa9efoinyaaidrgicinsdcnftmiaeycw0.rinpheanionoaant0lggoaalrmrdcng0nla,lekioppstdmaaathrmpasnoisloeovlindndfdpaultrdegthaohltleieahstvneari.tdffioertnraeduonaiacgnwsnn.tirnhugaotd nsdale irk Road, Point LonsdaleFurther features, gas and slim line heating, reverse cycle air conditioning, private front and rear gar$d8e3n9s,p0l0u0s a huge garage ideal as a studio or to store your cars, boat, caravan and all the usual holiday trappings. POGLLKLKEHoFIIoIiDiDLAEHrErDniAkPPAkDIAnRNsYYooARRLRtTdiiHLHTooYnnITLaHOIFIOaattGGolOEddHELLHNeHFn,H,ooFILLSIsOEnnGNIIOdADFFssLEEHdRdLaAPPTDTIIDaaH4lNNooLeHlLlOe3eOiiLELTTnnIFEHHOOFttLKOEEENLLINHLiDHHoorDSSIEEEnnAkDNALADssAYOARdRdRATNTRTLaHaoLSHlOElOTeeIDEaGFFEAOdOOHLHL,LEFDDLEOILLFAOOLENNRPDSSITNDDoLAAOiTOLnLEHEFtNU4EOU4L4S9P9HP9oLDMFMFFEnDlAlAl4HAiiisnnAnRLL3ROd4dKddREO3ETeeeaLKTKrrKrINlOss4iDLsieErr3ISSSVFkAkSTtKtIDrRYrNtOieeRrrLoGkeAeeHLaoIRettBVdDL,,IoYatG,EaI,dTNLdQHH,O,GEuIFLFIPQQNnnBeFIoooFIBuuEoFsnPSseiorrArneeosEppYDrnpCSeiSteSPenSeFC3IaAeIsHnnLnTaaNtacloocccoeoslsLsLltHletltrcecnneoipEiTlnlSfnsEtiieHfdaastcFICCI3dcalBnEnt1ICFeaLotlnoCFIoosenoElsHoseoronrnsnppprAnpSESttneteSetaaeacCaAaaacclscctcec3lcttleHtRdt1ttetTalOeF3OLD LONSDAU4L9PEMFlAinRdKFICnoosrnpSteaaccltet IFCFICnnoooossrnrpnpSSteteaaaaccclcltetettHOLIDAY HIGH LIFE IN THE HEART OF OLD LONSDALEhmnLndwsuunnaraaecvneuFnaecrmhiyoalwgnrcoihdsgecdmianotladoyanddngtaomad,flndonniatefmrrastldeearyldeatmaiesloaolileeldkivetepfmonivedeoqkittLopddmwehaptqehacaprasetetFe,echmarwapleisceruopnboapdietnnsuobaoaethnt,hlowonlvtaae(rwdouoayebgtauel(evrysobapegcrevdrynieesigcrrpircodhlinureacaaresdutenrtdhlacoidumanelposluteouoatnotneotsoaohhwhyhpkntoloydtlaesntwboopdbtlprtltrssacubeotsldcpeuaececpilepoorsteei,eieoeridthtlihp,plosonmshaetdniestlapodoooroerooadhmygvdoforrfsgatenftaobooleagalogobgooliuaodloppaelgamdlipuyctaacrtdinaatrpdiirenycnsnecnrsnmhrrnaptmmteshlrsarsesoorptee,fdoe,ptguesaoedgoltaetcptnualcuoegrocah.rnilecaasooenorsfrnaermretanemsrsty,nnoleprontoyesneoencteeaecheetserohncia)thoauduoenrsodi)ttsehaffgadearhirddantseilrapnltponrthayownupeuaiueurclywnsace.tsotelahnhrohgfasonhmednmsddtfmaitslelbrt,mtlroattinabl,neoltlirsaeottloolohishrtsouiterooaacnrilrcshitsiefaataefevaaeiervhmatsmmbnmibeetepaetttaatatoueosbnettledrdenaroesohbsidnsdtsunsaeiuhirhsehirtoenrererhessdrcmtdmnnsaroytsrsldtrhglepdcaaicrioroaiidcoieepcecyy,lhe,lonsWyeneneiauoieanaahdtdtoriicupodnpyaanabonlblocaswdaonnbneektpeernheiawyeebkrrcnruwbseamseiwmoonpoouhmftetetdfdttnnhfitrprpreaidhitohgnnnoddEhahaearaannntndanDaeDyg.dcorcaamsnayaa.dmeeei1eimstgrteemdoelnvUva,emeetclnniLgeoUc,a,atclcnca,clshaeakrs,isueeghurk,nniphhsdccpggphupvvii7sdpLdttamlkpprpsdwoomsslilarrueaawttoioiaeieisrouootshhtomthnsintntroeddbtrr-pruup8tonSC3$sOSrrorbisoanoammbmtrnoonaaoffiiotaiaoarggLoooeaMmtMesasau6wptcrorooavorvhrmag,liilwpciihvmv2ododrt,net,ithneren9emOssdfrdnbdfhdbkkarauynauscucsuroirbmoyno.prousoc9nrm.iaiuegeat-DaPndDeotngalrohtptttleaaoldtomhm,sfhlsfttttaaldveivcsit0ihscat1ofrceCiuihssv.latpo.borvOanhhhasOavrhnlptesheovhega0nrastisoisod.geheineonniodifnnfi7.rOortreryrofi0etlnven5slvffniofnuainorraecossdltsdadAaluadigdcnneracnlia2nififgnon1deaiepagdi9foaoacleiglgnoPnnaaewL5daLldsnlacsoagkhfnnF.cTmaFtwloimcwwhchfc2oeoatdalo86,alneen,nv.ela,r0ctoihrypadvetylaoEtldttor.bptMneiunneeirbnh1ceu4hgeutcttgnacaottccdtruriauanorssranTsehhsDtaulhh50erlrLoaretengoBtbeefdrtreodldeaiocitt,facne7ld0tboretht,mDshmethbowabsoooosaehaaawahdaog9eeaealu3anhtoodduo0uaauprilsfpaloidSacprfiidaryper.iosceurfnmery4rays0mssdeo0neeoksllcseolrluMckc9udi0eclieLnc4eonsessveosoeoooatoaostagkabte1r4l–kAaf1aeraudfeanelrpirienlpeueu8s3oeAkesdrndshd3snrb,rdhlttdal5tdaacaatab5Raahr,.iorroiiheoioeit3griethnendtLstn1dnsturecknlueanl0laMiioeaiiGeacgi3oeia,edroLohoegsddrpieaoggsdlshaerenynvftnahc3ydricmaeraaicdsahncsotainyEitA0tciwyihencg-pwohsnOgphelioentorsi9HrcsDonttgno,taageoeaaordrimnohCerroSmngdgln,atlgdln,aalasklisikoipisaoewpsdpomHgcdspsotdlma,eathsnRriekthplwsrnoopeponnsnilanogoemihoavaEeifhuovdianEilsLadrfdgancudfdaoauielcuroygpDsgrtiatohkwglllotAstaophsolyteinsllahsehptaeittvnah,stfuvdnati.tuSahcolniff.ioragrtfGfiaossrnorautaocdpngprandronea,loocngssaryhowcsngesarwnn.eiostnn.ety,iEndesipauanoutdnahuvhdaoatdpwgro,ogaapgarananoerabdeeydeWeebgnddhsnnatediaaMaraoalesonaodneresediceudrscucrkvlghcopkIrloekukkecsrnlegkTeaaoanpsaeserbooiesanbamuaHoorerihnasteareridotdsrnledartedsrmrpota,opdaencigeac,hretgganigach3$SCaOSnMlpcha3$SCSOelriannahagadegiaul6saneahigtrrurau6fgtlatsnrecdft9tehaomerohrtetf9rhtdemuhoiieUsutecda9aeossaoicdtscs9tPfeeor,propcePsnc,rnpoe,eeencdfi,0egst,ogndoeeLa0ibogonoislpbaa.Hai0aherontdlis0ataabTnateaeoilktlyer0pt5stnyylia0tkssl5nslpnlfncIuslaiglia2lt1frfguolu2Pl1nuiyllcrgPgpeaaTicTFdaa5uiRlusPidct5esgpsoss$n2ontse8tnaLoo,2ogntsrhshcu8f0neeetuahwr,e0atMouyatha9M.1E4gapittsneird14ierecntapnadsnFdaTciThrRes5s0oon,asrryts5a0lsoa9haskoeshhuri,7esoeu0solrhug7v0ersfciypuwurvsrubrei9nc.nval83gpao9apbnsov03ettyeegk0kaaanpor.Tnehetesuf4u.0worediana.c4n00netovrteor0aendn90h0rergTrgu940sodidatatcn4irtnregonnhafgc1tasd4e–taovrre0HTicTFdaanR1t1oh4l–flnesia1tseoerhrlear8veo3lehhsuiitneemvoe8ev3kdoe3haitaotrdy0t3vppaospa5ierercnaOraaraestee55ees.otrgpofyta5.b3ketelpootboohettth3girwos1fuorawrthue.lprwb1eehv0oytrenveturseai0nbLe3erTcovyautnra3teidafoecrpsnlirictnpeehaegaaonfidndrtyaagaentdI3oideolmfneaa3tesnrcidnatmcffecleDimoaeenv0eiordytoo,ndcnth0.fttoidrinsapaedooareaneo9sgc.tnfit.rcb9dnetaoalogoAtanwoioloruptgr,abevtahyrnsrialshago.mohrnarraesddcerYlng,tfeetogeayalcntgoeedaonscaosocpmrtanityoatrt,rnhnesaeHhsooaaaogmdhrfartdsarldgaimroaoo,npeuaugatdrcesatlschemIhrasmdrasmlr,lensgGelaecrmoetnlbyaiwpscinmrtfnaleevyetmhmnbeeeadhaoeadoedHhadasidrauisrlironouounrecsmutustelhacimdostmilcreyh,llrenoiamlddsiomLlpracnibldtfaevelmmkebeeeoaelrseeieo$I$SscutiustdirfarpevihrensiaFmhmsmatblnieDocaian8y,al$8eienstiaedvetpOnEanrbls,aucsira8te$e3eehrungresehscogvim3stttult38orpsihinohatia9eiiInoyDc,lntN9dea3rauneiiatrNer9advmeanfp,a,aanc,bgla9Msdre00rnlhlcgeevivtoet,E,oesr,se0atb0ikoeioaca0trndtoTr0TtRa4bFgFTHhuotnr0iarpme0aaiDfnhona2SOC$StghMyasmrucrf0hhtnoeraelvDOctH0vco3T4HicT0dFaet,R.oeaHT4icTdFauaRO8ahseobkiaerthseiaeocnrOa1hlhsuareeoosvhhsuoeneen1snnyitinedaDrs,yntar3icernc3aeesmOtlm3viearEdcn0amcsoOohfyttososdevWytkctaufldKonkchshro.cosgnfiuhewrvicOashaf9uh.ewroehtoa.oaevvetloeCesveLtoPLhremTsnKLLrnurdTpiaKrauercanntHriiaelrcveineF,namcyrhiowgcnrohddsgndtaoa0tnIddgtaodo,IfrlnoiuterfNrIrMasteerbyirdleDatailsoaoileelDaviemfnvoeaeodiftLtooda0dreEhtpaeaakrcDtpaargtteeF,ecmarwleMcersopbeordentsboroehAtt,khlotlwovAltykerwod0auEyg5btveluavyaebpeoAvdyrnieit,rpsiceolwhlenracaaedtnterYhlacdmbeYpRklteuloAot2tneasoacohrhyh1notRlyoadRerntoodbRorttrsocueonCB$SdscuRcSSOCcpPiliposretie,ieoi5drhtiahp,lsDnmnshasoineHsaooo3HotrooahmyvgforsfrgatmonfatYelfgatlauogoooiutdlouvTSS3OC$a88poapecltapuyatacidrtaWatypierannse.c0ns.omIrhartmmIahlssrarsesooaarOhua08ae,t$C3OSSoe,tageMaseoGeehgomltGatecacuoegcha.ieseca134sonftseautrmrmet3nauemrs8mtnn,OlnypeoanyddnoA0dHenereacecrehutshnahseuoWaluAdvHonsdHch5t09ffga3eadreaiPrmddalirontlpotnasrdonPu9puaueauerucnasdpc.teot,ahhnr,ohg,ochn,i9md7mPFsddt0imddleslr–trtmla0rtapeoPlonellpsaeTotaorIolplobhliheouieLroLbnrcli,ciiefa,taefevaie9vda0mLsmP0mbandmibet3otepeaaoGaaotaueEnelbeder00tearFoIsdiIm3tssywOusaiupcsi0rhir5a0beoereotresFdsrcFtmn.masosytssltdtrglly,alaieiorooa4ici50eiytryyll,Rh,l2n0sytyyn.5ne1iaina0tlahd0ttdsriiclpynEpnaEanslbblclaH3swneaionPnneLepteehe9iet5y0leleh22scrrwsesice1mo1onttpoo4hicttPPdtft-,nnitrprpr1oihigohtnsPnod8h0aah0nraa5snnItInaPhDDhsDngrocc0aalm5aeaaFi1meoe4lsiigr–ttNeNemdtlnv,avM1oelenntieoog8daa,,lncca,clhPnaapks14ilctue0egoknnipLehhscggc88pvvisi3Rdp0hmttttpsmMdsoomssila5e00aao3ttoiaiaeeii14iiotohshahtmthnirtntneddmLTTrprPrauupsttor5rMsnaoanmnmmnoa7Iasff0iroiaoa55g0oguoOe.aMmMe4ss14rLoorovrvprlgt,ilimliHHv3Ovdioddo9Fpt,t,neneo37sdfed0dfbdrkbakauut1act0scrurmirbooiproson5n0roaiigee0eaDd0anDetg9.nalohttnltEa3doEtomhm4llf0ftttta3ve0vicitENctu0NeutichLssL.to.7oiev0OnahshhaOrnahtpeehe.venhn9a0iss.e4sn0ineont0n4ifnfi.rorrrHr0oiHtetlveslvfoafnioonar9roae3tsdotsdada3ladm39dn0rsacn1iSTfn4ino–deanep40daocalofagerlnoInsaawLnldpLld0EaEcngak38nnn.F3mFLtwicme.wwh1c4os–oD03,aNlnenn.,4l0rcnihayrdtaylohttdtdlA.F905Ane0inndei8l3htech5tstctg.oaacotscttdcrri3onssaa3nTehsh9lh0heloeeAng4hobo5Aeod1redR4daidoRcia5dicneed.4taeh0mDhemhabsoon3oahaaatdhag3eannhtodTdu1euonT1lupls4pTa9p–lidcapidLaa0iperiaMceurmelaryis1mdseo3neekoos3lseorllmuckcdrdi8uepc3oseiescndeHonlsesvOEeoasolOeootoao0s3tgakebater3lek8anefameryau4fdenarelpiriean5lpeuerso9eicIkesdrndsdh5sn0b,rF.dhsltFtdalntadLactaatbiaa3hE,oyrrioiehoiceoitgwr9i3ethendtntpndn1sChatrueYcknlu5eanaMiiloeaOiiieacgOo0iioa,drooheogsdrdigaogsndlsthea3gren5yonvaaftanhcydricaeraaidcsH1prhlncoLstaOmiyniLttciwyhengc-HpowghesngOplehnlia,oeltroircsDonttD3go,naatkDgeomieaadorri3mnohreormngpglan,tlpgsdlna,adElskmlNisOkoi0pisoeawpsadpomcdspsotdlamt,heathLrierktphlwLpnsroopeonpsnnsilaong9onoemiA3oavaeifiuovOTdioanilOseLadrfdgancoMuvdfdaouailicurygpsgrtdiatAohklgllotstnapohsoy0letnisdfdllaNashehetittvuNnaR,hstfuvdnati.truahclonfifi.roagrtffgiaoronruatotcdEpangpraoCh9nSldroneta,loSocnsgsarhowecsngiesTrnwn.eioshtsnnt.et,DivdensinapauDanoutdahuvhdaoatdpigT.roogaapgafrfnaianooerabereAytdeeebgAnddhnOrasnnatediaardaoalesonaodnereAseonidceLudarscucLrvckghcgopkrloekuwkecsrnlgekeaEaonpnnas.eserEbiooeiFsanbaGmuaoorerihnastearneridodsrnledaaoetdstrdmrpota,pdaencigea,hretgganigagchanlprcahelrEiOaonnaahagadegilasnehigtrrregtbltsnredcfdtohaerohetfrdhtnNhdioiestedaeaosaidctasstfeerop,oacsncAbnoe,eeencLfiegst,gnodeeaigoossilpa.aaiheTrcondlistaabnaaeocielklrptsnDyliaksslnponlfcnuliakgabltfrrfglouuknuiayllcrgpgeaauiueidcteespgoosnnsetnraos,gnsrcfbcetuahwre,aaouiaaha.gaiptneirLdriehpanlnhreson,errdaloshadlssreri,uslosguveicipOuverubnvlag,paapaneeigkgaaanphneeteoendsnanetcnrodnarergsodatiitnrgeNnahgasovrentgthlltnasoehrlrritnmvtoehoaairtvrpoeredaesthtgrpoofapelpSotthtgirrahelprehstrensanoeecotattcsfoosiceaeaa,ndfiaDghineaanndioncffemaensdgoncf.tiriedaaone.tni.r MFMMFFEOnFllAlAAiEiiLsnnAnRRIDRddKdNdKRETEeeeaLTTTKrrHrOlOssLLseEEINISSwVFVSHTttIISrrNtNEOewerDLAGGeeeLAIRettwBBVDT,,LU4YYtOEI,.9TTPNLQcFHHOMOFGEEuaQU4QNLlBABeiDm9BuEPuESneRAAeeMLYDFndKCCOeeplHAAsHEnnNeTicnbRsTsSLHrlccDdKEiselLlfAEiiEefISLlTVrEBltsIpLrNEISeVoAGteIrNtCetBtG,HesYt.BT,cYHoTEHmQwUwBEPwwQuEM.BwaAweuEA.CA.Reeucc44KCHaaen93EmHmnTsFK4psLplciir9IncbbkVlFidlIeeRiNleillnoGllr4Udppas3FCIBendoo9SPoYor,stttsMrnrTpttFSessHStetelA..aarEcicceCt3CPnclRo,oBt1eICeotnoCoEtmmdKo,isoAnnnnpCEe.n.CttateatTtaHaarcLaQuaucstcoc3LmctQu1tntItSeuVspeetdIenbSCFIrFCINannnICFesuoeolnoFCIoscoGsenoseosecrolrlnrn3spplilrnipStBSSttePPteSetaae,acaaaYaaoocclcctceclctltlettttteTtetttssHE00QB44uE01A80eCe50H14n93sc34l30i59 w w w. cUHPOMLIADRAKYEHTIGLIHVILNIFGEBIYNTTHHEEBHEEAACRHT OF OLD LONSDALEpnnLddeaodeadDuwsausadhlrFDrosewreeresssdrmtmenesaoontsssldtrigilsnaai,oirooaiivciei.yryo,lha,lit.nsyntntneiatianahdtndtrttiiacpnwnwpyaTenbianlbolcawTsohannnceedtpeehtipoayndetehrpcrwseseimohonponoohsnetthtfdtnotnnitrpoerprtoiohioghinonodhhaiaiahnntntasdpshDDgcsorcsoaamcaisnaoarmeesiitgrtteehmmdetnvva,eelenniignoor,iaa,aclncoa,calsohrpaaatsiptueegknniphhsccggipovvniisioridpmntitmorrpsopdolromdssoilaredeaatteiiateieioooseheshuamestohunitnntreddmnrrpruhuanpsrraasanaemmmnoaafftioiaoaitaggooo,earMMess,orrcorosdovrvrgid,rliiltifvvnododhlt,,twsneulenaeowosdfdohbodbdokikathioauoauccurribooprooncnolvtviiugeioeonaDaindDiotnogfanaralohtttlgadtpimhgmeflifttettgaveevncitictrksterekeuihss.too.nonhvnraOnhhhhasOahnretehehveilagreiistrles.aelnnnnnhifnafoi.rororrrietlveslovnfnqfbnihionqaorrhaeodsesdagtdalgdabdoanoracnitnnfinodteauteepoduaoouoaclgnlnoae,knayaekwLqdLldaacadagnakmnnF.ammFwimcwwhlciriroroo,aclsnceldcn,n.lnllrrctitradytlyaotlidetui.onteodroieannreaeiythggechtctgacroottoccitrriyoynoissioannsThhshlhnelonateneingoibossedrePdPdwsasiocimyacnepkdAkheshsmpiDihmehasooiooahoanlanahdagioiaeosknntoddwutotioosouplasaipailggidcpidccpreritRnncATlibacpcTldcFUeauremReraysmppisgdeohwnaesehhlnoksllsoyeoelreluttnaakcoooudiechhskuieeienceaeeeoinCsespevceeosovrrrewooirrtscoaoNNdstygabbnntteevervenelsagkgnnriaerafaecrnaukahfeaeelnrphthiurisenlpeuesoeeddsaaaeykteessdnrdashidnoHspnpd,rkcedhlttootdloialpp,,tlhdaaedcbaiasobrdfaauh,oswrorroiitiaaliaheoaoihmelmit.gpprdienetinheondktvueeenttdnlsItdfucre.recroknltpueauinlaMiiireTeeaaieaTiiekkauerccgioiiasai,raidor2caoaadhknoegsdDdrlirhoanggnsdnnlsolhnoloharelhttEsigrieneyansvsssastynahrdydrtnainicnaAlbapclcUeirsaasicdohs5hnfcisotvnaaaneinonaynrateveioittcr.inwCynnatecnoog-tpowohlsinbgtnpeahetbltOtienooepndvetroidvrifwircsaDooernwtweAoTdtoitbgostno,taanvnmgnegsropaeareaaadordrdnimdnedohawruerwrsoepmngeoStwTgtlnaa,htltgeddradanl,aaltsbdktcseietocotgoUnoelkooiwpistaobegwPpshiwPtowdhpodm-csporrssrortdallomauichnlcbmeaethiivFoiyhkoorieeektphoellsIswper.asrniopotppoepon,npomioinsnTilianiosnNoeemanioroosaisooedavrdaiipeteniafduillmoDveinnadindnatonorcdiliseSadorscfdggioreamncasmuadfdroayaaauinltnctouriodndtytgpdittsnwgrBiStonreiavteoihkbgslcn.llTtirustnniaoartuophcsoldymtentiinsrtLcliaeroLhaseidrhitetwotrtvtanwaw,ewAh,tidTstirPhosdiauvdrnantsotianat.nitoeyusuanhnkiocenodliofef.ieropagruottwnsgoffhihaoirnofarauttoinsdgapnansogprtlagcnenIgsetdrongetnafttosa,lolNconeooonchagsqaRprihs,orhaaqwcssngoatieucahsrhdrknrwnns.ssaeioslt,dskfamonn.etv,dusiianmnehurasailepaesuwtrueandotantomdtaehEurDoalnephvnh,doaaoioaitndepoeasgrnbganeecloornaeoctsogadeaapglcardnalnvynolaeadbeewrDeieydiioossnndioeareedebasSmgenmrrdtendbSIhdogrynidnasteudleeidd,aarlnuao,ateNewlosotenSnapoesuodhwrlnkteyerpteoasat,odinichdceutdaeahrisrciaucteuhrrkbvuhdhaghtiacrothripttfugk5tarenoernallooekcu,oerkueGoancsniraluchldekigncyneoopaoinntnrpdsafesisehrvbaoensoeqhlabvgh-mwsdaunbaaoacsmgugamllelooergehdroihogabatiaeroBienlriildBoetBddsrpinronltsllecdeduheavleytoedissrmerppiohonotaac,oispdaaweeaeanckfdeiabWgtderegva,ehiereetagmgEamnigbpysadcohaa.remncyarloakntlepsrchalciesreswlroiaeiennaahhrasgwoad,vecegicilunsaFleDaahiigutgrcrstrrutreirilglltoatasoeniiaAnnrneioamrclefdgetsohaoonrenoromaemadseattf,turdhtlnnpgnhmqoibithiesloaotciemdaaaeoirgdlsiadyybicdktssRo,lteioiimfeoodrl,pnkqunTncispanmrtcqeuhdneQonoet,neenicisfikplsegsant,sblgniosaeeeaPktusinnEagpiloaomynOuailseaa.eankdidra.thmsnecroandief(hluistarolagierbsnea(eaeoooiogclknleecreercgnpstFRgscltiaornryltitaklunprcrspuwinlefnctiuogphiuloaiagnsaosoruoahaeflotaiatOfunrfggpuogotnusdnDcsuilloctlocsnrbggppelaaypruliasuaiebidcpeoenntlttiespgpetaro,hwVesnhpnevinqeeesesnetnatlpoe,ugasthrPcat,eafdsctlnpeofmtyauaheMr,deekddasoreiicehoeeuonahaea.phgcrapigonitarvngibnIolcureiraeeNitogilpnynadtnonehErrweessoeitnn,ooyncssrraanartalpisoihhnerigtshornesocrip,detsnuesoltnpdteudugrreavudeipWncitpptruuavwhHorubuahrnnpamvnlvagpfaoearnpprntloauaesapg,fslergndaeMbseaesanpritneavreteeoadeeeSnit)licaroiretdcnvmaeONrntciep)stetornnhett,oreeSpdetesnuaenynrweehatrbepgkehprosohdaoywwceieintnrregleaoeadneaaonknetCdasilfastvreiiadpsanenthmlaakDnMbnrottioliarsuooaaAuawUDbpehtrl,snltnrrblmtaitnfomvhfttveasoteoihaeiaivaeaatracrastshnrvmpopirgeternOlcpUlcaAbena.faeossnsdtsusAUblpalccnertrdgpOeatatonnhaeaeropiesbaehtnapeooonnlp.dotaenEhteghaeiroooeaeshptnnbtaavrkheahwededlpprinevrhbanwtsrendrvnphccakrbigtcdsbarrtdnalovnrTenneeglcNldtrvnsanaepctesclewtorarfposqtsoeoeouoraihodasicdeoekcasesealartraeBdaeadlndciWugfoeidnatrdaiegtlodniidsrdsuithaleeonedrnanahlsaerwwailidincifhlplnofkoauaSeTkrflihlmr-nae.uektarrntpewnntlaainid.odauitpnclmedf.tiLtaieieridtisrdciuedbefadtainoaoDsntrdidwidanoAtodadwelFoo.DbrnsmisarwP.renocoyherdnsdoadnosIceseeioannsnlraiiselnyyredm,.idegrflceoTnrdsvoiu.lrrronrevaitwoeym.eelotolnthoetStagoa.seUatnrtptrtClitdcaenwswnTedoiiuoseaysHwswbTtirdosdho,pnnoccydrtutwpsnoearobcndtanwcldiwPhppnf.phtwrahmilnonororsnenownohohgotnecotdelorugoectoooTob.iooosionetomiloiihdieneaaaoaptsdpsihbrsl,rsonsmotctndFaTclUaicbplTAo,isdnRcmioitrotmweoisBnairrtaweashsmoabtemhtamailnm.edooaviornooae.nsnhhuirisaAuwcleaeoeandsnohrohpprmanktvdrgowaptciniyeLbanlvmrnysnginhonrireiaoraarcnnaiwumntiemoirar.UsmoeuopilrrsdoctyrndatoutyrweBesdipidarepmdto.kycnetuntloietesuGlortautnehsoouleuirssmsdnfuhokswrrdsasnalohdniehala.iaeLaleaaosikstvhetetvfplost.wepinftltiapgaiol,iiarrgTsrrpieuta,oroucgohsdiuecvlapcuhisdiroearwytcadnninifDenurfseeaeohgnEolrmshhnwssgulsqaeoeowosiudfeslanoedhotaoilorenethioUAbpilcooirnsaonnolncftgleofrtonveiseprt.cgoaalvyctaoctglvldveyNiadtuiiiocntnosneatieieooofnuainaeveravagnbahotgwwlnTbqpdigbeaosdetiasifivergepariadnennfPedmrlranksteieuplreketoaedttwaaaaafhocanneenahnrlvdgnreeahbhcrecieatoeeunoelvnaooaTdtilgficrotetiwgdlaetrleevdolasrludinahnnlpbenannreahalMvaoiiyhpowesbilessaareve.idhnonemtioneqtobnnpheciiqreibsnhsacennsrricearsebgtddraaetagdbdSlmDobeuaeodntutneirlhrougtortedwasutehteoaouhdyeuountnte,rdodeesnllgusaoesasaer,karfyaeorkwiqsSitc.lAicnipotaarthcoairdmnan.drmtac.ebdomocirfoorutale,tliea,rwTliwrihlogdotrtntsatocewuseclsdtbucondocFnldooaFppblartpasorttuungawahhhtrfauieteuiatoaoRaitlodroneaogorionaeytuuoebttotpuulgoeapgofoba,ayotpiwro,olrsahoraicutarychnhdyaroyssoiioinslnosfanfnoldyeAlUrbplcsnmrse,horenaatlniKlswiimtrupoyassoyseavsehco,PaeaotPiwtsinesonudgrmyaameynpkakhdctdsotespspiOS$CSihchgvlvraoaeaiiooisoaonnnliopnroaoiomEvrritonibnoBogsyogrkpiatinnteewbwnetaetdilgoaueoi8svsoeonaaaaesuharBgktiseiipgrngaeaeonccdedereahrtonrnsmeslewrTrdeaairpnpniaitgtrddgereo3nhawlwhemrlwhlht,olerniua,auanloycdrdceeeotttfnaateliuoaffhsktenddeeiyqlibhmwedodiairoucscsece9mslrereghyopoaerbrSiipierrsorshccllbNNdhemLPeosnntwltotuherevvevoeeeipahslgnnewoioaao.ncvippkhhpp,vaekfahhthieivguudielsmruUaam0beedddapela.aoaaemaIrtsitksereieiolapdliirnoeeipbapeaoDlhricomaocunuiesFVpdmalpr,o,iudllstreresirnba0dnbonlneaorsivtvnvroeotisiotiaodraomdaneaaasPmtctmiulmmepgrpdrnqnenehilldontoouyeuieeoge0uevyydfidce,5iollreo.drioiIadkonksnuvtiarptfmupdeseanoemaqtnlitkqpksordsacndbiNliaeEPkastssakhaaklgwmyfw2aTlehelksota1hrnmsnwnaanioeslrhhlrlaetpiirtsteiouioaBCSpni.sasdencssasnCSOyruitlipgPeoningttinntoaa5RvrhpsewnsietishhnsonnaastGrihaeiv(anitanngnogoaaenoneecDnntdao(cnntenasuotoooygcrrtdaeuiriSC3SOa8eop.cbiectbteyosetnhowigndcrhnaridviofesBfi0nrsodreerihuetoPa,atoscssrlusfeuadalnSC3OSemokrtdaneassMnrdiureeaoemoiidudensuisedunhwurcgowrivBniooeec1tS4aronNStitootwttmpnautenommtdeogemaeledastosetnAbadttaasctiditlocuihdoeipwggopwhrosbeawacbPEnlchont5twP0dsehedtreabPamunrYrpetltnrrerpoPcenpn.aahpcmmoeeruapiefoeeetotelouaoaapiepgnoec,ialoerp7ePeaMebs0pdsdmrornsdroXpdorooeroPoolieeparrlsrrtlmpvsbaNopoeeoporosliodtn.bnnert,liipn.eedietubon9idanaonoadrbTerknesduornot3oecdaocgcnlgrmobeeoe0adntomaaoahrnkEdtaaa1iyibpooyciadspdacae5taatabneakDdBrncitwttwloBinUbwUuADaa4ap.tgs,ntreinlleHtrlmbnefruttn4p5a0iukttdvieadylictas2so,kritycme5L1ncaip0iCncerUA4UnblnapclcLneoasrdd.odndsg0lwwsA4UUblpnalcctsnOalaphneatwutiwrrepeiofPhaieaaonoora99et5o0ylpnleaaoonnl22aeissptonnbtyelunrvke1akiiwenowpuneu4EvrrebaanwosudoPvcnarbatigd9brstdrodahdonvono1onePiegl9toldvsnrrPnsapnt8tmusilPn0ews5agsqeeseeoPnsrsapieohtsgdacntdkec0aaeslarpetr5atwUnldldi1cnaeen4trlsweilcc–lconndidlvsuhstritrahlMee1odqhltesrwheasa8lrMioaiiqhlonoirookta)naSseFlnfoMnil-o14a.lurrktanrtpenkBltnaM0noii.odsitpleFsaiLtieersgdt88ilavgds3Fdrikuaibtea0stadiohetvgsdDnrudwMioadawdsleFbooDrpmuTswaPc5e0cd0oheo3erresp.nnoswDy14weeeediontrsntrkttieieseiornon,eiipll)tnPacealiodrnvitltnl.5rArEaeaosnrvacsbiotw.lyh.nboAe7erontsletont0tcreteeasoItnpnt5e5tf0altaia.nawe4wddTioi1hi4oasaswrlbwnTiitiadgtoshwmreeporcnlcybd,d3Vltrtwposntroroaceirnd9ietwnyldiwPpnhnsao.htAwn37eenhd0Ami.sSRranroesnerna1ooRneh0oshltSgonddcetologdoruectodoso5s0scooiuoltrsedt,omiciinlighoee0uqapt0aabdps,fi9.shrhawlglohos,smo3cp,siodwcnmt4ornt0weysBiepgnidKt-dv3o0thabbmodKab,tametE,tia0ooimtteCiicarnoont.nei7euiriuaa0oanhsntbtoripptakageituedo.Rapthctrr9rbiuhhono0setbutLaaeno$CBmh4roti0uodninarot0an4niwusmnetiEoaetrsrSC$hU,loaemoopic0Elrdrltrdeoteutaaaerey,idoikdreepei9adl3hotyeeintnoyientes3dmutaopmune9Hosumeturi0anesannmn1d4hrpdnsas–saotiahdhnvaami4a0RLeeTpdasuihTavatrg8ftos6twKplfinttttlatgCSS$aiayr,igeorragp0c-saprletu,caorrcuhsacioda3s8ubchi3gedoratinnoiofc1rrdncBe4fnepi–nhnlilomshees0wl3hutqBreoadtoeorwp4iunsuaaoles6iohtoS$COStiollrsetsoihaioduenos3aetnaomnElte9i05dtsLlgpo0esLptlpcw8ahoslS39vdatycocgrovdlyvnon5ueadroonilor.wnmieoioftunaaeahutrdaei9atduarbeg3h6mtEngdlbpqieAgad3seieidir9eoagbksdenronnfpymk4Isu9nslrtieea5olpkIacrtarewscaSa1aoaynSy4Snenoeahdneerseaurhht59riecob9m.4outenebVnaemcdehisleVns0wgoitregvi9terleearlPhd3sfnpawoSnnnn,anrhvrulaaoepi3pdoiwutiueoal,dshaaonT,n1neoccqbnoeruih9trqob1ahstailncP4nspIiednidoaecg9atpordaelsdg0ddSb0bonaoipo0oImedPeyinItoamllgtderkdetepht1unbeoonDhuduneesoumaye,ed3erbsenao.ligld,,roNesssbtn3aNk,ndekafyaearkswnqiSmd0amcaapt0aow8ipddltne3aoo.dam.aicnmcmsemaao0euuoralti,l0leiriirmbdleedrikooercoeeiUwuscdcl0opntdlctpcnFimllpyFpbdalalakroqttur0ntbufeah3L0awrpueem8tiuraitemootdqritsGdtosor4Gobehontaenasyrubile5utppge,gysEkli,ealloetgaho0rlo9hircnauhpuiyepstaeyodyylcu50i0iiosnlnonrannneldt5da10pneilprnapreonetaunnipiiaaplsonyssnasrtvsylclPnaIpPtoiwtr.nsdsnuaaamyfP(mynewuposkhokdwhsdsgh9eNs3lplihhigeh2ruvs(eraeseito1tgrc11oaolloBeemBnonteiooreeesgioosni5oBVtsggakpcirtnntortewwoUaeodeti0glodtttciPsoisuuaoaaoaBrsciibesi5neeugg,,Pdsogcepdciruratoninn0nto,miooslsewuselrrieapYpnYfooin3srdrsagd,n5rthhwwotritrtlenhih,aMawolcoysptddhtseeCN8uttfnanatlaoeosal1wffsbfkpndeen4iosdytdtlappeta0epiitatlruocsaeeIew,tpcpebeyeerrtinpselirtrshrccpembNdlNmaet,rhOnnsMewohttsaeevvpweaeeihogqwnona0aeepTTkehhpap1tlur4hp3tthhtuNurautonahhlsPrueaeoredddeadpttlaanaapdost3itsaQortsteiMoeiptlniopapedoasooEd0iynrrmaouioupdcmepa5p0os,llbs,esHnbacboHdnbnnoaamoprvvm.rvoott0iaionaonttuidagobaoalpurcmrimamme,prdprloonenelldbndgoeiur3ue7lecytu0edfddrrceirocoedoniardktk0sd.uvao.ihan,moycpeaisemaqaeGkikanloqedrorcidEaiapEmsan9rshstaseakppwcakgu9.3lcrhclsosntehnhriwa3pnnmlsnorlhdeatne4let0itutptriuua0iaipsesanssitsyurdgi0veilpniingrnoonnQaupltvtQuesnGserhasnrnoaantehirurnni.vr(nanns9laaveao0oogeesanntaB(doontneB4trnpa0rolkogcd4eie0esai.cbiiedocynetosbt0ntgoodsgrcranndirsfosefreioeseoarrckemogtstonr.ulallnns3eu9dadmrordeon0Saseniriurat)d1dfocneB4nnnudsu–uEdutuwElum4woeoemSrtoartoantSeie)sttaotutinoeiohcgdemladseeRtbpsas9tdasttoesdclaowprgwp8gynbwenea3whalPtbeeln.whP1spes4hbhnAsa–ilrrArtlfnripooywrs3wcsnn.eaecemieie0ieinebgtoaelotelfiapa0oeoaeeperse5napeseYdnoa0ernnadspo8oobv3,flnpaeseolst5nninEltnsd.tapo.onio.stlnd.morlpCini.3rbd,Croionttan3ooiadosrrrnooondeg0ceghfcedsbcgvtslgtaaor5mlootaaaan1amrro4aadihiodabooye4asddaettt5ascnBadr.ctetgiwweBeaana0itgreoreiAlhenrobnuHenvr3sHunetttkdditokai3tynecLfpancsanonisinnrrbeoaLrdedg1urtwdnTttup1tnrdutwribephea–urioislGboytpnnuacpiwn0nety.oedceukiiennnno1oueeehrSsoouechngddtsondrut3ihrnpcttareum3nTsdiaeegdsssirnempfctngnssape8nrlptatunpehaecasiclcrondgrhoqrhTHosaeatqehateriwt)esponecboeacr0rn3kanororltpPsesochnarto8s3ulvdeogekoactashugvdmefaoeurpBdaceldeep.oyuweordtteotatn,eeciriotroO9ohig)pntnafacintebdoasahac5bk.0onbolereno.ncedateslsowoeanalldwpheaeoluarnaabfpkrdwmehprrnledee3awarrtreirewioEnywdisafeeevodSauia9sermdeStlatedtouadoerudps1sslCrtuea,df5sfinoolagatudifwe,adigothlarnepbwrionsyept-vai0oanbt,ouany,eot.dCiidcnfatnenuceesysibritvgdyeiuathsrrbhehunoastcuyybteh3m.rotdfdauannstseesoolma,cUlrtatceay,oeair1ailhauneiemeyndoppBrentaiaeoraOdsnsapUtihrvtdctat,i,pedtdsuheBvagihtuttyergatap-cgslcorsdbpoe,aigpnoBrrdiEypnnfwihnoeueBhtldu3errpilianntslcdwdupoeefpmt3t,edtsrouewpmhlaidelonLonrtrabeodlrwaeshewdotirEtddsiedroruaowtsyrnpwsNob.epaocawrscisAiy0onoereesttnoualorodinecesohensowviebooryhsnao,wivnahutditnotuuaolaoaaieicoourooinlainoaerladeordswpconioeeimathlaoAgadm9rie3nnomoyvadaaoidaeiobnnkadrnpwcmaTfnldtwhdyremarlgnhisNegmarmeuorsseidtmlsioikeeipaomdilqunkfrenynnphmrsredqwtsbthnsmrii.cskAluhhai0npaqupynidsusnsnretadplarpitmuCnan.oannnurtydr.nnaaf(uwoaosloegheershsta(seocoglreeomvederhengiosracogrealUrutcdiuuashsscbuevr9lepdVgpiuonaCosieodsuairforsog,nrtasorognwspvdhltspuitloHswwfpnblstooiddpaapraplawssneebleotoetghpemlbcearn,eaepnwiqoodfleneetprulerauonahlodoeutinpdndlsoItaorcetdlfnTdolynorwgceenbobcodopmauia.rEifnontucasogobleurrieonaoisgi-dgregnlycdrSentdianahiaaofycsniolrenianptsrsgedpwcrsohiampueotaentedah,tpufcnWleAaoiliovpdnutlptuworaneehvuanrorpdnlvahofogsconroplalevrlaeisiytnotogsnrpesteeaiecsmpgtn.rabnuradieeetvSoenu)fcnutetobontpreistteeeatk)heochrruruGbtepasaayrhgnewlaurteeesnhaspauliryiorwewrseeiiSiunbotalfaaelsrneprrndtaybvufaltp,seoasoidrrnfimrnr,nbtldtortorsoiogt,thgsfctvrtslartebtaorosiohdaseasfvtseagleaeaarwotEnhtt,aneveteaatttbfopsasnioboodrsntgtabohuaeuwosilbtntcpnte.edcennaoiheaoerhginnortiBhceradpionauriNanffrycruedcahpiwdrsgoraToatritenesceepeceaorropouniooefoayrmlUapclceodsBelwouotoaatrmtghfodcrdbonharkbnolaedaewlwpeubamkrrheneTranwootfoveouaatmedeaootueaypaafnaretpidtedrSbvrswayensounoe.ddfatncesysyasenywumybov.efdavnosgUrrteiceuameereoaesareUctuwstr,id,leuwahyrstapdrpo,eneiyhfwuailllolranwcdpdfptt,reutmletmaborolsowdttersounndw.bodisnotteonalsoirdnaloroiabaanhtioamnutoahiiaiooalrrwkcpthaearimsevo.aiteaoiwptcpdvlfhkdryrminhrgispiismnyqrhnsrwsmshrici.nueidnycDsmto.nuseonoralosstsohoeapiihnaalurhsvslpneiianrsegrgaopvlwidornorveisoegl.onbe(BsooidtnflfeelonincuessnfcglgnouiinfacawsfwiToni-ggesrneaaiafniinugnsoua.edaeatchfanoloantwoeevhoadhcfvellattpoetnaoprnbepeevueotgspnlekoysrbrrraubtlurepnaiurrautaripdeteausorsersfaerudteltth.r,,tmobteofseinwlttl,tpeabtootosdmaouwtdatoea ueenscli The Rip April 2019 Page 10

AY HIGH LIFE IN THE HEART OF OLD LONSDALE Board rider club lease extendedd character home in the heart of Old Lonsdale is an easy walk to front and back beaches, golf course and shops and ay to a great lifestyle investment. localpremTihuemPbouiinldteLrDonavsdidaMlecDBoonaardldr,itdheerhsoCmleufbea(tPuLreBsCpo) lishedhardwood oors,highceilings,anopen replacefor eningsh,aansdacplepvlearuopdendinagQofuroeeonmsscvliaffFereCnocuhdnociolr sdtoenciosritohnandsouthfacingdecksidealtosoakupthesunorentertain. nt of thtoe heoxmteendis aitspcalcuiobuhsokuistcehelenawseithfoorpaenfuprlathnedrin1i0ng and living areas leading to a large private north facing edroomyesaarnsd. a smart central bathroom complete the accommodation. rteos,sgtoarscmeoayenTnoadthuninesrslucitmaehurestlnio,ngabencrooaihamuletl,paotcth’uaisnersmagLv,oaridgenrevehacettnirhhssdoieaoauncnlsyl1ect5hleoR0efaemuisrseeCucrmoavonluebhdneEoitrclnisiiodlgwnlaoiiynnirletsglr,apprpivinagtes.front and rear gardens plus a huge garage ideal Shed home until at least 20129. Co-Presidents Max Lazarus and Jackson Wylie said they were “stoked” by the news and paid tribute to members who had worked over many years to restore the shed and transform it Boardriders into a community and club asset. have been “We have come into presidency at a very given a new DALEfortunate time thanks to the help of some very lease of the driven members such as Ross Bird, Terry Walsh, Point Londale hgdebackmPpbueeatsadahceheGdethso,itosghdoaeallfllc'lcloeoutamsrnsedegteaotnmdfsrasuhnhaiytocipokosnetda,h”n'edtrchsaemtwwphaooigsanriedaa.nlldy Engine Shed ood oors“,Thihgehrceeilinwgesr,aenonpuenmereropulascefomr embers who set about transforming it, including upgrades nuagraedlaesclkedtshaioddeneinadagtlietlotadospotaiadhklaeauitrrpgedetthipmeersnieuvganiatonenreednnosthsreteehrrtdvafaiiniccn.eintsogttohetrathnrsifvoirnmg or replacement of the walls, floor, windows, capacity as well as Club and community use clubhouse that stands today, so we are very doors and roofing. The estimated cost of the of the ‘Engine Shed,” a Council officer’s report t and rethaar“ngTkaorfdduaelyntsopwalluelsoafthhthiunogkseegtmahraeatmgebPiedLreBsa.Cl contributes voluntary work is around $100,000. said. enormously to the social side of the Point Lonsdale community and we look forward to Apart from hosting club activities, it has “[It] makes a significant contribution to the continuing this long into the future. “Thanks become a venue for broader community events Council’s strategic priority to improve the to the engine shed, Point Lonsdale Boardriders including film and literary festival activities, health and wellbeing of the community through Club has become more than just a collection of markets and live music. provision of a range of activities and events that surfers, it is expanding its horizon to music, arts facilitate participation in sport and build social DALE and film enthusiasts too.” “Over the period of the five year leasehold, networks. the Point Lonsdale Boardriders Club have completed a significant renewal of the The Club was established in 1964 with an previously dilapidated building that includes original membership base of approximately refurbishments to all internal and external 15 – 20 people. Over the 55 years since its elements, enhancing the appearance and inception, the membership has grown to 154, including 60 junior members. dgndot.drohanalfrddcbwoasuochorksdTeedhaeinndc2slu0h1bo4psffioarsnrtda moved into the abandoned external presentation and dramatically five year period and quickly improving the functionality to enable storage . nirng. areas leading emeniagllcinomgsp,laenteotpheen replacefor oraoal nktuapntdhreeasrunorentertain. aandlaarlgl tehepurisvuaatl e north facing ders Street,ns plus a huge garage ideal KET LIVINGSBPYECTHIAELBISETACDHOG GROOMING 7 days a weeksition, looking across open parkland to picturesque Swan Bay and nestled into the sand dunes with magni cent bay t time f e rear overlooking Point Nepean and Point Lonsdale, this is a unique opportunity to secure your own special part of new The bdone owner home is o ered in as new condition and provides immaculately presented contemporary living over two tairs a high quality kitchen opens to the dining and lounge rooms (gas log re) with the added bonus of a fabulous no ... beginningseodr oiuntdoor entertaining area, main bedroom with ensuite and walk in robe and separate powder room. mmaculate bedrooms with built in robes are serviced by a well appointed central bathroom. Upstairs also features a aumnbaoliFiaonfytnuaterodttr,httfhuhfealelscyabinnleadgancdbhsa.clcFaoupnretydhwearnhfdiecaphtaulvoreeodsksigntacorlduSedwneasln.ocBkayupangdarwagoeu,ldpoplrioshveiddehaasrduwpeorobdplaocoersf,osrtobnreeabkfeanstc,hlutonpchsCStoGLAhrEErILodAAAEuiNnRSOgnTTIhNVeEorGERuaRtf,tearir awyo c a m p b e l l p o t t s . c o m . a uhwooutoofuwssmoeleisveolfsf.ered in sa Still supplying your favourite surf and beach eoeaarirrm with ensuite, labels... plus much much more... Rain jackets & winter woollies in store now aoirinted central • Flea, Worming and Mosquito treatments to Swan Bay. Fur • Quality dog food and treats introducing Minkpink, Donna Donna & Grace Cooper pdoirnttuonitthyetosasnedcudr•uenDyeeosuswirgointwhenrm•csGaopglrelneaciariastclreapannantdrgtbeloeafyaodf shifgohr quality toys conditions LAB TEN IS ON THE MOVE... all weather tely prree)[email protected]vobemur lto.wauous - www.lapetterie.com.au You’ll soon nd us at og 1/45 Hesse Street, Queenscli e and separate powder room. - 5258 1149 - d central bath5ro9oPmo. iUnptsLtaoirns sadlsoalfeeaRtuoreasda, Point Lonsda•l•e552-25525858585454414411 erb place for breakfast, lunch or dinner after The Rip April 2019 Page 11

New surf club close - but not close enough The Point Lonsdale Surf Life Saving Club is Pictured: Corangamite MP Sarah Henderson, PLSLSC Club president Matt Ponsford, club imploring all levels of government for one last members Chris Harper and Kirsten McLeod, Mayor Bob Merriman and Nippers Scarlett and Indigo show of support to help it meet a revised $5.4 Birrell. million price tag for its new club house. Building Better Region’s Fund, was budgeted I’m really proud to support this club, it does The federal Government has announced and would flow to the club immediately. an incredible job in this community,” Ms an immediate allocation of $650,000, bringing Henderson said. the total of funds raised to almost $4.9 It comes on top of $2 million pledged by the million. However a blowout in planning and state government and $2 million in donations She described as “extraordinary” the construction costs, including new building from the local community. The club itself has community’s support for the project. requirements under bushfire management contributed $250,000 to the project, which controls, means the club is now $650,000 short involves demolition of the existing clubhouse “For the community to contribute $2 million of the amount needed to start work. and construction of a new modern facility. is incredible. That is an outstanding amount of money, it’s one of the biggest community President Mathew Ponsford said discussions “I’m really proud to have delivered and efforts that I’ve ever seen from any club.” were continuing with major parties ahead of next month’s federal election in the hope of securing enough money to finally turn the first sod. “We are getting really close but we just need this last little bit of money,” he said. “We’re still chasing grants and applying for funds and we’re still getting $100 donations here and $50 there, so we’re still working on it and we’re in consultation with both parties ahead of the election. “We’re optimistic and we’re in for the long haul. Six-hundred-thousand dollars sounds like a lot of money but for a $5.4 million project it’s not that much,” he said. \"We started this journey 11 years ago and I keep on saying we’re almost there. Corangamite MP Sarah Henderson said the latest federal allocation, made under the OUR SUNDAY ROAST IS BACK! ENJOY 2 COURSES IN OUR BISTRO FOR $28 Open Thursday, Saturday & Sunday nights over Easter NEW COURTESY VEHICLE service available Thursday, Friday & Saturday nights The Rip April 2019 Page 12





Good Friday - the giving HOME MAINTENANCE continues Including • BATHROOMS More than 20,000 Easter eggs are expected to lure thousands of • KITCHENS visitors when the Queenscliff Bowling, Tennis and Croquet Club this month hosts its sixth annual Easter Eggstravaganza. Grant Rogers - Point Lonsdale PH: 0438 261954 After last year raising a record $38,125 for the Royal Children’s Hospital Good Friday Appeal, organisers have again set their sights high and are urging local business to jump on board. “We are hopeful of raising as much as we can on the day and will be doing everything we can to get the best possible total,” said Club President Rod Wayth. “The egg hunts for the kids are one of the main draw cards for the day. They’re great fun and there are literally thousands of eggs given away. The Adult egg hunt has proven a hit each year since we introduced that - always good for a few laughs and the seafood will be a hit again I am sure.” The event, which since its inception has raised more than $158,000, also includes market stalls, raffles, auctions, live music and an outdoor bar - with every dollar raised going to the Appeal. “I think that the long history of Event based Good Friday Appeal Fundraising in Queenscliff has instilled a certain degree of pride both locally and with our regular holiday makers,” said Mr Wayth. “We do receive fantastic support from local businesses for this event, as I have said before the event is a Community event and it is supported by the entire community. We are still in need of Auction items that will get people bidding and can help us drive the total that little bit higher. Obviously the best way to support the event is to come along and take part in the day, donate, take part in the activities of the day and be involved in what is a fantastic family event for a fantastic cause,” he said. Volunteers and businesses wanting to contribute can phone the club on 5258 1773. DinnWEe’VrESGOoTrted POINT LONSDALE Fresh Fruit & Veg direct from the market daily • Butcher Quality Meats • Fresh Fish • Local and International Cheeses • In-house Salads • Artisan Bread • Quality pre-made meals • A great range of liquor including local wines Plus much much more… Open 7 days 8am – 8pm Point Lonsdale Village P: 5258 4911 Follow us on Instagram:@Pointlonsdaleiga Facebook:Point Lonsdale IGA The Rip April 2019 Page 15

“You can count on my experience… when experience counts the most.” Neil Laws FREI FAPI CEA (REIV) – Branch Manager, Queenscliff Licensed Estate Agent - Accredited Auctioneer - Sworn Valuer Buying or selling a home is a major event in anyone’s life so it makes sense to Queenscli use the most experienced professional in the field at such an important time. Neil 64 Hesse Street is the most experienced real estate practitioner permanently located within the Borough of Queenscliffe. 0419583633 He has built an outstanding reputation over more than twenty years in the local Kerleys offices also area for his professionalism and singular concern for his vendor’s interests, his at Point Lonsdale honesty and integrity and his depth of knowledge in all things real estate. and Ocean Grove He is a Fellow of the Real Estate Institute of Australia and the Australian Property www.kerleys.com.au Institute, Past President and Director of the Real Estate Institute of Victoria and an REIV Accredited Auctioneer and Sworn Valuer. If you are in the market to buy or sell or require valuation or consultancy advice regarding the local market or real estate generally then give Neil a call on 0419 583 633 or email him at [email protected] OPEN THURSDAY - SUNDAY 10AM - 4PM The Rip April 2019 Page 16

A local plan for groynes stretching along Specializing in the Point Lonsdale front beach has won the Kitchens, Wardrobes, Vanities, support of locals Wall & Entertainment Units, Poppies come to town Locals back home Furniture, grown front beach A field of red poppies has arrived in Point plan Flat Pack Assembly and Lonsdale, ahead of this month’s ANZAC Day Installation and much more. commemorations. A home-grown plan to safeguard Point Lonsdale’s front beach from erosion has 0417 168 537 The mat of knitted flowers is part of a much received the overwhelming backing of locals. bigger installation, created as part of the 5000 DIGBY MORAN Poppies project, initiated by sisters-in-law Lynn Figures released by the Department of Berry and Margaret Knight in the lead up to 100 Environment, Land, water and Planning LANDSCAPES year ANZAC commemorations. (DELWP) show 88 per cent of 234 votes lodged (Assoc. Dip Hort, Burnely) online and 77 per cent of the 58 cast at recent It is currently on public display at the Point community consultation days supported Specialising in low-maintenance, Lonsdale Primary School. the so-called 8 Groyne Solution - created by low-water gardens residents Graham Slade and Chris O’Dowd. “It is a one pace by 12 pace mat of handmade Design & Construction poppies that has been displayed at various sites The plan, to reinstate groynes where original Quality Paving over the past four years,” said Principal Fay timber ones once were, stretching the entire Retaining Walls Agterhuis. length of the sea wall, was presented alongside Turf another four options. Irrigation “We will use it as part of our lessons and encourage people to come visit and see it pre A further 2,000 people signed a petition in Landscape Plans for Council ANZAC Day,” she said. supported of the 8GS proposal. approval The blanket will also be displayed at the It will now be reviewed and costed by coastal Qualified Tree Arborist Queenscliff ANZAC Day service. engineers. 0412 520 438 or Mrs Berry and Mrs Knight started the poppy 5258 1547 movement by setting out to crochet 120 red poppies in 2013 in honour of their fathers who email: [email protected] had served in World War II. An estimated one million poppies have since been crafted by people around the world, for displays not only in Australia, but also England and France. The Rip April 2019 Page 17

Opposition Climate Change Minister Mark month for an official 'Paddle-Out' protest. New advisory group Butler addresses a local forum Speaking at a recent public forum in Point members sought Drilling on watch list Lonsdale, shadow Climate Change and Energy The Borough of Queenscliff is seeking Minister Mark Butler said the projections had expressions of interest to join its Economic The federal Opposition says it is closely shocked coastal communities. Development Advisory Committee (QEDAC), monitoring plans for oil drilling off the southern following the recent resignation of two coast of Australia, amid growing concerns for “All we [the ALP] have really is what’s in members. coastal communities. the public arena, we don’t have any further information before us, but certainly [Shadow The group provides key advice on business Environment groups say areas stretching Environment Minister] Tony Burke and I have and tourism matters within the municipality. from New South Wales to Western Australia, indicated we’re very concerned about the including Point Lonsdale and Queenscliff, are modelling. Applicants must have industry or skill-based at risk of an \"absolutely catastrophic\" oil spill, experience, according to Mayor Bob Merriman. under Norwegian energy company Equinor’s “If this thing was prospective, it won’t be bid for an exploration well in the Great producing oil until the late 2020’s and by then “The primary responsibility of QEDAC Australian Bight. you’ve got a substantial transition happening in members is to provide strategic advice to the whole global transport system and why you Council on opportunities and issues related Surfers, boaters and swimmers from across want a new, expensive oil field is still beyond to economic development in the Borough of the Geelong region descended on Torquay last me, it’s a bit like the Gallilee Basin and coal. Queenscliffe,” he said. “We’re watching it very closely,” Mr Butler “Applications must address the selection said.” criteria outlined in the expression of interest application form, and applicants are strongly Meanwhile, the Opposition is promising encouraged to refer to the QEDAC terms of cleaner, cheaper renewable energy to rental and reference before submitting an application.\" low income residents under a plan to establish a Community Power Hub in our region. The expression of interest period is open from Monday 1 April 2019 until 4:00pm on Friday 10 The initiative will support local community May 2019. renewables projects such as solar gardens on rooftops, community wind farms, energy Applicants can submit via mail, in person or efficiency upgrades for social housing, and but using a new online application form on grants for community groups to pilot new Council’s webpage. projects. Labor says it will work with local communities, councils and renewable energy groups to determine the best location for the Hub, with the Barwon South West. CLARK HOMES▬ builders with experience ▬ ○Green Smart Builders ○ Quality Customised Homes ○ Architectural Designed Homes ○Complete Building Service ○Building & Planning Permits ○ Renovations & Extensions ○ Multi Dwelling developments PH: 5258 4640 - 0418 366938 [email protected] 2062 Bellarine Highway, Marcus Hill www.clarkhomes.com.au Registered Building Practitioner Housing Industry Association Member The Rip April 2019 Page 18

Train station upgrade complete Queenscliff’s historic railway station has been Pictured: Sea Scouts Virginia Roob, Matilda Alexander and Indiana Roob. preserved for the enjoyment of train travellers for years to come, following the completion of a Members of our local Sea Scouts have played their part in keeping Queenscliff clean. $600,000 upgrade. The kids, their leaders and parents spent a recent evening collecting litter from foreshores – stretching all the way from Lover’s Walk to the Ocean View car park. The two garbage bag haul The works included repairing the station included items that would otherwise have ended up in local waterways including aluminium cans, building, including re-stumping, re-roofing and bottles, plastic food packaging, cigarette butts, plastic bags… even a rusted metal bed frame. painting, replacing and repairing timber, and fitting a new kitchen and toilet. Recycling back on track for now They were completed under VicTrack’s Kerbside recycling collections have resumed company’s Laverton collection plant. heritage program, aimed at protecting across our municipality, however a long-term “This is very welcome news for Council and significant rail buildings and structures. solution to the state’s waste stockpile crisis remains unclear. the Borough of Queenscliffe community,” said “Victoria’s heritage railways are a huge Borough of Queenscliffe Acting Chief Executive attraction for tourists in the state, and these After a two-week halt, waste collection Officer, Mr Phillip Carruthers. upgrade works have preserved one of our most contractor SKM Services has resumed historically important station buildings,”said processing materials at its South Geelong plant. “Council thanks everyone in the community Public Transport Minister Melissa Horne. for their patience while SKM have worked to It followed the Environment Protection achieve compliance with EPA regulations,” said “The staff and volunteers of the Bellarine Authority’s decision to revoke a ban on the Mr Carruthers. Railway make sure visitors to Queenscliff Station have a great day out, we’re ensuring they can do this for years to come.”  Built in 1881, the heritage listed station is the oldest station building in Victoria principally designed to cater for tourists. The station was built with a large waiting area to cater for high numbers of tourists who would visit during the holiday season. THE RULES AND FORMATS HAVE CHANGED FOR POWERS OF ATTORNEY Think ahead and be proactive! If you or a loved one became mentally or physically incapable, e.g. by an accident, a stroke or dementia, who would you want to manage your affairs and look after your money? A trustee company or at total stranger appointed under the Guardianship and Administration Act or a family member and a person of your own choosing? The solution is simple – have an Enduring and a Medical Power of Attorney drawn by a professional. ITS QUICK, IT’S SIMPLE AND IT WORKS! BRUCE ARTHUR & ASSOCIATES - LAWYERS Deceased estates + conveyancing + Wills + Powers of Attorney Servicing the Bellarine and Melbourne 94311070 • 52584847 • 0402133455 The Rip April 2019 Page 19

NOBLE ROT WINE EastPOINT LONSDALE STORE AND BAR MARKET SATURDAY APRIL 20 8AM - 2PM , Bowen Road, Point Lonsdale FRUIT & VEG ARTS & CRAFTS PLANTS HOME MADE PRODUCE JEWELLERY CLOTHING + MUCH MORE Wine store and bar EGG2S0T1R9AEVAASGTAERNZAG$RAR1AIS5NEDD8TT,OO0TDA6AL6TE.00 “Proudly supporting the Good Friday Appeal” W i ne stor e a nd ba r FRIDAY, April 19th Hi from the team here at Noble Rot from 11:00am We hope everyone managed to enjoy those summer rays and 2014 - 8,000 Eggs - $21,000.60 survived the summer madness on the peninsula. After taking a well 2015 - 16,000 Eggs - $30570.00 deserved week off in March we are feeling refreshed and better than 2016 - 17,000 Eggs - $30368.40 ever for the coming months, with the arrivals of some delicious new 2017 - 18,000 Eggs - $38,002.00 wines from both local and international producers which we are 2018 - 19,000 Eggs - $38,125.00 serving by the glass, bottle and case. 2019 - 20,000 Eggs - $??,???.?? Come in and see what we have on the pour and have a glass or two... Please come and help fill in the Chef Will has been busy in the kitchen, with an ever-changing menu gap!! with focus on local and seasonal produce. The menu has been designed to suit all serving smaller snacks to larger size plates to be QUEENSCLIFF BOWLING TENNIS & CROQUET& shared. We will be launching into some very special events in the coming QCLUB months.kicking off with an Autumn harvest lunch on 7th April - 4 B118 Hesse Street Queenscliff - 5258 1773 courses of seasonally picked dishes and perfectly curated wines to match $95pp inclusive of wines bookings are essential with limited TCwww.queenscliffbowling.com.au seats available. Don’t worry if you can't make the Autumn harvest as we will be hosting a series of events on the first Sunday of every month, where we will have a new exciting theme to each lunch. keep updated with the latest events by joining our mailing list. Noble Rot’s comprehensive wine list (awarded three glasses by pGThroeeudrwommine eitNnTloaibrsnalttevliyRselocblteaorWruePWitnfoiuiqeinnluSlteyteLoLcorliouenscsrtadaanoatldfleVeBdt.ihacPbrtehoy:5yr15tie2aPha5noe8ri,n5kiN1ntn1a5Lo2towi0no1slned8daa)llgecaeRonadndb;tliEenuuJroeorspdteaoannfwewahtiounreiess. always more than happy to discuss it, his focus and wines in general with patrons. All very noble! Noble Rot Wine Store and Bar 51 Point Lonsdale Road;   N obl e R ot W i ne S toPr eoianntdLBoanrsd51aPleoiPnht:L5o2n5sd8a5l e1R1d5; P oi nt L onsda l e. P h: 52585115 The Rip April 2019 Page 20

queenscliff TREATMENT SURFBOARDS 2hr 4hr Day MENU $25 $40 $55 Choose 3 travel size BOOGIE BOARD • dermalogica $15 $25 $35 skincare products for • cleanstart facials S.U.P $40 $55 $90 $20 when you have a • c•osmeceutical peels facial from our treatment Point Lonsdale • organic facials menu in April • microdermabrasion Shayleigh • spray tans 0447 619 566 • pedicures & manicures 2•. s•hwelalxaincga&pptlinictaiantliglon • LASH LIFTS MASSAGE • deep tissue • relax • hot stone • remedial *health fund rebates available YOU CAN NOW book i online *While stocks last 5258 4233 - Level 1, frontbeachsur ire Queenscliff HffaHrbaorbuorur Front Beach Surf Hire wwww.queenscfliffdayspa.com.au The Bellarine deserves better than Scott Morrison and the Liberals. If elected, Labor will: Invest $15.2 million more into our local public schools Take action on climate change and invest in local renewables Protect Medicare and make healthcare more a ordable Build a strong economy that works for all of us 0422 786 425 [email protected] libbycoker.com.au fb.com/libbyforcorangamite Authorised by L Coker, ALP, 2/65 Madeley Street, Ocean Grove The Rip April 2019 Page 21

Thank you! Letters \"Let's keep the conversation going...\" Dear friends, We are almost at the end of our March Laps Pictured: Kari Peart and Meagan Canaway. On behalf of myself and our family I wish to for Life challenge and the enthusiasm of our Below: Olivia Melican, Tori Peart, Belle Kidd, thank you for your support and prayers during team members and the support from the wider Matilda Frances and Lisa Peart this difficult time of Michael’s passing. community has been sensational The gifts, flowers, meals and compassion Donations can continue to made until April genuinely helped us through this difficult time.  We truly cannot thank everyone enough.  15th 2019. For anyone wanting to donate please Andrew Pamvouxoglou and family. It has been fantastic to see the dedication and see the link below. Queenscliff Fish and Chips continued commitment to this important cause by all team members. The youngest was just h t t p s : / / w w w. l a p s f o r l i f e . c o m . a u / Classifieds one and the oldest, a lot older than that! fundraisers/queenscliffcoutasfootballnetballc lub QUEENSCLIFF There has also been such incredible support Lisa Peart - on behalf of the Coutas Laps for 68 Hesse Street from the local community, both financially as Life team. well as physically, with some choosing to jump We are seeking a senior person on a casual in the water along the way to provide company basis to be part of Panache Café. to team members doing the challenge. Position would fit in with commitments to family and school duties.Training is provided. Experience Autumn has delivered some spectacular days will be considered. for open water swimming.  This along with laps Please Email your Resumes or present at 68 Hesse St. being churned out in the pool have seen the Couta Team of 28 put together a massive effort “[email protected]” of collectively swimming in excess of 165 km’s at the time of writing this.  We have smashed our fund raising goal of $5000, and are currently sitting at just over $10,000, which is a testament to the incredible community we live in.  Your contributions will go a long way to helping ReachOut provide support and services to young people in our community suffering mental health difficulties.  Our hope, is that once March is done we will continue to talk.  As a community we will check in on one another and ensure that no-one is suffering in silence and the proper support is available to anyone that needs it. 2019 ANZAC DAY SERVICES NOTICE OF TEMPORARY ROAD CLOSURES QUEENSCLIFF AND POINT LONSDALE 2019 ANZAC DAY SERVICE The Borough of Queenscliffe Council advises that three Anzac Day The Borough of Queenscliffe Council gives notice of the following road services will be held in the Borough of Queenscliffe on Thursday 25 April closures for Anzac Day Services in Queenscliff and Point Lonsdale on 2019: Thursday 25 April 2019: ● 5:45am Dawn Service in the Ocean View Car Park (also known as the ● Hesse Street, Queenscliff, between King Street and the Ocean View Car Bullring) at the southern end of Hesse Street, Queenscliff. Park, from 4:00am to 9:00am ● 9:00am Anzac Day Service at the Point Lonsdale Cenotaph (March from ● Point Lonsdale Road, Point Lonsdale, between Kirk Road and Admans the corner of Point Lonsdale Road and Kirk Road at 8:30am). Street, from 8:00am to 10:00am ● 11:00am Anzac Day Service at Fort Queenscliff (March from the Please note that no traffic movement will be allowed in this area when the Queenscliff Post Office at 10:45am; assemble from 10:30am). road closures are in place. Members of the public are invited to attend these commemorative events. For further information please contact the Borough of Queenscliffe For further information on restricted vehicle access and parking conditions, on 03 5258 1377. please contact the Borough of Queenscliffe on 03 5258 1377. Phillip Carruthers Phillip Carruthers Acting Chief Executive Officer Acting Chief Executive Officer Borough of Queenscliffe Borough of Queenscliffe 50 Learmonth Street (PO Box 93) Queenscliff VIC 3225 50 Learmonth Street (PO Box 93) Queenscliff VIC 3225 Telephone: 03 5258 1377 | www.queenscliffe.vic.gov.au Telephone: 03 5258 1377 | www.queenscliffe.vic.gov.au The Rip April 2019 Page 22

POINT LONSDALE $1.59m 2018/19 Budget document prepared residents. It is a slow motion train wreck that CIVIC ASSOCIATION early 2018). is happening. NEWS That is an income loss of 20% in User Fees in We have great concern that continued neglect \"Oh what a tangled web one financial year. will lead to further drop in revenues, direct cost we weave...\" to ratepayers for the major upgrade and a loss If we compare the income from 2013/14 of foreshore access. Some months ago the PLCA asked a question budget (5 years ago) the drop is $390,000. of Council at a Council meeting.. “Was there So! The upshot of this is that the question we going to be a major effect on the Borough income Why do we see this as important when asked was answered, NO - there is no effect on from the loss of camp sites at Queenscliff Oval?\" there are millions being poured into projects in the budget. However the answer should have Hesse Street and the sports precinct? The funds been “There is no effect on the budget as we The answer was no!. We accepted this that are being used there are grant monies reduced the income projection by $410,000 due response securing knowledge that all was OK specifically earmarked for each project (with the loss of caravan sites or incomplete works in in the financial management and income for the some not insignificant contribution by Council the Queenscliff Rec. Reserve etc… ”. borough. as part of the agreement). The first answer seems to have been Recent reports that Council is looking to The income from rates and charges etc run ingenuous and goes to tricky and evasive join a group of small regional Councils to put the council and provide services to ratepayers. which shakes the confidence in the process. The a proposal to the state government to exempt The importance of income streams to Council second answer would demonstrate openness smaller Councils from the rate freeze prompted that are not grant (capital) cannot be overstated. and an understanding of why the information us to look at the numbers again. They make a quality difference to residents. is sought. “How could this be?” we asked ourselves. The other thing that has happened is the “Oh! What A Tangled Web We Weave…” (Sir There were budgeted surpluses and there was Caravan park amenities have not been well Walter Scott’s poem, Marmion says it best…) not going to be a problem with User Fee income maintained. Some are in poor condition and (the vast majority is income from camping fees need work. The residents of the parks have Confidence in the process of government at from our parks plus some income from the boat seen their fees go up 58% for Queenscliff Rec. all levels is fundamental to working together ramp at Queenscliff – Councils own words, Reserve and up to 45% in Golightly. (Refer for the good of all. If trust is lost we move to an Budget 2013/14). submissions to budget 2013/14) us-and-them situation and we lose the ability to function properly for the people we serve. On review there was a problem and it has If our Council rates went up by that much been there for some years. Income budgeted we would surely want clean facilities and better A final observation. I am amazed how from the Caravan Parks had been lowered by services. quickly what appears to be the parking at the Council by over $ 410,000 (2017/18 $2m to south end of Hesse Street has gotten underway Preventative maintenance of the Caravan considering the other end has had two plans Park Facilities, apart from being the right thing over 5 years or more to have their improvements to do to attract visitors, means major capital done… And then there is the poor old Avenue works will not be necessary. Council knows of Honour project. very well if there comes a time for major works on the parks they will have to be upgraded to Rob Minty, PLCA President the new specifications. The new rules call for larger plots, wider paths etc which all mean loss of park land and public foreshore for EXPRESSION OF INTEREST GREEN SPEAK QUEENSCLIFFE ECONOMIC DEVELOPMENT ADVISORY COMMITTEE by Brooke Connor The Borough of Queenscliffe Council invites written expressions of interest for two new industry and / or skills-based members to join the Queenscliffe Economic Development Small but mighty bats Advisory Committee (QEDAC). You may be surprised to learn that on the Bellarine Peninsula we have 12 species of microbats living amongst us. They are very small, the The primary responsibility of QEDAC members is to provide strategic advice to Council smallest one weighing only three grams. on opportunities and issues related to economic development in the Borough of Queenscliffe. During warmer months, microbats feed on insects that they catch on the wing. They can eat as much as 40 per cent of their own body weight Expressions of interest can be submitted online on the Economic Development Advisory in a single night, equating to several hundred insects per hour. This is Committee page of Council’s website, www.queenscliffe.vic.gov.au, from Monday 1 April necessary as they prepare to hibernate during the cooler months. 2019 until 4:00pm on Friday 10 May 2019. Microbats use echolocation to find their food and their way around Alternatively, expressions of interest can be submitted: their environment. They produce a high-pitched sound and detect it as it By email to [email protected].gov.au; bounces back from surrounding objects and insects. By mail to PO Box 53, Queenscliff, Victoria, 3225; or In person at Council’s offices at 50 Learmonth Street, Queenscliff. Microbats rely on hollow trees for roosting sites. Competition from birds and possums, along with the clearing of many old trees, means Applications must address the selection criteria outlined in the expression of interest that microbats may look for alternative sites in the eves and walls of our application form. Applicants are strongly encouraged to refer to the QEDAC terms of houses and sheds. reference prior to submitting an expression of interest application. This documentation is available on the Economic Development Advisory Committee page of Council’s website, There are some things we can do to help protect these special creatures. www.queenscliffe.vic.gov.au, and from Council’s offices at 50 Learmonth Street, •Provide a safe place for them to live. You can erect a bat box or Queenscliff. retain old trees in your yard. •Use night lights to attract insects. Not only does this provide To request a copy of this documentation, and for any further information about the food for bats but it gives us the wonderful opportunity to see them up expression of interest application process, please contact the Borough of Queenscliffe close. on 03 5258 1377. •Keep our cats inside. It is important that if you come across bats in the winter months that Phillip Carruthers you don’t disturb them. They are very slow to wake up and burn valuable Acting Chief Executive Officer fat reserves when they are brought out of hibernation. They also become easy prey to cats if their roost is disturbed. If possible, it is best to leave Borough of Queenscliffe them where you found them. 50 Learmonth Street (PO Box 93) Queenscliff VIC 3225 If you come across bats that need assistance, please call me on 0418 132 Telephone: 03 5258 1377 | www.queenscliffe.vic.gov.au 37 The Rip April 2019 Page 23

Gas Fitting & Roofing Merino & Merino/Possum New Zealand Knitwear NOW ACCEPTING EFTPOS & MAJOR CREDIT CARDS Jackets * Jumpers * Ponchos For all your Plumbing needs Vests * Wraps * Cardigans Mob: 0408 037 686 Socks * Gloves * Hats * Scarves E: [email protected] And - a table of specials Lic. 40157 M: 0407 345 242 0404 163 609 carolinegleeson.com.au [email protected] POINT LONSDALE MELBOURNE Domestic Anglican Church Hall Commercial The Gables, 15 Finch Street 1 Albert Street East Malvern Industrial Saturday 6 April Monday 8 April, 11am-5pm Registered Electrical Contractor 23229 10am-4pm Tuesday 9 April, 9am-3pm sally cordner W a rr e n&H ob b s Ph: 0 4 1 7 5 4 3 7 8 6 Archit ect marriage celebrant 3 D visualization www.j3design.com.au New Homes For your special day... [email protected] Heritage I am very committed to providing you Energy efficient with a quality service in order to make your wedding day a memorable and Extensions Townhouses unforgettable occasion. Commercial I am looking forward to sharing your ideas and thoughts about your special day and Shop 3-54 Hesse St. Queenscliff 3225 ensuring that your ceremony is creative and unique. p: 0417 522851 e: [email protected] LBMUIICMHILADBELERS SPECIALIDSETSSIGINNE&COC-OCNOSNTSRIUDECRTIAOTNE W: WWW.MICHAELLIMBBUILDERS.COM.AU E: [email protected] M: 0410650019 The Rip April 2019 Page 24

MECHANICAL REPAIRS Little fighter takes flight Pt Lonsdale/Queenscliff Automotive Centre By John Murray, (Steve Higgins) BirdLife Australia volunteer Full Car Servicing All Mechanical Repairs Every Hoodie Needs Good Neighbours! Fully Qualified Mechanic It used to take just Mr. and Mrs. Hooded Air Conditioning Plover to raise a Hooded Plover chick. All they needed was a Southeast Australian surf Repairs & Services beach with an offshore reef. Abundant seaweed Pick Up Service Available grows on high-energy surf zone reefs, breaks off and washes up onto a nearby sandy shore. (Local area only) Invertebrate sand hoppers breed prolifically in decomposing seaweed and provide a reliable 46 Bellarine Highway, high protein diet for the local Hooded Plover Queenscliff family. Not that Hoodie life was ever a holiday camp PHONE: 5258 4668 in their dynamic beach niche. Southern Ocean 0418 524 861 storm-driven swells hammer the coast eroding dunes and swamping Hooded Plover nests. An endangered Hooded Plover , hatched on Jardine Homes Native avian and terrestrial predators have Point Lonsdale's back beach, head beaten the always threatened the survival of eggs and odds of survival flightless foraging chicks. Even neighbouring Hooded Plovers will attack and kill chicks. Now they need modern humanity to be aware In the past Hooded Plovers adapted to these of their existence, to respect their breeding constant but familiar dangers. They dealt with cycle and to modify human beach culture when major fluctuations in climate and sea level, the visiting the Hooded Plovers home habitat. arrival of the first humans sixty millennia ago and the dingo’s appearance. Today it takes a whole community to raise a But now they are suddenly forced to Hooded Plover chick. share their only breeding territory with ever increasing human hordes of modern Happily that has happened twice at Point recreational beach users and their dogs. Lonsdale this (now finished) breeding season, For millions of generations past they and twice at Collendina. possessed all the necessary survival skills to But it only takes one unleashed dog to destroy a flightless chick and that happened three times on nearby beaches. live independently. Custom-built homes and Renovations Will Gordon 0414 354 079 [email protected] www.jardinehomes.com.au Retreat & Spa Lon Spa | WReedt-rSeaat t| 1&0aSmp-a5pm LoAndvSapnac|eWRBeoedo-tkSrianet g|as1t0Eas&mse-n5Stpipmala LonASdpvpaan0|c3ReW5Be2eo5tdor8k-eSi2naa9gt9st0|E&1ss0eanSmtipa-la5pm Advapn0c3e 5B2o5o8k2i9n9g0s Essential Lon Spa | Wed-Sat | 10am-5pm p 03 5258 2990 Advance Bookings Essential p 03 5258 2990 The Rip April 2019 Page 25

The Rip Directory David Wilkinson 0438 258 324 DENTIST David McDonald 0418599620 Queenscliff Dental 5258 2388 Ian Warren 0418 525 452 Ocean Grove Building Service 0417891122 DOG GROOMING/WALKING EMERGENCY Phil Vallance [email protected] 0417139636 La Petterie 5258 5441 Borough of Queenscliffe 5258 1377 Michael Limb Builders 0410 650019. Coast Guard 5258 2222 Point Lonsdale S.L.S.C. 5258 4123 O’Dowd Builders 5258 1634 EDUCATION State Emergency Service 132 500 Paul Riley 0408 520 981 Point Lonsdale Primary School 5258 1501 Queenscliff Kindergarten 5258 1342 Ray Threadwell 0418 525 095 Queenscliff Primary School 5258 1696 ACCOMMODATION BUILDING MAINTENANCE/HANDY- ELECTRICIANS MAN Beach Breaks Bellarine 0424 172050 Matt's Handyman Services 0418 127 028 ‘Bells By The Beach pet-friendly, Col Ferrier 52581553, 0448813156 Steve's Handyman Service 0497 331788 Ocean Grove. 0403 221 737 Home Maintenance 0431 488706 LMAC Electrical Services 0438 545500 Lon Retreat 5258 2990 John Gleeson Demolition 0419 347708 Peter Coyte 0414 520 248 Queenscliff & Coastal Holiday Patrick McCarthy Maintenance 0408 075 330 I & S Ransom Electrical 0418 336 670 Bookings 5258 3763 Coastal Property Maintenance 0404 088 500 Warren Jankowski Electrical 0404 163609 Queenscliff & Pt Lonsdale Acomm Paul Farmer Seagull Home Maintenance 0438 261 954 www.qpla.com.au 52581640/0407866568 Home Works 0422 370 145 ENGINEERING Holidays on The Bellarine 5255 1222 DCM Services 0439 355115 Laker Engineering 0418 521 199 Ruby’s Queenscliff 0407879096 Dave's Handyman & ACCOUNTING/FINANCIAL Carpentry Services 0423 874854 FENCING Brian Dalton Accountant 0414 804 152 CABINET MAKERS Point Lonsdale Fencing 0408 581 439 5257 3776 James Rush Accounting 5258 5100 Jake Masterman 0417168537 JMD Fencing LBW Accounting 5221 6111 FITNESS - SPORT INSTRUCTORS AIRCONDITIONING CARPENTRY Bellarine Pilates 0418 519655 Oceanside Carpentry and Property Maintenance I & S Ransom Heating/Cooling 0418 336 670 Kerry Pettigrove Fitness 5258 1670 0411 227105 ANTENNAS - AUDIO Steve's Carpentry Service 0497 331788 FUNERALS Kendall Antennas Carpenter Fully licensed 0418 147 174 Bellarine Memories Kings Australia Funerals & Communications 0404019781 CIVIL CELEBRANTS Tuckers Funeral Service 5255 5500 5222 3688 ARCHITECTS/PERMITS/INSPECTIONS Sue Warner Civil Celebrant 0488 053099 5221 4788 Thomas Andrews Designs 0423 298 666 Sally Cordner 52583325/0417522851 J3 Design & Warren Hobbs Architects Val Lawrence Marr. Celebrant 5258 1616 GARDENERS/MOWING 0417 543 786 Jen Lawrie-Smith 0419 121003 Bellarine Black Diamond Garden Service Tony Baenziger Architect 0412 823 488 COMMUNITY GROUPS Mel's Gardening 0429 990 850 DCM Services 04005 68629 Binder-Peart Design Pty Ltd 0437 463125 Rotary Club 5258 4723. Lawn Order 0439 355115 Lions Club 5258 4648 Ken Adam 0488 885 296 0413 202300 Masonic Centre Queenscliff 0400 553939 Jim’s Mowing 0408 357116 Neighbourhood House 5258 3367 Andrew Stephenson Mowing 131 546 Jim's Building Inspections 131546 Probus Q’cliff/Pt Lonsdale 5258 4308 0403863360 Probus Queenscliffe - mixed 5258 4428 Stuart Miller Permits/Design 0412841434 Point Lonsdale Civic Assoc. 0400 083719 Queenscliffe Community Assoc. 5258 3381 ART - GALLERIES Queenscliff Environment Forum 5258 3360 Queenscliffe Historical Museum 5258 2511 Salt Contemporary Art 5258 3988 Queenscliff Library 5258 2017 GARDEN/LANDSCAPING 5258 3645 Queenscliff Music Festival 5258 4816 Seaview Gallery Queenscliff Reconciliation Mob 5258 1722 Coastal Elements Landscaping 4202 0942. Red Cross 5258 1616 Digby Moran Landscaping Queenscliff Gallery Senior Citizens 5255 2856 Nathan Hovey Landscaping 0455 971 515 Swan Bay Environment Assoc. 5258 2559 Rip View Landscapes 0412 520 438 & Workshop Swan Bay Ladies Probus 5258 1871 0411 571 482 0419 890 082 AUTO 52581841 5258 4668 GLASS/GLAZIER Queenscliff Junction Motors Kev's Window, Door & Glazing Steve Higgins Auto Elec. BLINDS, CURTAINS & SHUTTERS 0418519078 Barwon Blinds & Shutters 52541338 GRAPHIC & WEB DESIGN BOAT REPAIRS/MARINE COMPUTER SERVICES/REPAIRS Ben Pell - Studio Paradiso Design 0406 636201 Queenscliff Marine Services 52581305, Discount IT 0439 024870 HAIRDRESSERS/SALONS 0412 460 987 Laurie’s Computers 0418 302178 Donna's Mobile Hairdressing 0408 565733 Ivy Creations Hair on Harbour 5258 4764 BRICKLAYERS DJ’s Computer Help 0466 564 921 Seagalls and Buoys 5258 4854 Take Two Design in Hair 5258 3451 Chris Pennant's Brick Laying 0417 543 628 OG Technology and i-device screen GJB Professional Bricklaying Contractors - Brick & replacements – 0457 363 261 Blockwork inc. repairs - Gary 0418 522928 CONCRETING HEATING BSC Bricklaying 0438 839129 Breisch Concrete Floors Classic Fireplaces & Barbecues (polished) BUILDERS 52584640 Ross Fewtrell 0488 088 258 I & S Ransom Heating/Cooling 5222 1688 0419 392 537 0403 722649 0418 336 670 Clark Homes Craig Fenby The Rip April 2019 Page 26

HOME CLEANING - IRONING REAL ESTATE Wayne’s Windows & Exterior 0408 059 616 House Care Bizzy Barker 0414 583 708 / 5258 3708 sheSELLS Real Estate Game Changers 0427 337 083 Home & Garden Maintenance and Whitford Property 5254 2444 WATER PRESSURE CLEANING Domestic Cleaning 0412 107 558 Bellarine Property 5255 3100 Gary's Gerni Service 0405630076 HOTELS - RESTAURANTS - CATERING Brian Capp – Property Advocate 0418 500 483 Fletchers 5258 2833 WATER PUMPS & IRRIGATION Benitos Meals & Catering 5258 1131 Kerleys 5258 4100 Just Water Solutions 5258 5193 Saltbush 5258 4829 Campbell Potts Real Estate 5258 1579 0438763462 Lix Ice Creamery and Juice Bar 5258 4564 Rob Hendrey FAPI CPV Mint Catering 0400 611 966 Independent Property Valuer 0418 314 760 Advertise your business in the Rip Trade Directopry for just $70 for 12 PikNik 5258 5155 Jeanette Ernst Licensed/Conveyancing months - FREE with any 12 month Let's Torque Food 0423 844806 0407726260 advert listing LEGAL - SOLICITORS RT Edgar 5258 1811 Peter Boyle /Lawyer 5258 1084, 0402 282190 RETAIL - BUSINESS OUTLETS Bruce Arthur/Lawyer 52584847, 0402 133455 Basil's Farm 5258 4280 Phone 5258 4131 or email [email protected] McManus Lawyers 93184188 Farmfoods 52584744 MEDICAL - HEALTH - MASSAGE Queenscliff Grocer 5258 1857 IGA - Pt Lonsdale 5258 4911 Point Lonsdale Health & Wellbeing 52584633 Lonsdale Tomato Farm 5258 2665 Day Spa Queenscliff 5258 4233 Labten 5258 1149 Sally Low Feldenkrais/Physiotherapy 0405170090 Point Lonsdale Newsagency 5258 1159 Point Lonsdale Medical Group 5258 0888 Queenscliff Village News 5258 1828 HENDREY Greg Sly Optometrist 5256 1295 ROOFING CONSULTING PTY LTD Pardeys Pharmacy 5258 1817 J.R Chapman Roofing INDEPENDENT PROPERTY VALUERS Point Lonsdale Pharmacy 5258 1116 0421962111 MELBOURNE Point Lonsdale Physiotherapy 5258 4633 SECURITY DOORS/FLYSCREENS GEELONG BELLARINE PENINSULA Petrina Tierney Massage Therapist 0429 380 317 SURF COAST MOBILE PHONE REPAIRS Screens Direct 0419 507 484 An Independent Valuation service providing comprehensive Bellarine Mobile Phone Repairs 0429 123756 SIGN WRITING valuation advice & reports PAINTERS All Signs Signwriting 0417 345 110 for all purposes including Steven Flynn 52555667/0411 126291 SPA & ACCOMMODATION Capital Gains Tax D&B Scarff 0417 389627 Superannuation Daryl Nicol 0408 596 241 Lon Retreat & Spa 5258 2990 Family Law Trevor Pigdon 0418 524 228 Internal Accounting & Transfer Ricky Moore 0438 717 552 SPORTING CLUBS 5258 1523 Estate & Probate 5258 1257 PLUMBERS Lonsdale Golf Club 5258 1150 Mortgage Valuations Point Lonsdale S.L.S.C. 5258 4588 0418 314 760 Annandale Plumbing 0408 037 686 Point Lonsdale Bowls Club 0409 562 976 Q’Cliff Football/Netball Club 5258 1773 [email protected] Bellarine Peninsula Plumbing 0458521352 Q”Cliff/Lonsdale Yacht Club 5258 4588 www.hendrey.com.au Queenscliff Croquet Club 5258 3272 Geoff Ray 5258 4989/0418 373 026 Queenscliff Sporting Club 5258 1773 Point Lonsdale Tennis Club 5258 4344 Golightly & Sons Plumbing 0418 524 268 Queenscliff Bowling Club Queenscliff Golf Club Grant Priddle 0455 363603 AJM Plumbing Service 0418386916 Mark Riley Plumbing 0418 100 689 PICTURE FRAMING TRAVEL - TOURISM - FERRY On the Point Picture Framing 0439 563355 Queenscliff Visitor Info centre 5258 4843 PLASTERING - RENDERING Queenscliff Sorrento Ferry Service 5258 3244 Plaster - Bryant 0405 252103 VET - ANIMAL HEALTH Patrick McCarthy 0408 075330 Bellarine Animal Hospital 5258 4862 POST OFFICE WINDOW CLEANING Pt Lonsdale Post Office 5258 1159 Peter Macmillan 5258 4248/0415 493302 5258 1579 . [email protected] The Rip April 2019 Page 27

Borough Bulletin April 2019 Cr Bob Merriman AM, Mayor, Borough of Queenscliffe emergency listing of Shortland’s Bluff 11 Sea Scout Cubs, plus leaders and was based on incorrect statements by parents spent the evening collecting litter It’s no bluff, Council welcomes the applicant. Council has an obligation from the Borough’s foreshores, starting Heritage Victoria decision to deal honestly with Heritage Victoria from Lovers Walk and finishing at the and advised them of the factual situation. Ocean View Car Park. The litter collected In a recent post published on a local Council has a strong working relationship was made up of a variety of items that community group Facebook page, it with Heritage Victoria and supported the may otherwise have ended up in our was incorrectly reported that “Council subsequent due process for the heritage waterways, including: wrote to the Commonwealth Minister for listing of Shortland’s Bluff. the Environment seriously bagging the • Aluminum cans, glass and heritage values of Shortland Bluff to stop Shortland’s Bluff is a renowned area rich in plastic bottles a National Heritage listing proceeding”. maritime and defence history and a critical site for the preservation of indigenous • Plastic food packaging The incorrect statements made regarding plant species. Let the record state, Council • Paper (tissues, napkins, newspapers) Council in this post are misleading and welcomes the inclusion of Shortland’s Bluff • Cigarette butts a misrepresentation of the facts. The in the Victorian Heritage Register. • Metal strapping application to Heritage Victoria for the • Rusty metal bed frame Cubs lead the way with • Plastic bags Borough clean up event • Dog poo bags Members of the 1st Queenscliff Sea The Cubs collected two bags of litter and Scouts Cub Scouts recently organised and one bag of recyclables at this year’s event. participated in a litter collection event to contribute to Clean Up Australia. Council congratulates the Cubs and their leaders on a job well done. A job well done by the 1st Queenscliff Sea Scouts Cub Pack. Back: Daphne, Matilda, Leah and Jacquie Johnston (leader). Middle: Tom, Council’s half-year report card Josie, Indigo, Toby, Monty, Indiana. Front: Thomas and Virginia. Contrary to the report by President of the Point Lonsdale Community Association, Mr Rob Minty, published in the March 2019 edition of The Rip, Council has completed a number of projects during the first half of the 2018–19 financial year. We have completed 20 new capital and asset renewal projects, including sporting infrastructure improvements at the Queenscliff Recreation Reserve, construction of a new roundabout at Point Lonsdale Road and Ocean Road to improve traffic flows, and a new pathway on the Bellarine Highway from Nelson Road to the school crossing to improve pedestrian safety and access. 50 Learmonth Street (PO Box 93) Queenscliff VIC 3225 | Phone: 03 5258 1377 | Fax: 03 5258 3315 www.queenscliffe.vic.gov.au The Rip April 2019 Page 28

Our achievements to date are detailed Federal Government acknowledges the Get ready for Council’s 2019 in the Council Plan Quarterly Progress value of Surf Life Saving within the local e-waste drop-off day Report, presented at the Ordinary community. By rebuilding the Point Meeting of Council on Thursday 28 Lonsdale Surf Life Saving Clubhouse, club The Borough of Queenscliffe’s annual February 2019. This report reinforces members and the broader community e-waste drop-off day will be held on the importance of good working will enjoy improved facilities and the Saturday 18 May from 9:00am to 2:00pm relationships and project partnerships opportunity to develop a stronger social at the Ocean View Car Park in Queenscliff. between residents, local community environment within the new clubhouse. organisations, Council, neighbouring Borough ratepayers are invited to gather municipalities and other levels of The Federal Government also provided the up old, broken or unwanted e-waste Government. Point Lonsdale Surf Life Saving Club with items such as televisions, computers and an additional $10,000 funding under the computer equipment, printers, cameras To read more about Council’s performance, Stronger Communities Program. and mobile phones and bring them to the visit the ‘Ordinary Meetings of Council e-waste drop-off event. for 2019’ page on our website, Queenscliff Hub funding www.queenscliffe.vic.gov.au, and refer announcement For a full list of what can and can’t be to the Council Plan Quarterly Progress collected, head over to the E-waste Report on pages 36–40 of the Ordinary Council welcomes the recent Drop-off page on Council’s website, Meeting Agenda for February 2019. announcement by Federal Member www.queenscliffe.vic.gov.au, or call us for Corangamite, the Hon. Sarah on 5258 1377. Point Lonsdale Surf Life Henderson MP, confirming the Borough Saving Club secures funding of Queenscliffe’s successful funding Community Listening Posts for new clubhouse application for the Queenscliff Hub project. Members of the public are invited to Council is very pleased at the recent The Federal funding will add to attend Council’s upcoming Community announcement confirming that the Point contributions from the State Government’s Listening Post on Tuesday 23 April Lonsdale Surf Life Saving Club has been Living Libraries Program and Community 2019 from 6:00pm until 7:00pm in successful in securing Federal Government Support Fund, along with funding from the Queenscliff Town Hall Foyer, 50 funding to rebuild the Point Lonsdale Surf Council, toward the successful completion Learmonth Street, Queenscliff. Come Life Saving Clubhouse under round three of of the Queenscliff Hub. along to discuss your ideas and feedback the Building Better Regions Fund. with Councillors. The Queenscliff Hub is a project that Federal Member for Corangamite, the offers substantial economic and social Next Council Meeting Honourable Sarah Henderson MP, benefits for our region. It recognises the announced the funding for the new importance of the Queenscliff Historical The next Ordinary Meeting of clubhouse at the Point Lonsdale Surf Life Museum, Queenscliffe Visitor Information Council will be held on Wednesday Saving Club on Sunday 3 March 2019. This Centre and Queenscliff Library in the 24 April, commencing at 7:00pm Federal Government funding will support preservation and promotion of our in the Queenscliff Town Hall. ongoing training and development and maritime, military and cultural heritage. All welcome. community activities. Council looks forward to working with all For more information The $650,000 funding provided by the stakeholders to ensure a great result for the Borough of Queenscliffe community. Visit www.queenscliffe.vic.gov.au or contact the Borough of Queenscliffe on 5258 1377. 50 Learmonth Street (PO Box 93) Queenscliff VIC 3225 | Phone: 03 5258 1377 | Fax: 03 5258 3315 www.queenscliffe.vic.gov.au The Rip April 2019 Page 29

Roadworks get Land buddy call Calling all young green light after rescue muscians! Long-awaited works to improve Point A 12 year old boy was among a crew of three Queenscliff and Point Lonsdale youths and Lonsdale’s Bowen Road are finally set to who spent the night on Port Phillip in a tinnie, visitors aged 12-25 with a passion for music are commence, with the Borough of Queenscliffe after being “ill-prepared” for a change in bay invited to take part in the annual Bellarine Blues finalising tenders for the project. conditions. Boot Camp music workshops at the Potato The poorly drained and pot-holed road has The trio, which also included a 21-year-old Shed in Drysdale these April school holidays. for many years created access issues for the Swan Bay man and a 15 year-old, set off from The camp is described as “a fun and Point Lonsdale Primary School and has been Queenscliff at around 5pm on Monday March challenging, two day and one evening, highly the subject of numerous upgrade calls. 11. interactive workshop,” where participants gain both theoretical and practical music industry The works involve widening, sealing and They had intended to return by midnight. skills and performance. new stormwater drainage, with $360,000 made The alarm was raised early the following “We all work towards putting on a show available under the Regional Roads Victoria’s morning by the boys’ mother. and along the way we have fun, discover the Fixing Country Roads Program. They are challenges and figure out how to overcome expected to be completed by the end of June. Police believe the vessel was ill-prepared for them”, said founder and facilitator, Wayne Jury. the westerly winds that blew up on the bay Blues Boot camp had its genesis in 2009 at the “The widening of Bowen Road will provide overnight and were unable to return to shore. Echuca Winter Blues festival when Wayne Jury much safer access for the car parks on either was in his second year as music programmer side and with a large number of parents and The crew was located by Ambulance Victoria of the festival. It’s been successfully running young children trying to access these parks. and given the all clear after the tinnie washed for several years now on the Bellarine, Also the night time access to the community ashore at Dromana. always supported and facilitated by highly- hall will be much safer,” the Borough said. experienced local professional tutors. Local anglers are being encouraged to arrange The next Blues Boot Camp will be at Meanwhile the Borough is set to commence a “trigger time” for someone to call 000 in the Drysdale's The Potato Shed on April 9 and more than $117,000 worth of works to protect event of them not having returned to land. 10.To register and for further details, log on to: two recently-constructed Queenscliff homes www.bluesbootcamp.com.au from future flooding. Maritime Safety Victoria (MSV) said having an emergency plan with a land-based buddy could The works have been initiated as a result of ultimately save lives. The plan should include past flooding to 16A and 16B King Street. details of the craft being used, destination and an agreed time to call emergency services if the The flood threat to the both properties - boat does not return and its occupants can’t be caused by an under-sized stormwater pump reached. and storage system - is currently being managed by Council with fence boards, regular “it is so important to set this trigger time, pit inspections and sand bag prepping prior to because if you are in trouble, the sooner the forecast large rain events. alarm is raised, the sooner a marine search and rescue unit can come to your assistance,” said The works will involve around 180 metres of MSV Acting Director Cameron Toy. new pipeline down Hesse Street to the Fort. Ian Warren Builder Pty Ltd New Homes Point Lonsdale Extensions 5258 2758 Renovations 0418 525452 Decks [email protected] Registration no DB - U2446 HIA no 516372 LBW Chartered Accountants For Advice on Succession Planning Estate Taxation Small Business Individual Taxation Setup & Administration of Self Managed Super Funds Other General Advice www.lbwaccountants.com.au Contact Richard Bull - our local representative 5258 3297 (AH) or Geelong 5221 6111 (BH) The Rip April 2019 Page 30

O’D O W D design + construction Reduce the stress & time you spend on imagine your business paperwork by letting Epic innovate create manage your bookkeeping for you. • Bank Reconciliations 50 YEARS OF • Accounts Payable & Receivable BUILDING EXCELLENCE • Payroll (Including STP) • BAS Services • Xero software set-up Fran Briard: 0449 168299 or [email protected] Franchises Now Available Automotive Service Centre For MORE than just Mowing! ○MECHANICAL REPAIRS Gardening, Mulching, Rubbish Removal ○LOG BOOK SERVICING ○LOCA○LTF○YRERENEEGSPIN&ICEBKTAUUTNTPEIN&RGIDEESLIVERYGuHtteeLdraJsgoneCbdTlsserBcaiFmaoorrpedmMidynOi,RngCEIg,ntoh,EsraRnpuxjporiudaserteanrm-ttcoeoePwn/iWrnWugM!onoorirFFFnkrrrwkaaannngAAAcccciNNNvvvhhhnaaaooooiiisssiiiwwwllleeegaaavsssbbbllleeeerGardening, Mulching All work guaranteedPoFolricMeOPRoCElicthheaeCnhcjeukcskteemddowing! Gardening, Mulching 131 546IOnHsu&rSedCompliantFor MwOwIIOPIOPnnnRoowHHsssElluuuii.&&jcctrrriSSheemeeeadddCCCCsnmoohhjmmeeuoccswppkktlleeiimnaaddnngott.wneintg! Expert GPraurdneinngin, gH,eMdguelcThriinmgming Expert Pruning, Hedge Trimming ExpIenrstuPrarunncien/gW, HoerkdcgoevTerimjobmsing InsuBroadnyceC/oWrpoorrkacteovweorrjkobs InsuBroadnyceC/oWrpoorrkacteovweorrjkobs Body Corporate work 131 546 5258 1841wwOwH.&jiSmCsmomowplinangt.net 131 546 131 54566 Bellarine Highway, Queenscliffwww.jimsmowing.net www.jimsmowing.net CREATIVE PLANTING RETAINING WALLS AUTOMATED GATES DECKING OUTDOOR STRUCTURES GARDEN LIGHTING PAVING TURF MAINTENANCE Award-winning quality Sustainable designs 5258 1634 www.odowd.com.au The Rip April 2019 Page 31

April Diary 6 ROSE BYGRAVE will perform songs Day Lunch is on today, featuring a fashion 25 ANZAC DAY - Three services will parade of leading Australian designer ware, from her new album The Yabby Catchers in lunch and local wines Venue: 360Q. Time: be held in Queenscliff and Point Lonsdale, a special performance tonight. The former noon Cost: $100 Bookings: 5257 4200. commencing with the traditional dawn service Goanna singer will be joined by Belinda on Shortland's Bluff. The RSL will host a McArdle, Deb Elea and Lucy Jones Venue: 13 Popular Melbourne-based folk and breakfast ahead of mid-morning marches. Queenscliff Uniting Church Time: 7.30pm. Cost: $25. Bar available. rock band THE GO SET will perform at the 26 The Queenscliff-Point Lonsdale Oxfam Queenscliff Brewhouse tonight as part of their ■ Queenscliff's netballers will christen their current Australia-wide tour. Time: 9pm. Annual Quiz Night is on tonight Venue: new courts when the football-netball season Queenscliff Uniting Churchl Time: 7pm. Cost begins today. The Coutas play host to 19 The annual QUEENSCLIFF $20 BYO drinks and nibbles. Bookings: Les Drysdale 52583849 or Wendy 5258 3165. EGGSTRAVAGANZA will include fresh 7 DAYLIGHT SAVINGS END seafood stalls, a monster Easter egg hunt, 27 Enjoy a night of fine dining and 10 Queenscliff's second annual Ladies raffles, auctions and live music. Come along to the Queenscliff Bowling Club to help raise entertainment showcasing incredible music money for the Royal Children's Hospital Good at the Fleetwood Mac Tribute Show. The Friday Appeal. evening includes a 2-course meal and drinks Venue: 360Q Time: 6.30pm Cost: $100 21 Join Easter Bunny on board a historic Bookings: 5257 4200. steam train. The Bellarine Railway will run special services today. The event will include an egg hunt and prizes.Venue: Queenscliff station Bookings: 5258 2069. 20 THE POINT LONSDALE EASTER MARKET is on today, with numerous stalls offering a range of produce, arts and crafts and much more. Venue: Point Lonsdale Primarey School Time: 8am - 2pm. Community matters The Rip April 2019 Page 32

Literary The Queenscliffe Literary Festival is delighted Festival sales to present an outstanding program of events on track for record and workshops in Queenscliff and Point Lonsdale over three weekends in May.  Early ticket sales suggest next Four Corners journalist and writer month’s Queenscliff Literary Visiting writers include Kerry O’Brien, Helen Festival (QLF) will be the biggest Sarah Ferguson will appear at the Garner, Richard Fidler, Michael Veitch, Sarah in the event’s five year history. Ferguson, Michael Robotham, Heather Morris, Queenscliff Literary Festival William McInnes, Meshel Laurie, Peter Phelps, The festival - held over three weekends from May 11th to Michael Veitch, Helen Garner Rosalie Ham and many others. 26th - was officially launched last and Richard Fidler are in high month. demand while discussions on Visit our website for more information and to motherhood, fatherhood and book tickets. ABC stalwart Kerry O’Brien, Mirka and Georges Mora are also in conversation with former very popular. www.queenscliffeliteraryfestival.com.au colleague Maxine McKew about his long-awaited memoir, will be “We have over forty among the many highlights. participants this year including Sarah Ferguson, Michael Another big coup is Robotham, Heather Morris, internationally-renowned writer Jamila Rizvi, George Megalogenis, Helen Garner and the ABC’s Meshel Laurie, Peter Phelps, Toni Richard Fidler on stage together Jordan, William McInnes and for the first time anywhere in many others. Australia. “With history, literature, food, \"Creating my first program for art, politics, family, crime fiction, the QLF was easy because word birds, seafaring cats, professional had already spread about what a workshops and a special dinner, I great event it is and writers were hope our audience will find much keen to come for 2019,” said QLF to entertain and inspire them this Program Manager Jane Finemore. May,” Ms Finemore said. Since our launch on March 5 For details and bookings, log ticket sales have broken every onto the QLF home page. record set since the festival started in 2015, “Events with Kerry O’Brien, The Queenscli e Community Market Much loved by those in our community and visitors alike... This voluntary-operated and managed community market is an opportunity for market-goers to support artisans and creatives, listen to live music, pick up quality market goods, have a bite to eat while relaxing on the lawn, or pick up something delicious to take home The next market is on Sunday 28 April, 9am - 2pm Lower Princess Park in Queenscliff. The Rip April 2019 Page 33

arts Tussock Upstairs Gallery Kids rule the gallery ! 89 Point Lonsdale Road Point Lonsdale Salt Contemporary Art will celebrate its 15th birthday this www.tussockupstairs.com.au month by letting kids loose in the gallery! [email protected] Fifteen local school children 'April 19' from our three local primary schools will take on the role of Exhibition dates: guest curators for an exhibition of their favourite works by Salt Saturday 6th April - Sunday 5th May 2019 artists. Opening Drinks Saturday 6th April 3-5pm The aim is to encourage an nurture our curators, artists Featured Artists and art lovers of the future, according to gallery director Rona Green Janet Goldman Fiona Kelly. Exhibiting along with: “We saw this anniversary as a great opportunity to involve Salt's Fiona Kelly with St Aloysius Sue Cumming, Priscilla Fenton, Julie Hall local schools in the work of the Primary School students David Jarman, Michael Ryan, Mary Tegelaers gallery, she said. John McClumpha, Pip Matthews “Inviting students to explore the process of choosing and displaying Paul Waycott, Stephen Wright a range of different art works exposes them to the broad spectrum of contemporary work that we show here. Seaview Gallery queenscliff “It is a way of both de-mystifying the role of a gallery in the community presents and encouraging an appreciation of art as a way of enriching our lives and commenting on the world and society we all share,\" Fiona said. The Autumn Exhibition “Even if we spark a love of art in just one child, it’s a real reward.” St Aloysius, Point Lonsdale and Queenscliff primary schools will each choose five students from across different year levels with a particular interest in visual arts, or who would most benefit from the experience. They will visit the gallery to view, discuss and select works, before helping to curate the anniversary exhibition that will run from 29 March until 14 April. The Gallery is separately hosting a competition for students to design a 15th birthday card, with a selection of entries to be displayed as part of the anniversary celebrations. In its 15 years Salt has held more than 200 solo and group exhibitions and played a leading role in boosting the borough’s profile as an arts and culture destination. “Altogether, we have shown the work of over 500 artists and we are proud of the long term relationships we have with our artists.” Creatives join forces Unique creations, from paintings, photography and textiles to handmade woodworks, jewellery and even shaving cream will be offered for sale when a new store temporarily opens its doors in Point Lonsdale these Easter holidays. The ‘Ripper Pop Up’ brings together the talents of some 19 people, each with a different art or craft talent. Among this involved are jewellery artist Julia Howell, her mother, highly-regarded Julia Howell's unique jewellery will be painter Lavinia Cuming and available at the Ripper Pop Up photographer Alex White. Members of Point Lonsdale’s Morning Mermaid swimming group will also be showcasing their contemporary - traditional - glass - jewellery artistic talents. 86 Hesse St Queenscli 3225 - 5258 3645 The cooperative venture will run between April 13th and 21st from 61 Point Lonsdale Road. [email protected] - email: [email protected] The Rip April 2019 Page 34

Salt Contemporary Art September Program Salt Contemporary Art September Program Sun Sep 15, 2.30pm: Opening drinks with the artist THE 8TH ANNUAL BELLARINE LIGHTHOUSE BINGE ON THE BEST HANDPICKED FINE ART FILMS AT THE 2019 LOW LIGHT FESTIVAL, QUEENSCLIFF bellarinelighthousefilms.com Tiwi Jilamara (until Apr 28) Join us with Will Heathcote (coordinator Jilamara Arts & Crafts), and artists Timothy Cook and Pedro Wonaeamirri EvEnt dAtEs Private event for patrons & donors with the artists: Fri Apr 26 from 5 – 7:30pm Public event with the artists: Sat Apr 27 from 3pm Workshops Seeking creative development? Or do you feel like trying something new but think you’re not creative? Come in to the gallery and talk to us... we have a few ideas for you! View the 9Postcards offer on our website. Purchase before Jun 30, valid one year, only four available. Images from left: Kayimwagakimi Jilamara Raelene Kerinauia Liddy, Kulama Timothy Cook, Wai-ai Amintiya Jinani Janice Pungautiji Murray, Parlini Jilamara Barbara Puruntatameri, Tokwampini The Bird Jason Palipuaminni Stormy, Yirrinkiripwoja Pedro Wonaeamirri. 81 Hesse Street | open 6 days closed Tuesdays & between exhibitions | [email protected]|03 4202 0942 qgw.com.au The Rip April 2019 Page 35

arts Arabic Iraqi meal on Saturday night is included in a weekend ticket. It is this multiple focus that gives Sacrededege its unique flavour, providing people of all ages with opportunities to learn and connect, rather than just be entertained; to listen to voices from the edge and celebrate their diverse culture, gender and unique contribution to our communities. Sacrededge is a glimpse of how all our lives are enriched by diversity. The Festival is now in its sixth year, growing from 80 patrons in 2014 to an expected 250 this year. In 2018 marquees were added to the festival site to accomodate additional patrons and activities, and these will return this year. Lior will perform at next month's Sacred Edge Such growth would not be possible without Festival the generous support of many local businesses Works by Rona Green will feature at Tussock Big names sign and the Borough, and this is greatly appreciated Acclaimed artists in on for Sacred by festival organisers, the Queenscliff Uniting Easter exhibition Edge Church. Nationally acclaimed artist Rona Green and Tickets can be purchased online at www. respected local printmaker Janet Goldman will unitingqueenscliff.org.au be exhibiting their work in the April exhibition By Margot Busch at Tussock Upstairs Gallery. Well known for striking pictures of peculiar spahasonsMdpamnardoinrmae-orirtnaTesshrpetisrBeodogklsahsfAosoparPrAfntrodyelrreotmttsyuolseroaioesnurnstpossanjsustesjltust AfFoerrsttylfeousnusdoinngs bjouossttl3fit1dtęwfth(thhhhluf9iœee|5hseaeisD7BH‘vffsemtet02ǰeeg)aid0ȱmnlftibbiawaombdiolaJLwg’alsœinoasnehvsoulb5ondngfweeelGeŽua3sa.boaic3sraiaoyjTYBBTTpSicavdlŠvtusu8dthwtt1tdfę(HwtnoapnlynwBninswhuottuhhhhiluios‘eeohhhko0geF9el,isfhœdehnefirgt5yTmgheodtsuaeeimfnosai˜lruoieesB7HDh‘hrhivftwsewesm4mnevseenImhrate.etnthskn0›tr2holutǰe.ieiHtQjrg)ahkmeg‘iduȱmlnœdkcltonogo’4hedeeguaaelflsafœipuatsehvsslb5Žylwhiiaofrnsefu,enriphlgŽaduarrsoseesta.bToeem9œreoiayheukpsSnooitpveLŠrrdsi8edeparaHcwtnǰrrypnnsMslheratcotoȱsounwdiifou‘eo6xieeaevsFivpmii,,o“mshdsfnrn,tertrroonŽvunepodaecwmdotti˜llugehreiieoaorwi’e4evvhe•mrfnsastmyearagnesslsepn›t.hhbald•y.fSegstjnlnneakmeiupono¢lClœdtoro4dh.neleriaasaSuprdhsusncŽhlwaesongętneDofutrftefirer,wsodtteefeTiams9œeohsednwitkiosmllaoeouinœvewtsrearavcasiosǰowalaipStSs,hrhedi‘cȱsnkszfaucSJmfpcwGtaase6xrmaisvpviat“cnmtgsgagacterihureieoidiŽloteh.otaǰeeichntiatlwgitestevliesonolȱiaorrui,atxulvnrsiSea•ehmuniehasietsyulTTœdaet.sveldnu.hteid•eeasrfwvglomclpwnyunaacrniinnn‘wph¢tesrsyrlteaahhelattarralbSelprieQnlceeeoshelnrytayitehŽugęecDeidtrettitMleeewosftoesaerfahidx,lcsasiiotln•sitiisimarlPehdœvcelsaaese3leGtcma•ehnslnowtpniaoahro,afipdi‘fbœhrhhlsuoSeatelfdcGafpcwmJSatseyaesta-xitvfuvetntsfygrdsaeicoyȱehreaniioh5iytilaiod,tǰaeieolnehinralpbaiŠesoxvsPDitonȱinacaoroanu,aliulancilpaeeukigetrekerrwolTTœdart.vlgdSddn—aihtilhmeiasnrnwrulemaclled‘tQdfcunaccvrnntoneea‘awhwbatmsiowwloeoaunhhehutrleohrgilebirxellorlioeetlte.rirveneeryFlriyiseiŽiuoicefintreegecflwaedeehtgnrrssefoptiilysnȱgdhmdnx,alPnPirnceuo•itneiianertlcŠedhdmegla-ilts3weGem•ieddanwnioorhltaeaiifntaWtasaebi.frsodafœbsr—oSttfeotrlsec-xiehnoteFernrpueacoserdfntggrs,axtsiyutȱea,eaanor5cnomoyfiacaolnhsȱant,.mpnbnieHoŠoorixeoPeDlegpriyoanuoi˜tddaosnle,epluagcGwtokdrdergaint—moihlasrnhmevl.ouacrsu.eletar—dcnalcmakslltceeoeapwlmincsinoEitjsuodihrutArdneeelbiitbfisrnrlotsooiepTlertit.rdtevsceeFibecsrotioifgnwnsgavlwcolaverhtlo,irpsuyiiyȱsmsunnp’iPePotrsaaehb˜diieodAisowntliŠrderesogta-icutatr,aaagdidlwnrsnlninfiutpranretsiaoab.fi’iatretinsmi—gaaftnconletenlinoehrdn—npswhtacosdnefhahtg,enxdkufreoao,cmees,rhcsrayaiȱipnle,mnyseHsordddltoygytprfitie3uc˜teekeeeodiosesssslrhralGstoilhd,e,,eeaufatmocooMnliywesȱlea—temasnoepainncndp-iErlisedingehuewwntrntoitortdtcerbcecftomiacgjonsaeatvoreoipe|yntoeanpthbuesa˜dreodotiitlirrtrasjatiferiaawc—hWe-¢fcwPmjDasdldlllrygkyonoo’upeeeeecausssi’trtinmiagallllf.,anaaxnincn—n˜e˜idefha0nkrooaeescwosgyoaiinnhepDWoȃsedddžyg yo3eeeeedsssstvirrrlhs,,,3iblleŽ‘wtȱ›rkeehttichaVpANwaSȱlftwęt1thtd(rlĴȱ‘teaŽbt˜vyyshhhhhluœeadsntia.e9ioiieœeerwȱ’uŽ5qehiee™hěeehsu-cslaeeioTTQstrœtD7BHo,‘tvafa¢fh—jDcPw-eamWcwsr›fswn,cokmg,toeeŽhsmȱutetŽioia02hhrȱeanaaeǰeoxcuvn˜etei˜g)aœtnecwirdŒlwaȱpmnb›aœngcow’ssAgoaiahnnheelsaœipDȃWoderisežeževls’ oiMl’b5gdoteevinGoa›rlZbfŽęiuhsra—a.nnhe.iba.’ll,oeŽ‘tmŽwiat›yap,žrkctpSewek•htotivTŠcasrhl8ȱhdelŒHtwtnadertaleĴȱht‘•Žnmteasbotepp˜tvyyseusdhhœiŒswey‘ekiǰaosntȱviarF.oaaeolz,tȱsh—drfȱwȱ’eo’•Žteqheem™hěrwealesur-od˜ulmeees˜tltuœ’teune,hlr¢zwažewyar›eœashf4lnnivw,”homg,oaieŽrnȱa—ddeŽiosdiire›ciholeȱn˜dŒro.ln.rwrtj›tlfarœtnkmecwnrŽŒwarp-alœtdb›oœelocŽ4syhtA•gtiatytahtŽažnduetapžiseotts’M’œŽ’hwrgwuidietwo!Goȱffuor-›it’bęȱlar—ěsnheee.bsw’n,aȱȱTies˜m9œumoŽonsaypRl,kžict’/Šoo•oTomrlrletŒaeraŒtstdoaǰsltaeeoœhtȱp•Žt—wahwproeeggpppȱse—nFdhiiŒfwiukiiŠǰn6hx,ȱarsvpaȱlcztȱr“m—urnstȱceooattn•ȱSrsmeouhrŽalre˜au ie—–ceeettcogukh’o˜enaaae¢zeeooežeiyarœslhnflinomet”h•miatoylnh—dddAedlȱinȱr.ordnhcwrmd—oed•.˜dsŒro.Šfgrao›tnŠar˜utSŽpre¢adkureŽhyt.n•htefytdŽhŽožnSrŠptarnMf‹ottœs›h’elhwuleiw•gęe!sDȱtwipti’afȱaeȱzwěoeaav”bKewenŽŽfȱȱi˜su’iansnlyhRsŒrhismiwp’l/Šœvepst•tleŒeiKcaryi›ȱsoowslaeŽeoœaȱot—wv•,aa’egghpaki‘oc—eFsiaiirŠtĚapaswfJtSGmce¢,era,aŠGfJnatwopaiDlpvȱcȱdvtrnsouMastmccaalnȱiShrehtianihhraoeie’wtspeotsǰ ii—–hnaaŠlcœotrȱkhkbo˜eiŽfsaevoeinleneȱŽiaorru,arnultnleoiulonttamemouiecreatorœlhTTœdrtȱs.AvSOLlwd¡ȱredntimldek—eyena.eœtsasrrŠwtolmcliotnǭaŠnounc˜urlntnnlŽl•na‘wddrhSykusalesbheatu’hhaǵe.srnlnuielsrdy˜hlŽ•tseoleŠumenMfk‹teœt‹u›oceinryynilejetŽue•ras,csldȱeoiatretȱhumpeSGaaheeȱciuznt—ssfaadt”seǰŽŽhsedx,loas’ilithl•oh•isŒtglidwiwaopȱvraPehidtlpromt•tados3eteiŽepiGeemr•yei›ȱegnisynoŽ hteanva•iau’honksdiho.fbœclrcoStieZrftĚtw¢aek,trȱ--xiŠirpttp.M”ȱuefhovofgrMsleaiyehtgȱeahnoguii5sAilreye,œw’phmisaosolnu’uŠl-œaȱpbiŠŽ,oauxPDnttei˜Žawouranelieatelo'˜loinpttshegkrttœk-huirȱssalncgL¡nl—ali‘hrlkeyhmmenuaœcruncrtr›uhodlS,itgroyadǭlacacrȱnŽlt•eeagwmtMiotentomtu’beǵhtsdutd”arneicelsȱ˜iybissŽkarluomaop›inra,ilhtuoœo‹.rocveFineŠsoaisȱfnȱehgdopstlwialethœtc’kErst—ŸstiiyȱǰrmGvnsoPaaPlnrues•lueoeetiȱŽeriwgoAtnatlŠsaoo‘etgreal-itadoaaŽyti.d‘lhwnva wlPtsiivafnstartosau—bif.n.rwr.sli—hcerrwZsftttwlkon˜leȱspoe›rn-fp”acosneov˜ktȱg,amlrtsaxteuathehaoa,ourcslr,,œiart“ȱ¢a’iniei,mni™seHSŠrogreuodleig˜priingauœnehlu˜tsedneliesoaeso˜nuliawGtottkTȱditeJea˜laltmlotbc‘Phanlȱlcncs›eedule,miasgs—h-lioafmsrdȱtoeupgfnElirlȱncEentasdsmh—ikdc”anMuceeȱe˜atarein,Žek˜tttoio›,eraaertdt,ei’becŠbsrodpipghaAnsoodoavt”aoeeeŽrœ’oixssspŸcy›ttafGanpslruscan˜deeȱŽodoonsiraoa‘Rrsrȱȱȱȱtttelatwtrwaatdad.‘tllŽlrapnPupreo—gauueit’iotitwitnomiorrwgiraiesftnl˜ninn›on—noeedee˜pfkhahvmtnkrrsrhehaoooaeeshmsirrwnyka“i¢e™ysrdddddddnlniygyigoœeh3eeeeeeeeeeeiesssssurriat.llTlȱt,,,J.,.˜oaȱlȱmhiotnlȱh—kcn˜i˜tte,i’dphoo”eeeŽsœs›lmBiLtcslsctBaLLȱȱȱȱhmj—PW¢weDcsfw-acAMPSJPsiaficweNnohhuuuoaatnsaaaooxoeieicun˜he˜ixnutwrrcoaggeepcwosmgTQD“MopppinnhaillptWDȃohrrweižpiiGOT oacoddtelltvinehhcWrnsiahsrthpprQibllaalhnehŽ‘eruwt›tlhrmrkirheeoehtictitocitttcaSȱtLloaarrCcerolĴȱoo‘sgptealŽnbhthh˜eievyMyLpeshœtreataMnsliitiat.olocirlinurrrwhȱh’ŽdfnnhoAeeaqheeu’™hasěaeoiegus-lenriloitœtt,rttaneasuaer›agf,nnnnFsat,treortmgeeee,omemclŽunȱeŽiooicsineȱqnliuetxalptshsœtnrsCcigwnrŒawpoob›qtœisestcFAMsWgaRthduahtdeesažnctGmnei’M’wthgpegeicndGouuelu›bhvęeb—a,rnhn,le.y’ne,eiGdumŽutap,tžiectisrPi•aoaTbtnbtrliFiaeeaŒhtosnaeRtathefahtn•ŽoaoitloempsepneedlhlŒwkoiefǰihtȱ,eltrrswiaonlzntȱtnr—lfLȱeivteot•”trub’osmlrlFoPgalr˜dudhetevnerettoo’tesnGe¢izempsžeya,pœshniesini”uhuirdoinetib,rn—ddurMdsieerruccosv˜dŒroln.trjhrh›auareycisŽParnasmlun,rgMferasŽlynt•tytinŽgeežCntaacotoeelttiaiœQio’hnbwunsiwta!ȱisxitJ’efeioȱnatxněRthtbtwnnNahȱlȱo˜alv.unsooyvfRufaliiumt’/ŠihsoAtxdNolufhŒfeegoi.slleoœȱntot—wdaeeapenrggparc—lFciiliehŠnoei,ua7sgAȱiecwrSbiyugssotneucpagnȱSoeolhcebev Giv—–esvcoi,khgoS˜ealreWeunterlimv0loebrntomunceioiahirAsiElȱohnTȱreadnmd—e.swnŠriatvonl0trsŠHoi˜utisesssrkushairlec.nanelasdtPhosŽt•i.Šg0nMfi‹Midncdelt›lmlea•istrtygctnpsutasaslȱazrefaao”eSŽrŽale.oha’ielgihesŒauwlpitshlaceptl•tlideeipporyi›ȱaineinŽJtwedra•csrl’nyhakiocsov.fllritĚoa¢o,rlŠEpr,yrnxȱspeoorMatnainfsittohietew’spstaepiŠarœiȱitnEŽShMrtonveŽDiurPeoteodolo3nwtiesLœydndȱes.L¡a,lkaeynanHœrpderteoosPirgǭrrunnlŽ•atanigatu’nnǵss.tnielsi˜t.ndisiteSutlfmgtœh‹rSocunmnservotzsi,ȱoygeȱAheoaeecrt—iǰttnsoealai•otweoȱcilra,ztPesttrrsradotlŽs woaditu5vvgithduohink.ha.eleceptFZdfwkeȱinpahn”Fsnovȱtaheasepfeulsral,rt,œee’aohhiaceŠucKiJeiuH˜ghautylyeeiso˜Cenyiettksasocanlrrclyȱl‘e.crS,nct›aMvd,inelauiraȱtfogktaoroeenuifmnde”samcaȱiwrbŽkoo›6Beq,vdbmf2ldnŠsrvrnwdortmtcœ’asŸiitpnetwGsudaele0eȱ.eŽaonsaiaaoW‘icdhelte.a‘lŽanPdtArlnlrot—giit,wnniolrrwnastn˜ls›nehunipeh˜ksmghaohacurisAnwwln“¢ow™LsydoigtœraeihelieruaaaaiarlTȱttJtgc˜iH’uaaoaiȱploeniidwoamhiisioeftinnnntnnlȱinknnh—hknncntdauht˜wa.ir˜atratrseei,i’ddddhtodphseeooddd”eeeŽilrtggksœstt›eelllsslll,,ȱȱȱȱ usceelnifsfc.clwoifwmf.wco.tmhebookshopatqueenscliff.com The Rip April 2019 Page 36

All aspects of Design and Construction with a sustainable outlook - Desi-gnD&esCigonnst&ruCctoionnstruction - D-ecDkiencgking - Fe-atFuereatFuenrceinFgencing - Pavi-ngPaving - Tu-rTf urf - Reta-inRinegtaWianlilsng Walls David Cordner E [email protected] www.coastalelements.com.au P 0455 971 515 Architect designed Built in weeks Installed in days Live life now. Visit us online: Visit our display suite: Book an appointment: prebuilt.com.au 33-35 Garden St, Kilsyth Victoria 1300 734 544 Complete Home Maintenance Holiday Property Management Bookings Queenscliff & Pt Lonsdale EXTENSIVE HANDYMAN SERVICE Are you looking for a from dripping taps to at packs Property Manager for NO JOB TOO SMALL! your holiday house? Tim Aston Beach Breaks Bellarine offers a fresh professional and Your Tradie on Tap personalised approach to holiday property management. 0403323670 Our aim is to unlock the earning potential of your home or Fast response times investment. [email protected] Talk to us today about our Servicing Geelong, Surf Coast, competitive rates and range of the Bellarine and beyond... services... Cheryl & Philip 0424 172 050 [email protected] www.beachbreaksbellarine.com.au The Rip April 2019 Page 37

Jill Warnecke is stepping down after 22 years In her role as coordinator, Jill has developed Drop in numbers prompts and maintained extensive and valuable records tourism review Jill calls it a day of indigenous plant species. She has also taken responsibility for ensuring that appropriate The State Government has announced By Pauline Nunan numbers of each species have been propagated a review into regional tourism, following and grown. a decline in international expenditure and Jill Warneke has been the volunteer overnight stays. coordinator and driving force behind The nursery is run by the Swan Bay the Queenscliffe Community Indigenous Environment Association (SBEA) with support Minister for Tourism, Sport and Major Events Plant Nursery for 22 years. Her exemplary from the Borough of Queenscliffe. Large Martin Pakula said the investigation would enthusiasm, hard work and leadership has numbers of plants are provided to Council and explore whether offered the best support and meant that the nursery has grown from a few Bellarine Catchment Network for re-vegetation opportunities to grow visitation and boost local boxes of plants in 1997 to the sale of 14,500 projects, while many others are donated to businesses. plants and donation of 3,500 plants in 2018. charities or local groups (e.g.Cottage by the Sea, Oxfam, Primary primary schools). New “In an increasingly competitive national and Jill leads 30 regular volunteers who can Australian citizens in the Borough have long international tourism be found every Wednesday morning hard at been the recipients of Banksia integrifolia plants work at the nursery and then relaxing with a on Australia Day each year. Participants in the marketplace, it makes sense to routinely cuppa and some of Jill’s famous fruit cake. Jill SBEA’s “Gardens for Wildlife” program are review the support we give to regional Victorian has taught volunteers to propagate indigenous entitled to 10 free plants from the nursery. tourism operator,” Mr Pakula said. plants from local seeds and cuttings which are then planted in the Borough and surrounding Nursery Representative, Guy Werner, “Tourism is the backbone of jobs in regional areas, thus helping to maintain the area’s said that under Jill’s guidance ‘plant sales, Victoria, accounting for one in every ten jobs. unique biodiversity. Individuals can purchase donations and volunteer numbers have Through this review we will the indigenous plants but most are used for burgeoned and landscapes around the revegetation projects. Bellarine have changed for the better.  Jill’s strengthen employment opportunities and dedication is unparalleled’.  open new markets for our thriving sector.” All who are involved with the nursery will Forty per cent of total tourism jobs are based miss Jill’s expertise, organisational skills, in regional areas, yet international visitors make commitment, and her ability to make each up just 3 per cent of overnight visitors to the volunteer feel wanted, needed and important. regions compared to 22 per cent in Melbourne. The Queenscliffe Community Indigenous Spending and overnight stays have declined Plant Nursery can be found at 79 Nelson Rd, Pt by 2.6 per cent and 1.4 per cent respectively Lonsdale and is open on Wednesday mornings, over the past 12 months. 9am to 12 as well as the 3rd Sunday of the month from 10am to 12. The review will be led by Special Adviser and Member for Macedon Mary-Anne Thomas. Consultations will be held in regional communities. “We know that regional Victoria has the best of everything, but we also know there is untapped potential. This review will address that and find new ways to develop and promote the unique experiences regional Victoria has to offer,” Mrs Thomas said. Lisa Neville MP “DELIVERING UUnniittiinngg CChhuurrcchh EEvveennttss for the We’re Better Together! Member for Bellarine MusMiceaslsMyeCshsyurCchhufrrcohm! 1S0uanmdaSyu7nAdparyil3frMomar1c0h’ish BELLARINE” Clay PAeuotphleor, MDira/MnesJPaoctkastoonHHeiall dwiPthehoeprlen,eCwobmomoku“nBaal bPyizBzansd&” more! Tel: 5250 1987 MusAicartl,FSetnocreie, Ms,uSsiocanlgInssatrunmd eBnrtus,nRcahinfboorwATllaAmgboeusrines [email protected] Art, Stories, Songs and Food for All Ages Shop G066, Gateway Plaza 641-659 Bellarine Highway, Pancwaik$the1F5esDpaRAdaetTouolyclirnscifi“anuakeFlgnteigBlodtisupyn$sotepgh2nrfsio5raagtnas,rtissgvisaBnefeurbFcdeopCulolumigpnnordooddneAhraatscetonGerpMswtrenuoctpaeopoAa7rwppddr.nle3decaUCr0le.allpbnai,WkvumiuDetiminisnsnegSegeb(Ta”CsiBnhEta6auealvceprrroerYdamiausaapavribWysryanboid6eaylgadnLArCbandulpaemecrsts.yciswdlhJaeeoyernt6e) sMarch Leopold 3224 ServHiocley oWf eAeskh&esEfaosltleorwSsearvt i7c.e3s0pm Authorised by Lisa Neville MP - Funded from Parliament Electorate Office and Communications EEasvteerrySSoaunncedrHeaisodylweyCdaoWgmrememePIlkFGyanuleMtnomwrsiooete-ytddaPillcvuaDF&osacraismilwdTniLoeangenyna.Steu1hJ1eb0n0oerraavicanmfmiehecues6FS5stpr6uipimvd.nf3maoad0WylraaWlyM1emin9d1euenP4dAs-eonpAuisicrenppdi,ltsra!iWLldyoa1inny7se2dAa0palrenMildFarrCocnhhteBeesaech Easter SSuancdraeydCeedlgeberaFteiosnti1v0aalmMSauynd3a-y521 April Funeral Care and Advice. KLnioitrIt,ninMfCogFo,oajGWomdrJeaAmouekKunjkuuAnpnMen,liunfSToti1aRdtatah-yvyile4ncae&ifgeDpgrdeBeDmuhisCCndll,aatalnisiNyucEvrree/kcbaadEGcrlmlSgveo26roeieniopspl1fnadtmuFm-aai4nBpeTzrgpftsew,suo,mtTnetuemioiasvcsreplqotkaudakheienlasslyKtnTMtyisachusSonatoaeoanadyannsntnlAW,u3dmidndPr-alee5dlaiyafddanovsdenyuyiraaesarmtssiwhgdoeTaOrbhye’sTsu!ituresa.dmaays Living on the Bellarine Peninsula, ReBgouolakrGGraotuhper1in2gmsd&-2GpmroufopusrtohpFernidtaoysAll Funeral Director Simon Hamilton is available to assist you with inPerspectiveCoAmrtm1u1n.i3ty0aDmin-n1e.r360ppmmwfieresktlyTohnuWrseddanyessdaatyPs oint Lonsdale funeral information, options and FeineSPlTaMeGhMtruisino1rorpdddv0oeKiaF.fdcen3uyrt,i0iCilstdvnStaleaiuaenimynbAtgsL-gr‘s2K1Gtu!pA2irWnmrwomckcKuiet’hfssidonpvlcd&uiiPtM1tortoit-Cilehmn4aomsopgcTnimmn1eudWC1ge’mais.scr3oyeiudcnn0scrnalacredoyim(lonWssu1sdn;--cs14&iBThin1.pv3ou2otmeG0eeopopsrmkeslllmadeintGnsaaeyttfiygrtrlroSs&emKisnuaatirMsgptKTnku)d’hiru1gsrdau2kfrsPaorto-siy2uRlPcaudsprcdatpomh1ey,,i0,nsTPfiPno.tha3ouofuLto0riirPonntsr-htonmt1dLFia1sLnaoyrd.oti3nlsdLanss0aolsdeeyanadssmslaesdlaieolens advice. MFienedolfruGIclnon1ofoe0nos.dt3aas,0cnSWatdimJnibasg-o1nd!o2ow5kpm2iemn5lgcW8Mosom2oor8nindn5dlsgi4an&yieenscmaG(lutsaeswcinlihvwtuoleenwosilMtiuitnneunggrismitqniinucgsge)1gqea0runto.e3sPue0cpol-n,[email protected]idoanyss Available by appointment at our Uant i‘tKinirgksCPhularcceh’,ccnnrrWHienstesrele&y &StKoikrkesRSd,trPeoeitnQt Luoenesndsaclleiff Moolap Chapel, 410 Bellarine Hwy www.tuckers.com.au 5221 4788 Info and bookings online at www unitingqueenscliff.org.au or contact Jan 5258 2854 email [email protected] Uniting Church, cnr Hesse & Stokes Street Queenscliff The Rip April 2019 Page 38

Ambulance station a step Sports Club gym works closer commence Work has commenced on a new ambulance A new station on the outskirts of Queenscliff. community gymnasium is a Bellarine MP Lisa Neville, who recently step closer, with inspected the state-of-the-art Swan Bay branch, work finally said it would result in faster response times for underway at the region. the Queenscliff BCH Board Deputy Chair Fay Agtherhuis, Recreation “In a medical emergency, every second Greg Hunt, Sarah Henderson, BCH Executive Reserve. counts. That’s why we’re digging in and getting Director Youth and Family Service Liz BDH An empty space below on with building a state-of-the-art ambulance Womersley and CEO Shane Dawson. the Community Sporting branch for Swan Bay. It will mean even faster Constructions Club will be the new response times and more local lives saved,” she Health Centre officially was awarded the home for Queenscliff's said. opens contract for the gymnasium work - part of “We’re backing our paramedics to do what Federal Health Minister Greg Hunt has stage two of the they do best, so that locals can have peace of declared Bellarine Community Health on track Recreation Reserve redevelopment project. mind that world-class lifesaving care is on its in evolving its primary health care model. A working group with representatives from way when they need it most.” all sporting club user groups is helping to Officially opening BCH’s new Point finalise an operational model and fit-out of The new station is expected to be completed Lonsdale health centre last month, Mr Hunt the facility, in partnership with the Borough of in the second half of this year. It will house congratulated the organisation on its efforts to Queenscliffe. seven full-time paramedics, currently located deliver a one-stop health care hub. “The aim is to deliver a gymnasium that will at the Mannerim CFA station. provide competitively priced, first class facilities The $6 million redevelopment include for members of the community including The State Government has also committed to a modern two level facility housing new cricket, netball and football club players and a dedicated Mobile Intensive Care Ambulance treatment and consultation rooms and a members,” a spokesperson said.” (MICA) for the Bellarine and the upgrade of the community gymnasium. “The Queenscliff Community Sports Club Ocean Grove Ambulance Station. plans to engage health and fitness professionals “This redevelopment has allowed us to to offer a variety of programs to ensure the The average ambulance response time for enhance our allied health services, created gymnasium is well utilised across the full hours Queenscliffe is 16.27 minutes – down from 21.26 more clinical spaces, expand our dental of operation. A range of health and fitness minutes in 2014-15. For Geelong, the average facilities including an additional dental chair response is 11 minutes and five seconds. and given us a wonderful large gymnasium which will be available for public use,” said BCH CEO Shane Dawson. equipment will be available.” The gym is expected to be opened in the Bellarine Community Health is now second half of the year. Membership packages seeking funding assistance to undertake a and hours of operation will be detailed in redevelopment of Coorabin House. coming weeks. Crigan bookkeeping because your time is valuable 364159278 BOOKKEEPER & REGISTERED BAS AGENT ● All aspects of bookkeeping and Business Activity Statements ● Updating your books ● Calculation & lodgement of BAS ● Payroll - Single Touch Payroll ● Communication with ATO as required Daelene Crigan BAS agent 0416 148 861 25951362 [email protected] Kev’s Window, Door and Glazing Service OUR SERVICES INCLUDE: ● glass repairs ● glazing & mirrors ● sliding door rollers ● tracks & locks ● pet doors in glass ● shower screen repairs ● repairs to security doors, y doors and yscreens ● sash cord replacement ● windows re-puttied ● window winders Kevin Smith Mobile: 0418 519078 www.bwdgs.com.au Quali ed Glazier * No job too small * FREE quotes Servicing Queenscli , Point Lonsdale & the Bellarine Peninsula The Rip April 2019 Page 39

sport & health Pictured: The winning Division 9 team. Right: Premier League players in action. Photos courtesy Charlie Saunders Mixed fortunes for bowlers With Charlie Saunders comfortable win. . BOWLS - Queenscliff has relinquished its Former Commonwealth Games Premier League crown to old foe Ocean Grove, following last weekend's premiership play off. player Matthew Flapper's rink caused most damage, winning 34- The Grubbers went into the match as 16. favourites, having finished on top of the league MEANTIME, it was a case of all table and proved too strong, winning 102 - 79. smiles for Queenscliff's Division 9 team, feating Torquay 77/14 - 72/2. The Coutas came within two shots of the Queenscliff's Division 2 side lost to lead before the Grubbers drew away for a Portarlington 121/18 - 63/0. Massage Therapist Petrina Blair-Tierney Remedial/Sports/Relaxation/TMJ Ph: 0429 380 317 New range of summer shoesEveryone needs a good pair of slippeHresl!pful advice alw Ladies & Men’s winterSenior’s Card Welcome Ct. Neuromuscular Therapy GroNsbOy SWlippIeNrs SnoTwOinRstEore52 Hesse Street Queenscliff PH: 5258 1817 Dip.Ther.Mass/B.Ed. (Phys Ed) Helpful advice always available. Free delivery and pick-up in Pt Lonsdale & Q’Cliff daily. Health Fund Rebates Available Helpful advice POINT LONSDALE SimHelpful advice always available. Free delivery and pick-up in Pt Lonsdale & Q’Cliff daily Pe52aHceesseoSftrMeSeetinnQiodure’eswnCsiactrlhdiffWyePolcHuom:re5m25e8d1ic8a1t7ion.... Webster-PakSimple, convenient and delivered to yourWHelpful advice always available. Free delivery and pick-up in Pt Lonsdale & Q’Cliff daily. medicSenior’s Card Welcome 52 Hesse Street Queenscliff PH: 5258 1817 tablet ENERGY FOR LIFE home weekly be tak of the Stay motivated through the colder months! Webster-pak is a safe and simple the w mtaebdleictsataion1nd pc0aa0cpks.uYIltessEetthAsaotRunteSaeldl OtthoeF COMFORT easy It is s be taPkelun sat ceaachllpianrtictuolarsteimee our new range of medic Kerry Pettigrove othfethweedeaky.,TfhoirAsemascahhkdedsaeyitnofe & seaside gifts is no Personal Trainer with more than 20 years easy to manage meHdeilcpafutiloand. vice always available things experience It is securely sealed soStehneior’s Card Welcome One on One training • Group training Circuit Classes • Boxing Classes • Boot-camps medication is protected and there 5258 1670 - 0414 581670 is no chance of spilling or mixing Free delive things up. The Rip April 2019 Page 40

sport & health How sweet it is! - Coutas play their way back to top CRICKET - Queenscliff’s senior cricket coach Pictured from top left: Tom Kidd, Michael Farrell, Tom Johnson, Shane Healey, Ned Stephens, believes the club definitely has what it takes Dan Stott. Front: Max Potter, Tom Bakker, Lachie Kidd, Toby Smith, Tim Frankenberg, Ned to mix it with Bellarine’s top teams, after Rogerson. winning the A2 division premiership - played at Anglesea over two days last weekend. but our playing group is ready for this. It will be With solid batting by David Peel (45) and our younger players that will take yet another Lachlan Platt (26), Inverleigh appeared looked Shane Healey described the narrow victory step next year to keep us competitive in A1. We set to cause an upset. against Inverleigh as “absolutely sensational” will definitely not be making up the numbers.” and a result of a commitment shown all season. “I didn’t think we were gone, but we were After a shaky start the Coutas were 5-69 on definitely under the pump,” Healy said. “It was a great win by the boys and it showed day one. However a steadying partnership true character, which we said all year would get between Healey (62) and Dan Stott (72) helped Tight bowling by Healey (4-60), Ned us through.” the team to a defendable 6/217. Stephens, Ned Rogerson, Max Potter and Michael Farrell had Inverleigh all out for 200. The 17-run victory means Queenscliff will next season be promoted back into the BPCA’s A1 division - a challenge Healey said the club was ready for. “Bloody oath we’re capable of being in Div 1. The under 17’s winning their (division 1) premiership shows that,” he said. President Josh Beshara said the season and its outcome - with three premierships - had been enormous for the club’s future. “Since we found out last year that we were not going to be a part of the competition we have made it our goal to be promoted this season. We also wanted this year to be the year that our young playing group got to experience consistent, winning cricket that is where Shane has been instrumental,” he said. He has led by example both on and off the track all year, showing especially our younger players what it takes to be successful. No doubt that moving in to A1 is going to be challenging D-Grade snatches impossible win Many thanks to our guest (anonymous) roving was quickly followed by Jim Gladman (2/20). QCC, 47 runs, to win. reporter, who managed to pen this report Wickets continue to tumble quickly and the In a case of premature celebrations, ways davuariinlagbpleo.sFt-rmeeatdcehlicveelreybarantdiopnisc!k-up in Pt Lonsdalseid&e wQa’Cslsifofodnailny.trouble at 5 for 64. Newcomb fans had started singing the club song and giving batsmen good send offs Last Saturday (March 23), and welcomes to the crease. Toohey kept our D- Grade side took the field batting! e alwaaygsaaivnasitlabNlee.wFrceoemdbelivinerythanedGpircakn-dup in Pt Lonsdale & Q’Cliff daily. Tension mounted when number Final, at Collendina. 10, Tom O’Brien, walked in to face the mple, convenienty. music. Newcomb was the top side Ball by ball, O’Brien and Toohey and had beaten the Coutas twice chipped away at the score with while during the year. However, having appeals for LBW and caught behind finished second, and with a good were turned down. The Newcomb win in the semi-final, our boys crowd stopped singing. People got out cationwpeareckc.oInt fsideetsnto. uTt hailsl thmeatch had of their cars and the Queenscliff voices tkseannadtgthaceeAmaapfpecto.eshtrueplneatsirawttilchiounafnltabinrneegtiniemgdeattohveery good lifted. toss, It all came down to the last over, with e da Newcomb elected to bat first in scores level and Toohey on strike. He wetoemk.asfrnuoDapngeetresobpfmifatieeeglddoiiocgndaogot,sidosizonem.dbeoclrwuoslwitnydg.hittainndg guided the third ball to the boundary securealtytsheadledathsosathweNewcomb reach line, securing the most unlikely and ccahtaionnw7cei–esQro1epu5f:re7osBnpotesefsiclfchlliittnafehfrgedaior2ar-B4n20mod0wo,itxvShliiecnenorgrgste.t memorable of wins. Toohey finished on figures Murray The one positive was Matt Toohey, who had 75 not out and was named man of the Kiddles 1-36, gone in at number 4, was still there and batting match. s up. Warren 2-20, Billy Clifton 2-16, Matt Toohey well. Queenscliff had also managed to maintain 2-15 (off 4 overs) and Mick Limb 0-44 (off 4). Pictured: James Gladman, Joshua Beshara the required run rate. The real issue was did the (Capt.), Billy Clifton, Scott Kiddles, Steve Those at the ground did not know it at the team have enough wickets left to get the runs. Higgins, Roy Simmonds, Matt Toohey, Mick time but the fun was just about to start! After drinks wickets kept tumbling, 6 for 92, Limb, Paul Bamforth, Murray Warren, James Soon after opening the batting, Coutas’ Scott 7 for 106 and then 8 for 111. The maths was very Gladman, Julian Melican and Tom O’Brien ery aKnidddlpesic(1k/u4)pwians Pboacink tinLothnesdpaavliellioann. dHeQuseimepnles,cNlifefwdcaomilyb needed just 2 wickets and Photo courtesy Andrew Conlan. The Rip April 2019 Page 41

sport & health Pictured: the winning U/17 cricket team: from left, Lochie Philp, Jackson Daniels, Max Potter, Pictured: Elsie Chapman and Elise Franzone Harry Gower, Bryce Dunnell, Tom Bakker (c), Lachie Kidd, Griffen Wilson, Quinn Taylor, Joe Nagle, Alex Baker (coach), Oliver Skurrie, and Ben Conlan. Groms showcase their talents Best in the league fishing village on the peninsula, it’s not too bad SURFING - Point Lonsdale’s Elsie Chapman CRICKET – Queenscliff’s U/17 cricketers are to come up here and take the flag,” Baker said and Elise Franzone have showcased their skills the Bellarine Peninsula Cricket Association’s after the match. at a recent junior surf tournament. Division 1 premiers – proving, according to coach Alex Baker, that the club is the “real “It probably sends a bit of a message to Competing in the U/8 section, against deal.” everyone around that the BPCA is a bit more of all boys, Elsie clinched a third place in the a real deal than they think.” Woolworths Surfer Grom competition, held at Having posted a solid 210 runs with the loss Jan Juc. of six wickets on day one of the two-day final Queenscliff 6/210 (L Philp 82*, J Nagle 73, against St Joseph’s, Queenscliff’s bowlers held L Kidd 39, B Clark 2/33 d St Joseph’s 6-188 (C Elise made it to the U/14 finals, finishing firm to stem the opposition’s run chase. They Cannon 73*, H King 32, J Stephens 26, L Kidd with a 4th placing in a tough field of girls fell 22 runs short of the target at the end of 55 2-36). overs. Earlier in the week the U/17 team also won “We put it to ourselves at the start of the year their division’s T20 Grand Final, defeating that this is where we wanted to be and this Torquay 167 to 39. is what we wanted to do and for a tiny little Club wins Lloyd You go girl! Shield CRICKET - Queenscliff’s stellar year on Lucy Naylor in action in the recent Victorian Open Women's titles. Photo courtesy Surfing Victoria the field has been rewarded, with the club winning the Bellarine Peninsula Cricket SURFING - Point Lonsdale’s Lucy Naylor will scored an outright win in the first round, Association’s (BPCA) Ron Lloyd Shield for the this month compete for a prized spot in the held at Cape Woolamai, posting strong scores Championship Club. Bells Beach Rip Curl Pro. throughout all of her heats, with a day-high The talented 15-year old continues to carve score of 15.13 out of a possible 20 points. The honour was announced at last week’s out a name for herself in the surfing world, end of season awards. finishing fourth in the prestigious Victorian That win gives her a wildcard entry into Open Series. the Victorian Women's Rip Curl Pro trials, to Every team from juniors to A-grade - except be held on April 14 and 15, with a place in the B - made the finals, with four making the grand Pitted against some of the biggest names main World Surf League event on the line final and three winning premierships. in the sport in the three-round event Naylor A grade coach Shane Healey and Toby Smith were joint runner’s up best and fairest players in the league. James Gladman received the John Dunne Medal for champion player in D-Grade. Gladman also won the D-Grade batting average. Glen Potter was named league champion in C2 grade, also collecting the batting average. The Rip April 2019 Page 42

sport & health New look Coutas have what it takes FOOTBALL - Queenscliff senior coach Steve definitely but you don’t know what the rest of Seb Monahan (right) and cousin Luke Clark (pictured) says he can not wait for this the competition is doing, Lawrence month's season-opening clash with Drysdale, after a solid pre-season and recruitment drive. “I’d be very disappointed if we weren’t there Seb triumphs in at the finish.” family affair The Coutas are once again aiming to be among the BFL's strongest performing teams. The arrival of new players to the club, BOWLS - Queenscliff’s Seb Monahan is including Jack Exell - son of former Geelong Geelong’s new Under 18 bowls champion, after “The boys have been really good in practice and Ftzroy forward Gavin. Exell played TAC winning an all-Queenscliff grand final. matches, better than I expected,” he said. “ We Cup for the Bendigo Pioneers before lining up were really, really good in regards to how we with Bendigo League club Kyneton last season. The 16 year old was pitted against his cousin were able to connect inside the stoppage to Luke Lawrence in the deciding match of the outside the stoppage and in our structures. The Coutas have also added Charlie Pennant GBR championships, played at Leopold on from Wimmera club Horsham Demons. Sunday March 10. “It’s obviously going to be really tight season. A lot of the clubs have improved but “The new players have slotted in well, Eight players contested the event, with team I wouldn’t expect that we’d be any worse they’ve been really good,” Clark said. “The mate Charlie Saunders finishing third. than last year. I’d expect that we’ve improved guys that have regularly been at pre-season have also shown improvement. “Pre-season can get a little bit long… now that we’re starting to see where we’re at and wehere we’ve got to improve and put some effort into, we’re looking forward to Drysdale, everyone is talking about Drysdale.” Queenscliff hosts Drysdale in the Round one clash on Saturday April 6. B O OKINGOSNLAIVNAEIL ABL E Senior netballers hit the track during pre-season training \"Finals is the aim\" NETBALL - Queenscliff senior netball coach Pam Maurer is hopeful a re-freshed A-Grade team will help the side reach finals action this season. The Coutas believe new recruit Elkanah Foott will help build depth missing in previous years. The Geelong Cougars defender will add height and experience in defence, according to Maurer. “We’re really excited, the girls have training really hard and everyone is really positive.\" The Coutas finished seventh last year. Maurer, who with co-coach Kerri Maher is entering her third season with the club, believes they can deliver more. “We think that if we can keep everyone fit and on the track we should be able to push for a finals finish. That’s the aim of the team and the club, we want to make finals and we think with natural development and the way everyone is working and the pick up of Elkanah in defence we should be able to to that,\" she said. The Rip April 2019 Page 43

capp 1-4 horizontal .pdf 1 22/07/2017 6:00 pm PROPERTY Statewide Property Advocacy o ers a unique property service known as Helping Seniors Sell A vendor advocacy plan designed to help Seniors achieve the highest price for their property and also manage the sale process to reduce the stress and emotion of selling, all at NO EXTRA COST! For more details call our consultants - “Senior” Brian Capp 0418 500 483 or Andrew Sutherland 0413 052 333 QUEENSCLIFF GROCER HOT CROSS BREAD & BUTTER PUDDING Find this & other recipes at IGA.liquor.com.au Whatever your entertaining needs this Easter - BBQ with friends, picnic at the beach, Easter lunch with family - IGA has everything you need to make you Easter that little bit more special Visit Queenscliff IGA today & have a HAPPY EASTER! FOR ALL YOU EASTER ENTERTAINMENT NEEDS, WE’VE GOT YOU COVERED. 73 HESSE STREET QUEENSCLIFF - 5258 1857 - OPEN 7 DAYS 8AM - 8PM The Rip April 2019 Page 44


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook