THE COMMUNITYwww.thecommunityuae.com YOUR LIFE STARTS HERE ISSUE 41 w MAY 2015 FASHION TECH BATTLE ARABIAN DREAM Smart Watches LSUOMCKMSER- MAID ISSUES WOMEN’S HEALTH PATHFINDER TEST DRIVE LANDOFAURORA
THE COMMUNITYYOURLIFESTARTSHERE From the Editor’s desk... A Sky Horizon Media publication The summer is slowly creeping in and it’s getting hotter and hotter even www.thecommunityuae.com www.skyhorizonmedia.com for the beach, so our May issue is about getting ready for the blazing heat E-mail: [email protected] of the next few months. We’ve gathered lush ideas and serious matters, cool cars and fashion inspiration and many more stories for you to enjoy. EDITORIAL Whether you plan to stay in UAE or travel,The Community brings you Sunanda Ghosh: Group Editor great reads and new ideas. Aurko S.: Senior Editor There’s no better time to start eating healthy and exercising well and the Jule McClean: Copy Editor May issue gives you a healthy diet and some super passionate exercise Rose Hockley: Senior Reporter routine. Check out the Food section and read how eating raw will benefit Shayantani Sinha: Staff Reporter your body; the ‘Raw’ diets are the latest trend even among superstars. Indira Kasaeva: Staff Reporter When it comes to fitness, ditch a boring gym routine for some soulful Astrologer Mary: Columnist Zumba dancing – calorie burning that you will actually enjoy! Master the passionate dance during the summer months, this energizing party will DESIGN AND PHOTOGRAPHY boost your mood no matter how arid it is outdoors. Muhammad Kamran: Online Marketing, Flaunt your sexy figure in a new wardrobe.This month it is all about Web Developer cum Designer boldness and confidence in a modern Arabian desert inspired packing. Get Caitlan Francis: Designer-Photographer inspired by the gorgeous models and the unique looks.You will know what to buy to give your wardrobe an upgrade and yourself a confidence boost. MARKETING AND ADVERTISING Our cover story tells you all the implications of hiring domestic help. Jennifer Webber: Marketing Executive Maids make our lives sufficiently easier however hiring one is not an easy Gautam Kapoor: Marketing Executive process. Make sure you do it right by reading the “Maid Issues” story. Akram Khan: Marketing Executive Following the guidelines you protect yourself and your family from dangers of letting a stranger into your home. Ladies should also take a look PUBLISHED BY at Endometriosis story in the health section, to check for any symptoms of Sky Horizon Media Dubai disease and overall read about female health issues. A division of Sky Horizon If you plan to travel any time soon, why not escape the UAE burn to a Publishing and Distribution LLC snow-filled forest? Watch the Northern Lights from your own bed in an 206 Aspect Tower, Block B igloo… Discover a magical winter experience in Travel section. Executive Towers Following a healthy lifestyle, taste the review of a breakfast at Nosh, Business Bay, Dubai, UAE Movenpick hotel in JLT.Their Go Healthy menu boasts plenty delectable PO Box 7586 Dubai, UAE and healthy options along with some sumptuous dishes that are full of Phone: 050-752 7299 calories; the taste is definitely worth it. Read the review section for a E-mail: [email protected] breakfast that will last you a whole day. www.skyhorizonmedia.com The motoring section took Nissan’s 2014 Pathfinder Hybrid for a ride and were quite satisfied with the performance. Check out ‘Finding Pathfinder’ PRINTED BY for full details, specifications and the results of the test drive. Alpha Printing Press FZ-LLC June is around the corner, so enjoy this May before Ramadan’s peace and tranquillity sweeps everything over. DISTRIBUTED BY Sky Horizon Publishing and Distribution Regards LLC Dubai Want to share your experience or report an incident? Get in touch with our News Desk at [email protected] or [email protected] For all advertisement opportunities in The Community, call 050-752 7299 or e-mail us at: [email protected] Want to subscribe The Community? Please call 050-752 7299 or fill up our subscription form, scan and e-mail us at: [email protected] © Sky Horizon Publishing and Distribution LLC, PO Box 7586 Dubai, UAE www.thecommunityuae.com Sunanda Ghosh Group Editor The Community
In this issue CONTENTS Issue 42w May 2015 PAGE 12 COVER STORY MAID ISSUES Domestic help makes our lives much easier, however hiring a maid is a serious issue.While there are a few options, there is a set process on how you should hire domestic workers... PAGE 14 BEAUTY ROCKTHE LATEST SUMMER HAIRTRENDS Read expert advice from topToni&Guy stylists on how to care for your hair and discover the hottest looks of the summer from the London Fashion Week runway PAGE 20 HEALTH PAGE 14 PAGE 128 ENDOMETRIOSIS The disease that is one of the most common issues among women’s health problems. Read expert advice from doctors and learn the symptoms PAGE 22 FOOD EATING RAW As new trend and an old concept, eating raw is a the latest diet muse inspiring health addicts PAGE 28 PARENTING FURRY FRIENDS Find out why you should get your child a pet. There is more to having pets, than just fun.There are certain benefits that animals bring to children, especially at a young age PAGE 32 INTERIORS DESIGN THE HEAVEN Interiors created by a designer are beyond most people’s budget, but The Community reveals trade secrets that you can master yourself PAGE 36 MOTORING FINDING THE PATHFINDER The 2014 Pathfinder Hybrid has been tested and reviewed. Read about the daring performance of the Hybrid beast PAGE 30 4 May
PAGE 34 TECH-BATTLE APPLE VS ANDROID Fancy a smart watch on your wrist? We’re talking about the latest battle between the Apple watch and Android Wear PAGE 38 SHOWBIZ CELEBRITY GOSSIP Take a look at the lives of the rich and famous and find out the juiciest details PAGE 42 HOROSCOPE FORECAST May horoscope from Astrologer Mary PAGE 24 PAGE 16 Top picks in this issue . . . PAGE 32 PAGE 28 PAGE 34 BUDGET HOMES: PARENTING: TECHNOLOGY: TRADE SECRETS: FURRY FRIENDS: APPLE VS ANDROID: DESIGNER’S DREAM BENEFITS OF PETS HANDWRESTLING May 5
Letters to the Editor... Recipes Bollywood Gossip We had a gathering to celebrate Easter I absolutely loved the gossip section of Motoring The last issue’s Motoring section was just with family and friends and as the host I was the April issue.You pick the most interesting epic. I always wanted to read about the BMW supposed to cook the dinner. Fortunately for topics from both Hollywood and Bollywood. I M235i but never had the time to; your article me I stumbled upon your recipes and decided salute Angelina Jolie for undergoing another was exactly what I needed. Seems like a really to give it a shot; they turned out to be just operation; this woman is a real inspiration daring car that I’ll definitely consider as an right.The dinner tuned out to be a huge for every woman out there. Fast and Furious option for my next purchase… success with all guests very satisfied with my deserved to top the box office, it was Paul cooking skills (which I don’t really possess). Walker’s last story! He will never be forgotten. Andrew Adams, Dubai So, thank you for the great help! Aditya Kapoor, Abu Dhabi Interior AmandaTorres, Dubai The ‘French Connection’ gave our living Divorce rates Flying fashion The statistics were truly shocking. I didn’t room a totally new feel!Thanks,The Birdy fashion was so cute! Personally, I love Community for the great idea and much needed expect that here in the UAE the main cause of examples and tips on re-decorating. birds so I was super excited to read the fashion divorce was infidelity. It seemed so impossible to story. It was great to add a few bright and me, taking into account the restrained society Saif Mohammed, Dubai flying items to my closet.The new touches made that exists here…it was unthinkable that me fly to the summery weather. Flamingo print people cheat on their spouses to that extent.As Editor’s note: Kindly send scarves look particularly cool on the beach! I I read your story, I thought about the fact that your request at thecommunity@ noticed I stand out from the crowd. Can’t wait it is actually the lifestyle that pushes people skyhorizonmedia.com and one to see the next story of the fashion section for for infidelity. Everyone is living in the moment of our circulation executives will something exotic! without thinking much about consequences; get in touch with you regarding Tatyana Kunic, Sharjah it’s all about getting as much out of life as international subscription. possible.A really sad fact… Anjila Ahmad, Dubai READERS’ PICTURES CALL USSEENT, NHOAATTLILSCHYEOODUUOLNRDEHEBEDEATERXODPDOAONSIYESDTH?ING ALERT USthecomYmYOOUuRUnIDiCt0EyAN5@TNI0TsR-Y7kEW5yAI2hLCLo7HBr2EUi9KzSEo9PnATmTSE:CeRdEiTa.com Here are this month’s top photos! Send in your favourite snapshots to [email protected] FALLING BEAUTY: The Golden dive at Dubaii MallA-bPdhuoltAozbiyz AEPlnICuaBiEmAiUinTYD: uAbsatiunMniirnagcslehoGt bayrdNenasser Abdulla EMERGENCY CONTACTS BIG FIVE: Reflectiobne.o.f. mevoedryetrhni,nsgopthhiasttiAcabtuedDahnadbiluisxaunridouwsi.l.l. MDEaSktEoRuTmHAlUTNamTiEmRiS: The art of falcon training. Photo by Police: 999 66 MMaayy Ambulance: 999 +Fire: 997 American Hospital Dubai: 04-377 6644, 04-336 7777 Welcare Hospital: 04-800 4428, 04-282 7788 Belhoul European Hospital: 04-214 0250, 04-273 3333 AlWasl Hospital: 04-324 1111, 04-219 3000 Neurospinal Hospital: 04-342 0000 Dubai Hospital: 04-219 5000 Rashid Hospital: 04-219 2000 Emirates Hospital: 04-349 6666 New Medical Centre Dubai: 04-268 9800 GMC Hospital: 04-262 6000 Iranian Hospital: 04-344 0250
May 7
Letters to the Editor... +
10 May
May 11
Cover story HOUSE CHORES Hiring a maid in the UAE is not that easy, it might even be dangerous…Indira Kasaeva gives you the details HIRING A MAID? BEWARE With busy working schedules, an active this will save you a lot of paperwork and any legal technicalities.There are a lot of legal details, while all you have to do is incidents where a sponsor bring in a maid, social life and household duties many fami- pay the agency it’s fees and pay for all the she runs off and is on the look of a new lies turn to hiring a maid to carry some expenses of bringing a made. Another job. of the domestic load. It is a widespread method is direct recruitment where you Hiring domestic help is not an easy practice in the UAE to have domestic have to go through a tedious process process if you want to do it legally. And workers.Very often the maids not only of gathering documents to sponsor the not everybody wants to take the time clean, but also cook and take care of the domestic worker. Plus you have to make and spend the extra cash on dealing with children; that however depends on the du- sure that you abide by all the guidelines of legalities. However, there is no other legal ties that are in their contract…if there is a Dubai’s Department of Naturalisation and option because employing a maid with contract at all. And there definitely should Residency Department (DNRD). And the DNRD approval is illegal and has huge be one… third option is placing advertisements; the consequences. There are several ways of hiring a made trick once you’ve found one through an ad in UAE.The most popular method is is to make sure that you are not breaking getting a made through a maid agency;
Unless you go to a maid recruitment agency, there are a lot of tech- TECHNICALITIES nicalities that you should know about before you hire a maid. One of such technicalities is that there is a list of countries from where you can employ domestic workers.The Dubai government approved countries from where you can hire a maid are Sri Lanka, Indonesia, India, Ethiopia, Bangladesh and the Philippines. Besides that, there are guidelines set by the Dubai’s Department of Naturalisation and Residency Depart- ment (DNRD) on sponsoring domestic help. First of all, the sponsor’s minimum wage should be Dhs6,000 or Dhs5,000 if accommodation is provided.There is a certain minimum that maids should be paid as salary based on where they come from. The minimum monthly salary rates are: An Indian -- Dhs1,100 Filipina -- Dhs1,400 Sri Lankan -- Dhs825 Indonesian -- Dhs800 Bangladesh -- Dhs750 Ethiopia -- no set standard Secondly, you have to be married or living with a family.The maid you hire should be from the list of countries mentioned above and you can- not have any family relations with the maid. THE PROCESS If you go to an agency, all the paper work will be conducted for you by the agency. However, if you want to do it on your own you must go through the legal steps to sponsor your maid and give her a visa. First you have to apply for a residence visa for your maid; after she ar- rives you have to apply for a medical fitness report follow by an applica- tion for a residency stamp on her passport and the issue of a domestic worker card. Every step from applying for a visa to issuing a labour card is tedious process.You have to gather several documents for every appli- cation as well as pay a lot for every service; for example you have to pay for the medical fitness tests, typing services and several deposits. Only when all legalities are done, the DNRD will issue a Domestic Workers Identity Card. There should also be contract between the maid and the sponsor stating the duties and responsibilities of each party. Not everyone wants to bother themselves with such a process: A THE RISK All Photos supplied Pakistani woman is fined for Dh100, 000 for having two illegally hired May 13 housemaids; another shop keeper received Dhs200,000 for hiring four women who were on house-maid visas and ran away from their spon- sors. If you hire domestic help without the DNRD approval, you can face a Dhs50, 000 fine per maid. It might be much easier to find a maid and hire her without going through the legalities; however beside it being illegal it is not safe to hire unknown people without know their medical and security records. She might have a contagious disease or a criminal past. There are several cases when maids run off from their sponsors after getting the visa. Crime cases involving maids are also on the rise, so it is better to make sure that it is ok to leave your family with a maid. By going around the legal channel of hiring a maid you risk not only getting a fine, but also the safety and health of your family because you have no information about the maid’s past.
Beauty Adornment Dry damp hair with Sleek Blow Out Cream to ensure a smooth finish, then use a fine toothed comb to part hair sharply down the middle. Mix glitter with some gel and brush onto either side of your parting for an on-trend 70s disco vibe. SUMMER LOCKS The Community asks top stylists What are the organic products that inspired women to ditch their long locks and are good for our hair? sport pixie cuts. At the same time hair icons from Toni&Guy the most concerning Natural extracts such as shea butter, lemon- Rosie Huntington-Whitely, Kendall Jenner hair questions.Take expert advice grass and wheat proteins have effective prop- and Blake Lively show that long hair is still from people who styled models of erties that can target a range of hair woes, beautifully on-trend. the London FashionWeek 2015... maintaining hair health and strength. How do we take care of our locks in What are your three secret tips to the What method do you suggest to fight the excruciating UAE climate? perfect hair? hair loss and dandruff? To combat dryness caused by pollution, Keep heat styling to a minimum, use the Use the right products according to the needs chlorine and the extreme weather, moisturis- correct products for your hair type and visit of your hair, minimize the use of elastics as ing is key. Use a hair treatment like nourish- your stylist regularly for trims to keep split this can weaken the strands and lead to hair ing masks at least once a week to protect ends at bay. loss. Consider getting a filter for your shower hair from the sun’s harmful UV rays, which to combat the hard water in the UAE. restore and nourish to leave locks more If we want a radical colour change, What are your at-home hair remedy manageable. how should we do it? suggestions? Sun tends to lighten dyed hair making It is always best to seek expert advice from Coconut Oil or Avocado can provide hair it fade into a lighter colour and loose your stylist to check if your hair is capable of with essential fatty acids, giving strands a its shine, how can we fight this to pre- undergoing extreme treatments. Hair may surge of moisture, but the best at-home rem- serve our initial hair colour? not be able to endure the strong chemicals edy is to maintain a nutritious, balanced diet Using the right products ensures that colour involved in repeated dyeing and may become full of protein, vitamins and minerals. will stay vibrant for as long as possible, and damaged and brittle over time. What can we do to add more gloss to label.m has specific products for combatting What is the latest fashion in hair dye- our hair? this problem – try the Colour Stay Shampoo ing? It was ombre, what’s in now? Pollution, over-styling and the sun’s heat can and Conditioner which fulfils the needs of Highlights have been around since the 90s all make hair appear dull and lifeless. Use a dyed hair as well as providing a much-needed and ombre is an updated version of the high-quality shampoo that contains natural hit of moisture. trend that continues to evolve. Balayage and oils and try finishing with a cool rinse in the How can we protect blow dried hair Reverse Ombre techniques are new methods shower as this seals the hair cuticle for glossy, from getting frizzy because of humid- continually growing in popularity. mirror-like shine. An ideal product to try is ity? Haircuts this spring and summer:Long label.m Treatment Shampoo as it contains Using leave-in conditioner helps prevent hair or short? And how long/short? exclusive Enviroshield Complex for extra from drying out, giving a healthy shine. Us- In 2015, anything goes! Anne Hathaway, protection against heat styling and UV rays. ing a hair protecting spray can also help when Miley Cyrus and Jennifer Lawrence have using heat-styling tools. 14 May
Irregular partings Apply a smoothing cream to hair for a slicked back style before sweeping hair into a side parting over the forehead. Secure the look in place with hairspray for a sleek finish. Blonde Ambitions Vintage Vogue Prep hair with a volume mousse before securing into a high bun and using a back- comb brush to create plenty of dishevelled texture. Sweep side fringe into place and add a bow hair accessory for a cute vintage beehive vibe. After seeking consultation at a trusted salon, use targeted FASHION TRENDS blonde hair care products such as the label.m Brighten- Indira Kasaeva brings you the best looks for ing Blonde range to maintain your new light locks. Deep summer 2015 right from the runways of London condition regularly and avoid over styling. Fashion Week. Check out the coolest looks along with some expert advice on your hair care... Fringe Benefits Depending on facial shape, trim a portion of hair to the desired length. Use a brush to style ac- cordingly and spray blow out spray to add body to the fringe, or slick down with hold and gloss spray for a more polished, mod- ern look. May 15
Fashion BOLD CONFIDENCE Delve into the luxury of desert-inspired dreams this season, Indira Kasaeva tells you more This month unleash your inner diva and test your inner femininity.Take note on how to add an extravagant touch to your ward- robe with a collection that will turn heads and drop jaws. Go bold and bright with fluid silks, predator animal prints and golden touches for a hot beginning of the summer. The featured collection shows the eloquent modernization of a traditional Arabian style in the most daring way. From dashing evening pieces to casuals-- don’t be afraid to show off this month. Use rich and bright colours like green, red and blue and get creative with de- tails. Incorporate different textures and styles in a wild yet elegant mix. Combine lace, denim and silk with details of beads, sequins, stones and feminine flowers. May is about real femininity and the graceful confidence of a queen. Find your muse in the epic Arabian fusion of the land around you with the majes- tic beauty of the desert and the modern glitz of Dubai. Accessorise your looks with chunky jewellery and bold make-up; smoky eyes with red lips will be just right. And don’t be scared to flair your evening outfits during the day – just style a bit differently and you shall rock the streets in broad daylight.
ARABIAN DREAM AMpariyl 17
Fitness SEXY MOVES INTRODUCES YOU TO NEW PEOPLE Dance away your You will be taking a class with a extra pounds, Indira group of other people that you already Kasaeva tells you have one thing in common with – you all why you should try want to dance or already dance Zumba. Considering the fun and exhilarating out Zumba… atmosphere that a Zumba session creates, you will easily meet new people and make new friends. You will be actually looking forward to the next dancing session in a friendly atmosphere! ZUMBA IT IS FUN Transform your boring fitness routine into the ulti- As simple as that, Zumba mate party with Zumba. Break a sweat on the dance is a fun exercise. At first it will floor as you move your body to fancy Latino tunes! be a little challenging to keep up If you love upbeat music, then you will have a blast with the dance moves and beat of the learning and dancing Zumba.Time will fly by as you music, but it will be just as rewarding burn calories and have a ton of fun at the same time. when you master another new move. Whether you hate the gym or just want some variety Besides, Zumba is a group session so to in your fitness regime, Zumba will definitely add you can bring your friends and make some bright colours to your life. fun of each other when you make the The wild dance originated in Colombia in 1986 by wrong move. 18 18MayMay BOOSTS YOUR CONFIDENCE Dancing in general can boost your confidence, but Zumba requires some extra bravery to make some sexy moves.When you learn to control your body to the upbeat tunes of dance songs and when you see that you do it beautifully, it will definitely boost your confidence levels.You will love the dance, feel comfortable dancing and be empowered overall. Zumba makes you feel sexy and that comes with great confidence.
TONES YOUR BODY With the wide variety of moves you have to perform, you will be doing squats, twists and other moves as you dance to different music. Including the resistance training involved in Zumba you work out your entire body making every muscle move.Thus, Zumba is a great way to sculpt your body in a fun way. BEATS IMPROVES COORDINATION The Latino dance varies in train- sheer accident when Alberto “Beto” Perez forgot ing intervals and intensity so you the music for his aerobics class; to fix the situation will be switching between fast and slow he put on some Latin music and improvised…The rhythms, which will sufficiently improve spontaneous class became a big hit with students your coordination and balance. This will and so he initiated the Latin dance class that is now in turn increase your general fitness levels known as Zumba. However, the roots of the dance which will help you be more active and lay in the interplay of several dances like salsa, cum- successful in any other dancing or bia, merengue, salsa and even flamenco, creating a sensual and passionate dance. sport. There are several reasons why you should at least try Zumba! HELPS YOU LOSE WEIGHT BENEFICIAL NOT JUST FOR Zumba burns from 600 to 1000 BODY, BUT FOR THE MIND TOO calories depending on the intensity No matter in what mood you walk into and beat of the dance. So rather than a Zumba session, you will walk out happy. sweating it out on machines, wouldn’t you There is a certain energy in Zumba that re- rather be sweating it out dancing? Zumba vitalizes not only the body but the mind too. is a high-intensity cardiovascular workout Zumba will ignite you soul with all the pas- that lasts about an hour so there are ob- sion of the awe-inspiring dance. You will vious weight loss benefits.You won’t forget about your worries, and dance notice the hour pass by... away your sorrows. MMayay 1199
Health WOMEN’S HEALTH Indira Kasaeva passes on the advice of experts to tackle serious issues on women’s health ENDOMETRIOSIS AND ORAL PLANNING With more than 100,000 women suf- UAE doctors and international experts during her menstrual cycle cause the discussed critical women’s health issues at endometrial tissues to grow, leading to in- fering from endometriosis in the UAE, the 2nd Middle East Endometriosis Forum flammation and formation of scar tissues. the disease is affecting roughly 1 in every urging women to seek medical attention These two factors can cause severe pain. 10 women. Statistics also state that from with endometriosis and creating awareness 30 to 50 per cent of women experience about oral planning methods. The symptoms are quite common with dangers or some degree of infertility dur- strong pain during periods, during sexual ing their reproductive years due to the dis- Endometriosis is a condition when intercourse and during bowel movements ease.The complications of endometriosis tissues that are supposed to be inside a or urination. Pain levels can vary from can be infertility, as well as chronic pelvic woman’s uterus, start growing outside of mild to severe pains in the form of cramps pain. In fact, the disease can affect not only it, affecting the pelvic area. Most common or stabbing pain on both sides of the the physical aspects but also the social life areas that are affected are the ovaries and pelvis. It is strongly advised to get checked and psychological health of a woman. the bowel tissues lining the pelvis.The by the doctor to start treatment as early hormonal changes in the body of a woman as possible in case of endometriosis. A 20 May
check-up will prevent the disease from disease can be prevented and treated. progestin. Such pills are used as the most progressing. Specialists at the Endometriosis council reliable methods to avoid unintended pregnancy; however there is a lack of “We often notice that the diagnosis of also emphasized the benefits of oral family awareness of the benefits. the disease takes place when a woman planning for overall women’s health issues. faces trouble with pregnancy. Prolong- The most efficient way to decrees the “We usually notice a general tendency ing treatment has a negative effect on maternal mortality rate is to avoid unin- to focus on the risk factors associated with women’s health and her ability to con- tended pregnancy. In facts, oral planning oral pills, without a background knowl- ceive.We strongly advise women to is proven with 92 per cent efficiency rates. edge and low awareness on the associated recognize the symptoms and seek medical There are several health benefits of using benefits. It is one of our constant efforts to attention if they encounter chronic pelvic oral planning, like protection against some not only educate women on the benefits pain”, said Dr. Sony Singh,Vice-Chair of types of cancer, less benign breast changes, according to their health needs but also Gynaecology, Department of Obstetrics fewer functional ovarian cysts, possibly raise their awareness on the long-term and Gynaecology, at the Ottawa Hospital, fewer uterine fibroids and rheumatoid complications which can be avoided”, said Canada. arthritis cases. Along other benefits there Dr. Lee Shulman- Chief of the Division of is also management of acne, androgen- Clinical Genetics at the Feinberg School of While the main cause of endometrio- dependent diseases, symptoms of PMDD Medicine at North-western University in sis remains unclear, there are a few risk (Premenstrual dysphoric disorder), heavy Chicago, Illinois, USA. factors women should be aware of.The menstrual bleeding and pain of endome- disease running in the family, an early triosis. onset of a period and a heavy flow during the menstrual cycle – are all risk factors. The most popular way of oral planning However, with a proper approach, the is taking medicines with estrogen and May 21
Food RAW LIFE STYLE MODERN TOPICS Indira Kasaeva gives you the breakdown on the popularity of raw food diets... Since childhood we were always told to a rabbit all the time, raw diets can include it preserves all its vitamins and minerals. some very dense (and tasty) foods. However, you might want to stick to some eat more fresh fruits and vegetables, now balance because there are several types of things have changed into eating raw foods The raw ‘diet-mania’ has become ex- raw eating. To name a few of the most to make us healthier. Diets based on raw tremely popular boasting great health ben- popular ones, here is the list: eating are basically the same concept as efits. During the process of cooking, food raw veganism, because animal products loses up to 80 per cent of its nutrients, • 100 per cent raw diet plan typically have to be cooked. And no, it which actually makes it less of a nutri- • High Raw doesn’t mean that you will have to eat like tional benefit for our wellbeing.Thus, raw • High Carb Raw food reaps major health points because • Raw Till 4 22 May
RAW TILL FOUR HIGH RAW The name speaks for itself. On the Raw till 4 diet plan, you High Raw is similar to Raw till 4, except that your cooked stay a loyal raw eater right until 4 o’clock. Of course, it is meal doesn’t have to be dinner.You should eat mostly raw up to you to set the timing, maybe 6 fits you better, so don’t foods, but you can have some cooked meals. All day – raw, be too strict and just follow the concept. Basically you keep once a day – cooked – that’s the principle. Plus, the High it light and healthy until dinner.The diet is perfect for busy Raw diet is not vegan, so you can enjoy your favourite meat people who like to have a nice dinner, which is deliciously dishes once in a while. cooked.Throughout the day, one will have to settle for fruits, veggies and other raw foods. On the bright side, you 100 PER CENT RAW will definitely look forward to the dinner. Despite the fact that your evening meal will be cooked, try to keep it healthy as healthy as possible. HIGH CARB RAW Following the High Carb Raw diet plan is getting most of It might be hard to do in colder weather, but in the UAE your calories from carbohydrates in an all vegan style. In it is very possible to go eating only raw foods. It doesn’t essence you eat raw foods high on carbs, and consume less mean that all you will be eating is fruits and veggies all day. calories from fat and protein foods.The basic goal of this diet You can prepare raw meals that will leave you full for a long plan is the same as that of Doug Graham’s 80/10/10, which time; check out our Recipes section for some ideas! With a is making up all your food consumption 80 per cent carbs, little bit effort and research on the internet, you’ll be able 10 per cent fat and 10 per cent protein. to make some good raw delicacies that are high on carbo- hydrates. Think creamy cashew raw lasagne...Sounds good right? May 23
Recipies Indira Kasaeva brings you dishes from the Raw diet – no cooking involved just a little creativity and great benefits HEALTHY OPTIONS RAW RECIPES INGREDIENTS: juice, honey, ginger, Nama Shoyu, miso, Pad Thai raw version You can adjust servings garlic, and cayenne pepper in a bowl. •2 zucchini, ends trimmed •Pour half of sauce into cabbage mixture A healthier option of the normal Pad •2 carrots and toss to coat. •1 head red cabbage, thinly sliced •Top zucchini ‘noodles’ with cabbage mix- Thai salad, the raw version is packed with •1 red bell pepper, thinly sliced ture and pour remaining sauce over more vitamins and tastes just as good as •1/2 cup bean sprouts each portion. the original. It takes only half an hour to •3/4 cup raw almond butter prepare and can go perfectly separate or as •2 oranges, juiced Watermelon lemonade a side dish. •2 tbspn raw honey •1 tbspn minced fresh ginger root It is a funky alternative to a lemonade and 24 May •1 tbspn raw soy sauce (Nama Shoyu) •1 tbspn unpasteurized miso the perfect drink this summer! Refresh •1 minced garlic clove yourself and quench your thirst with this •1/4 tspn cayenne pepper tasty blend of watermelon and lemon DIRECTIONS: fusion. •Use a vegetable peeler to slice zucchini INGREDIENTS: lengthwise creating long thin ‘noodles’. •4 chunks of watermelon Put the slices on individual plates. •Juice from 2 lemons •Slice carrots like the zucchini into long •Agave to taste (or other liquid sweetener strips with vegetable peeler. of choice) •In a large bowl combine carrots, cabbage, red bell pepper, and bean sprouts. DIRECTIONS: •Whisk together almond butter, orange •Place watermelon and lemon juice in blender, blend •Add agave to taste.
Raw zucchini and salt, nutritional yeast, and 1 tablespoon of •Chop ends off of zucchini and cut zuc- tomato lasagne water to start. chini in half. •Scrape down the sides of the processor •Use a mandolin or very sharp knife to If you’ve never tried a raw lasagne, you and add more water as necessary until it slice zucchini into thin slices. reaches a consistency similar to ricotta. •Lay two slices side-by-side, spread the should because it has a spectacular taste. •Add the chives at the last second and raw almond cheese and top with fillings Plus it is diet-friendly and much easier to pulse until incorporated. of cherry tomatoes and basil, layering be- prepare than the original recipe. Devour Prepare the lasagne tween more zucchini slices with cheese. your lasagne while keeping up the diet. Fresh vegetables and an almond filling create a sensual taste and keep you full for long. INGREDIENTS: •1 zucchini •1/2 cup sliced cherry tomatoes •2 tbspns fresh basil chiffonade •freshly-ground pepper •Raw almond cheese (see recipe below) •Raw almond cheese •1/3 cup raw almondsgreens (about 8 cups) •1/8 teaspoon sea salt (or more to taste) •1 tablespoon nutritional yeast •2 - 3 tablespoons water, or more as needed •1 tablespoon fresh chives, chopped DIRECTIONS: First prepare the raw almond cheese • Soak almonds in water for at least 1 hour, then drain. •Add almonds to a food processor with Raw Strawberry The raw strawberry chocolate trifle looks •1/2 cup water Chocolate Trifle •1/4 cup liquid sweetener (maple syrup) amazing with the colourful layers of vanilla •1/4 cup coconut oil and chocolate mousse. Enjoy a truly guilt- • 1/4 cup raw cacao powder free desert! INGREDIENTS: DIRECTIONS: 1 pint strawberries •Place all ingredients of the crunchy layer Crunchy Layer in blender and pulse until well combine •1 cup pecans •Whisk all ingredients of ganache layer •1 tablespoon coconut sugar (granulated) together until smooth and well combined. •4 dates, coarsely chopped • Blend all ingredients of the vanilla Ganache Layer mousse until smooth. •1/4 cup coconut oil, melted • Refrigerate until set. Make sure you give •1/2 cup maple syrup or liquid sweetener this enough time. It will take a few hours. of choice • Blend all ingredients of the choco- •1/2 cup raw cacao powder late mousse in high-speed blender until Vanilla Mousse smooth. •1 1/2 cup cashews, soaked until soft • Refrigerate until set. •1/4 cup liquid sweetener (maple syrup) • Assembly •1/2 cup water • Slice strawberries thinly. •1/2 cup coconut oil, melted • Layer crunch, ganache, chocolate •1 vanilla bean (scrape out the inside) “mousse”, strawberries, vanilla “mousse”, Chocolate Mousse strawberries, vanilla “mousse”, chocolate •1 1/2 cups cashews, soaked until soft “mousse”, ganache and crunch. • Alternatively, layer any way you want. •We suggest to layer the desert into small glasses for separate servings or one bowl for a cake-lookalike May 25
Review WAKE-UP CALL Indira Kasaeva sa- vours the breakfast flavours of the Go Healthy menu and here’s the feedback… Located at Movenpick Hotel in JLT, home feel to the line-up of the dishes. tomatoes and cheese. After filling our Whether you prefer a light version of a plates with a few more bites we headed to cluster A, Nosh restaurant offers fusion croissant with coffee or a hearty omelette our table. cuisine with themed nights.The variety with smoked bacon there were options for The omelette with bacon, cheese and is an impressive menu of options with any heart’s desire. Everything looked really tomatoes was great with a little fresh seafood nights, international buffets, Friday simple and tasty, so we filled up our plates bread. But if your prefer something more brunches and much more.This time how- in no time. serious, take on sautéed mushrooms, ever, we decided to try out the breakfast Starting off from the beginning on the baked potatoes and the smoked turkey buffet of their Go Healthy menu… long counter, we got some fresh croissants ham with plums.We have to say that the We arrived a little too late at 9:30am with at the ‘bakery’ section and proceeded to combination of ham glazed with plum the breakfast being only till 10:30am, order omelette.There is a station throw- syrup seemed odd, however the taste was however we managed to taste enough from ing out fresh waffles and pancakes where magnificent.Who would have thought that the gorgeous looking treats on display. you can also order anything in particular plums cooked with fried smoked turkey From freshly baked bread to fruits for mak- that comes to your mind; we went for the ham could go so well? Not too sweet but ing our own juice, everything was lined up typical option of omelette with bacon, intriguing, it gave off an interesting twist along several counters.There was a certain
RESNTAOUSRHANT to your typical ham. Accompanied with the waffles along with the green tea and cof- subtle tones of beige marble, some browns potatoes and mushrooms, the plum ham was fee. Croissants were not bad, but the waffles and whites. If the weather allows, it’s best exceptional. were just finger-licking.Thrown out hot right to take the outdoor terrace with a beautiful On a lighter version, muesli with raspberry from the kitchen, we topped them with fresh view of the lakes.The breakfast buffet from and apple had a tangy taste – it wasn’t sweet whipped cream and strawberry jam – which the Go Healthy menu runs every day from at all, but very light and fruity with a sour gave them a sweet and soft taste – I wouldn’t 6:30am till 10:30am if you want to have a green apple flavour. Next on the go was the mind having them every breakfast for the full and healthy breakfast. Most of the food yogurt with fruit jam – which we loved; the entire next year. is organic, fresh, baked and cooked in-house. layers of kiwi jam and white yogurt were a It was a full, healthy and delicious breakfast The sunlit decor along with sumptuous delightful fusion of slight sweetness of the that packed us up with energy.The next time delights of the breakfast made an excel- fruit and sourness of the yogurt all in cute we felt hungry it was almost the evening. lent morning; we left the restaurant full and little glass jars.To add to that we had a plate A great thing about Nosh is that the food happy, ready to take on whatever the day of fresh cut cubes of watermelon and melon, is simple, fresh, tastes pretty good and is might bring. Nothing too extravagant, but which were actually very sweet. very much like home-made. In terms of the simple, delicious and healthy – three words Saved for the last we had our croissants and interior décor, Nosh is simple and chic with to describe our breakfast at Nosh.
PARENTING has your child been begging for a pet? indira kasaeva tells you why you should give in PAWS AND CLAWS FURRY FRIENDS A dog, a cat, a fish or a hamster – it may that pets are dirty to be near small kids, kids. Even small gestures such as feeding, is outright the opposite.The dirt and bac- petting and grooming help develop small be any animal, yet there are several ben- teria that pets bring to the house actually motoring skills in very young kids.With efits of owning a pet especially for kids. help strengthen the child’s immune system so much technology around and babies Numerous researches proved the various explaining why kids who have pets suffer tapping on iPads, pets provide a better social, physical and other advantages of from diseases much less than those who alternative for play on several levels. children owning a pet. So the next time don’t. Aside the general health benefits, PSYCHOLOGICAL EFFECTS your child nags for a furry friend, you pets also provide great comfort during Teaching a child to take care of another should really consider giving in. Of course a child’s recovery or rehabilitation from being is nurturing a sense of responsibility pets, just like kids are a responsibility that an illness. Cats and dogs in particular, and care within the young mind. Kids will will take time and maintenance, how- feel when their owner is feeling bad and understand what it’s like to have someone ever the benefits strongly outweigh the always approach to comfort. In special depend on them; after all, you have to minuses. Depending on the age, the older cases; animals are known to help kids with walk the pet, feed it, groom it and take the child the more he or she can help take diseases like autism. care of it. care of the pet. So eventually, it won’t PHYSICAL DEVELOPMENT Researchers have found that kids with be that much of work. Animals help child Pets like dogs or horses and even cats, pets are less self-centred and more car- development in several aspects make children lead a more active life- ing; by owning a pet they better develop HEALTH BENEFITS style helping their physical development. traits like empathy. Moreover, due to the Research has shown that kids who were Taking the dog for a walk, playing with unique special bond that children create exposed to animals from an early age are it outdoors and running around with the with their furry friends, they receive psy- less likely to develop allergies and have a pet is a way to practice motoring skills for chological comfort.The non-judgemental stronger immune system. Hence the idea 28 May
nature of animals makes it easier for a furry friend and asking questions all foster child to trust a pet. For the same reason, the desire to learn. Babies and small kids pets help children get through psychologi- will discover the world along with the cally difficult phases of life.There are even pets, which will be very entertaining for special farms and shelters where emotion- all the family. ally-scared children can spend some time FAMILY BONDING with animals. It is known that even the The kids learn how to take care of the pet most emotionally closed kids eventually by taking an example from the family and became more soft and mild after being in turn everyone shares the responsibil- around animals. ity of feeding and watching over the pet. The love between a child and a pet is one In majority of happy families the pet is of the purest forms of affection. Cuddling considered as a real member of house- with pets actually reduces stress levels, hold. Playing with the dog, taking it out loneliness and anxiety, giving children a for walks or grooming your cat provide peace of mind.Young kids take their pets a common activity with the other family as real friends; they play with them, talk members. Simply having a kid and an ani- to them and trust them. mal in one house is really fun, so be ready COGNITIVE LEARNING for squeals, screams and a lot of laughter. Kids will have to learn something new by getting a pet; from what it eats to how to train it. Choosing a pet is another important process as they discover eve- rything that comes along with having this particular pet.Visiting vets, taking care if the animal gets sick, reading about their May 29
travel LAND OF AURORA WINTER MAGIC igloos will be the greatest opportunity the peak of winter, however you can try to watch the Northern lights in the most your luck right up to the month of March. Tired of the hot weath- romantic atmosphere. Just imagine laying in In fact, you might get lucky any time as the er? Jet off and spend a warm and cosy bed with a loved one, sip- Northern Lights are quite unpredictable. the nights under the ping something sweet and having the beauty Northern lights, In- of the night sky as your ceiling. Even if you don’t catch the lights, the dira Kasaeva tells you igloo village is a great place to stay if you about the fairy-tale Made with special thermal glass and want to indulge into some real snow away prepped up for a stay with comfort, the from the hustle and bustle of the city.While land… igloos will allow you to enjoy your time you are in Finland, don’t miss out on a in the snow filled woods without suffer- chance to go on a snow safari with huskies Spend a few magical nights in the serene ing the sub-zero temperatures outside.The or reindeer. It is a perfect way to explore glass design lets you observe the striking the snowy landscapes and truly enjoy a winter of Finland in true fairy-tale settings. nature around you as well as the glittering winter fairy-tale. Amidst the snow, you will experience a sky above.You will have a kitchenette and spectacle like no other as the sky lights up everything else that you need for a short in bright colours.The challenge to catch stay. In the middle of the igloo, the luxury the Northern Lights is a beautiful one and beds will serve as a comfortable observa- is definitely worth the effort. However, you tion deck to watch the night sky burst into don’t have to be freezing in the midst of the all the colours of the rainbow. woods to see the famous Aurora Borealis. In fact, you can wait for it in the comfort In Finland the Northern Lights shine of your own bed enjoying the view of the most of the year, roughly around 200 days. starry sky. Mere photos of this phenomenon are stun- ning, so seeing the show of lights live right Take up a few nights in the igloo village at from your bed is a truly exciting and magi- the Kakslauttanen Arctic Resort.The resort cal experience.The charming spectacle will is located just above the Arctic Circle and impress you with its breath-taking beauty. boasts a hotel with cabins and a separate Watch in sheer amazement as the sky lights igloo village for those who want to witness up into an array of beams – it will be a sight the light miracle.A night in one of the glass you will never forget. The enchanting Aurora Borealis or the Northern lights are actually particles emanating from the sun; when they collide with the magnetic fields of the Earth they explode with bursts of colours – causing a beautiful scene in the sky.The best time to pay a visit to the Northern magic is during 30 May
Interiors CREATIVE CORNER DESIGN THE HEAVEN Interiors created by whether a mansion or a small flat. worth persevering. Our home is our cave, a designer are beyond At the end of the day, the whole purpose our nest, our retreat, our theatre.The most people’s budget, place to which we return, in which we of interior designing a home is to achieve wake up, cry and laugh and which protects but Rose Hockley the best possible surroundings for the us from the rest of the world. If we respect reveals trade secrets people who live in it.We all want lovely, it, it will be a happy home in which to live. personal spaces to live in and by following That is a great benefit to have in life. so you can do it a tried-and-tested approach it really is pos- yourself sible to achieve. Follow our three steps to create your own ‘designer’ home... Decoristas call it ‘room romance’ — the The essence of interior design is creat- FINDING YOUR STYLE ing an environment which reflects our pure pleasure of sitting down with an personality and taste, and which is com- Finding and understanding your own interiors magazine, admiring and envying fortable, functional and something we can style will give you confidence and a clear beautiful rooms created by designers. take pride in. Of course, it can be tricky sense of your personal design identity. because there are so many looks to choose CLASSIC COOL from and seemingly endless trends, and For instance, although you may love the But so often we come back down to people get overwhelmed. retro style and get instantly drawn to mid- earth with a bump when we try to design Often someone will look at a friend’s our own rooms. Limited space, a tight house which they admire and try to repli- budget and an avalanche of assorted family cate it, but while a style might work in one possessions usually prevent us from repli- home it may not in another. cating those uncluttered, glamorous spaces featured in the glossy mags. Therefore, it’s important to work out exactly what your own personal taste is, Therefore, a step-by-step approach is which will make it so much easier to iden- relevant to every design and every home, tify what you like and don’t like, and help you avoid costly mistakes. Creating a home which reflects your taste isn’t just about choosing colour schemes and furnishings; it’s about under- standing how to use space and style. Sometimes you’ll make mistakes but it’s 32 May
century modern furniture, you will learn room would be wasted and better used as that it’s not a look that you may actually a home office area. like to live with. Designer tip: The layout of many The architectural style of your home is buildings cannot be changed without a important but it’s only one factor, so don’t lot of expense but don’t be too quick to let it override your own sense of style. limit yourself. A small structural change, such as removing a wall or repositioning a Designer tip: Collect pictures of doorway, can make an enormous differ- rooms which appeal to you in magazines, ence without breaking the bank. even if there are a few elements you don’t CREATE THE DREAM like — just note down what they are. Once you’ve got layout plans for your Having a reaction is what counts and it home and have established how you want will help you realise what you like.The to use your space, look at the work that clothes you wear, or would like to wear, needs to be done in your home, from can be a source of inspiration. If you tend electrical to building work. towards classic tweeds, you may like more traditional interiors. If you only ever wear Then you can create your scheme.You neutrals, you probably won’t want a riot of must trust your own judgment, and put colour at home. aside any thoughts of what other people think is stylish.This is about your own Films are also a great source of inspira- preferences.You will finally start to be able tion because they often show an interior to see your look, and recognise that some in not only surprising detail, but also in a elements of your scheme won’t conform lifestyle context.Think about your style in to the ‘style’ you’ve identified as yours. different ways: the way you like to dress, That’s fine. the car you like to drive, hotels you like to stay in or simply what in life inspires you. Designer tip: It’s important to ensure Slowly, a feel for your own personal look that paint colours you use flow well will emerge. through the various rooms and corridors. SPACE AND PLAY If you can, decide on all the room colours before looking for the connecting colours It’s natural to want to choose colours, for hallways, stairs and landings. Aim for a move furniture around or get building view from the hall or landing of a range of work under way to make a home your colours that happily combine, rather than own, but looking at the way you use a clash, when the doors of the various rooms home is the priority. are left open. The first step is to write down what you need from your living space.This shouldn’t be a list of the rooms you have, but the way you want to live and activi- ties you want to do at home.You might want an area for friends to practise yoga, a room where children can do homework and hobbies, or even space for a two metre-long aquarium! Obviously, if you like cooking and entertaining, an open plan kitchen-dining area will work well. If that’s not what you enjoy, a formal dining
TECH BATTLE HAND WRESTLING APPLE VS ANDROID Indira Kasaeva brings the watch you’ll choose will be of the same system as your phone. you the low down on So if you have an IPhone you’re going to have to buy an Apple the ultimate battle of Watch and if you are an Android user – you will have to get An- tech watches droidWear. APPLE First things first, the Ap- It is the new technology that ple Watch is sufficiently more is infiltrating our lives; the smart expensive; the more personalised watches are taking over the world -- the higher the price. With gold and the battle between the two editions the price of an Apple biggest giants is stronger than it Watch can go as high as thousands has ever been before. As if phone of dollars. In fact, the Apple Watch competition was not enough, there comes in three distinct designs and is now competition for the wrists. two sizes. In terms of design; there With Apple releasing its Apple are aluminium, stainless steel and Watch and several Android watches 18-carat gold editions, which all on the market already, there is a come in a 38mm size or a 42mm lot to choose from in terms of tech option.The availability of sizes is a specs, design and features. How- big plus for Apple because Android ever, one rule is simple: Unless you users with small wrists will have plan to change your phone, a tough time; all Android watches come in the same interface size. 34 May
Among other design benefits, you can pick Android, which instantly gives you more op- swipe through the menu, Google Now pops up and choose from the 38 different straps to tions to choose from if you are an owner of an with the latest updates and info. It will even re- accessorize and personalize your wrist hugger. Android phone. All Android versions are less mind you when you should leave to a meeting Ranging from rubber-like sporty bands to expensive than the Apple production with just to be there on time! When it comes to apps, leather choices for the gold editions, there are as good features and customizing options. Since Android has a very strong head start.The Play also hard-core metal bands – the Link Bracelet most of the Android models are a standard Store of the AndroidWear section is blooming and the Milanese Loop.The wrist straps play 28mm size, there are several strap options of with almost all apps that Apple only plans to an important role in design; however the cen- different bands to choose from, unlike for the develop.There are apps that will remind you tre piece is the watch itself. Apple’s interface is Apple’s same brand options. Android watches that you left your phone too far and apps that not that big yet the resolution is crystal enough come in circular models like the Moto 360, LG will allow you to remotely snap photos on your to be a ‘Retina’ display. On the 42mm display GWatch R, HuaweiWatch and the LG Urbane, phone using your watch. However the big dis- the colourful screen is 312 x 390 in resolution while Sony, Samsung and the LG G come in advantage is that unlike the AppleWatch, you while the smaller 38mm watch size boasts 272 square displays.Talking about displays, the cannot receive calls from your Android wrist. x 340 on the OLED screen which also has a highest resolutions are offered by Sony, Sam- However, battery life is longer with Android special touch technology.The AppleWatch can sung and Asus with 320 x 320 AMOLEDs and watches. For example Moto360 can take on tell the difference in the force and pressure of LCDs with 278 pixels per inch which is slightly 24 hours while Sony Smartwatch 3 does it your touch, the difference in a tap and a press higher than Apple’s.There are three models best with two whole days of battery charge. goes for various commands. that are powered by Google; Sony Smartwatch Androids are water-resistant too just like the 3, LG GWatch and Samsung Gear Live which Apple watch. Keep in mind water resistant An Apple timepiece can do almost every- have the cool Google Now feature. It is your doesn’t mean waterproof. thing that your iPhone can but with much own personal assistant that has full knowledge easier access.With one glance at the display, of your latest e-mails, appointments and even you have instant data access; from reading a your search history.You will be pleasantly text, to sharing your location with friends or shocked how good this software knows you answering a phone call. Photos, camera, cal- and how helpful it is.While you mostly have to endar, weather, mail and all the other features are all encompassed in the small display.There are 20 default apps in the watch and prospects for many more to connect you to social media. Another major plus of the AppleWatch is its fitness tracker which allows you to track your sports progress. It will be much more comfort- able to exercise wearing a watch than having a huge iPhone stuck to your arm. However, be prepared that just like with the phones, your battery life won’t last long. Out of all the smart watches, Apple has the shortest charge reserve. It is said that the AppleWatch will last 18 hours with moderate use and per night charging. On the bright side, the watch is water resistant, so it can take on a shower or a sweaty workout. However, it is not advised to go swimming since it can be submerged in water only a meter deep and for half an hour max. ANDROID WATCHES Android has eight watches out already, op- posed to the still arriving AppleWatch. LG, Sony, Samsung all came out with watches using May 35
Motoring POWER FUSION FINDING PATHFINDER Indira Kasaeva takes the flowing on the road. Handling this big beast months, and to be closed for the summer dashing Nissan crosso- was fairly easy too; the steering was light to protect from the scorching sunlight. ver for a test drive… despite the weight and size with only a Completed in leather, the interior was a little effort required on the U-turns. Even nice touch, especially the leather wrapped The Nissan Pathfinder 2014 Hybrid is an after driving a sedan, the Pathfinder was steering wheel.There are automated very easy to adjust to.The acceleration was power adjustments to the driver’s seat for impressive version of an SUV transformed efficient enough but complete stopping all angles and directions. In terms of the into a midrange crossover.Arriving in a 4 required some effort. technology, there is nothing too fancy in wheel drive and hybrid version, it was an the Pathfinder – a 7-inch colour display interesting ride to put to the test. It may be due to the Pathfinder being holds everything from the radio to the park a hybrid. Combining a 2.5-liter 4-cylin- assist sensors.There is a reverse camera, a With fluid lines creating a smooth exte- der engine, 15-kW electric motor, and a CD player and satellite radio on the display, rior, the body of the car looks top notch. It Lithium-ion battery – the car offers better while the audio and video jacks are located seems to be quite compact from the out- fuel economy, but slightly takes away from in the compartment between the two front side; however it is impressively large from the performance.The Hybrid blends the seats.You can just connect your iPhone with inside with sufficient place to squeeze in 8 power of the engine and the electric motor your USB wire and the beat will drop.The people and easily fit in 7.With three rows resulting in a bit sluggish response, and it is electronic interface is very easy to navigate of seats, enough leg space and headroom, not seamless either; you will see the energy with only a few buttons. Out of the cons, a panoramic roof, fuel economy and user flow on the dashboard behind your steer- would be the loud noise of the AC system. friendly electronic interface– the Pathfinder ing. However, the combo makes up a good is some serious competition to other cars 250 horsepower. Considering that there In terms of safety, the Pathfinder passes in the midrange crossover category. It is aren’t many SUV hybrids in the market, the test with front row airbags and full- the ultimate family car for a drive in the Nissan Pathfinder is a good option for a 7 length side curtain airbags across all the city and some off road adventures.There seat crossover with great fuel economy.The three rows. Breaking system is also on a is ample space in the two front rows and closest you can get of a similar hybrid is the high level with antilock disc brakes, stability enough in the back; good thing the second Toyota Highlander Hybrid. and traction control. In crash tests the Path- row seats can be adjusted to create more finder’s performance was rated as good. space for the third row passengers. Interior wise, you get a great pano- Overall, the Pathfinder is a safe, easy and ramic sunroof that you can close and open efficient car for a family in the city. Easily Our 4WD was a smooth drive, absorb- depending on the weather -- there is an to handle, can fit in a ton and economical in ing the humps and bumps and effortlessly automated system for that.The roof is just terms of fuel. perfect for some cool breeze in the winter 36 May
THE COMMUNITY ADVERTISEMENT RATES Kindly note: 1. All pages are of THE COMMUNITY: Advertising Rates (width x height) full-colour glossy paper Advertisement Type Size (cm) Front Cover Inside Front Inner Pages Inside Back Outside 2. Artworks should be Cover Cover Back Cover Double Page Spread 42 x 29.7 AED 7,000 provided in CDs with Double Page Spread - Half 40 x 13.3 AED 6,000 AED 5,500 AED 6,600 AED 7,000 colour print-outs Full Page 21 x 29.7 AED 5,000 3. Materials deadlines to be strictly adhered to 4. Rates for annual Half Page (Horizontal) 19 x 13.3 AED 4,500 AED 3,000 AED 4,800 AED 5,900 bookings are subject Half Page (Vertical) 9.2 x 26.6 AED 4,500 AED 3,000 AED 4,800 to availability and Quarter Page (Horizontal) 9.2 x 13.3 AED 2,700 AED 2,100 AED 3,000 negotiation Banner AED 6,600 AED 1,900 Inserts 90 fils /copy Full Page 2C Box AED 3,000 Coupons 1C Box AED 2,000 Advertorial Half Page AED 3,300 Advertorial Single page AED 5,200 Advertorial Double Spread AED 6,000 SPONSORSHIP RATES Section sponsorship (for a year): AED 60,000 SPECIAL REPORT/SUPPLEMENT Special reports and supplements on mega project, country reports, sectorial reports and to celebrate corporate milestones/anniversaries of major corporations/players to be attached/added to the main magazine No Description Rate in US$ Rate in AED All rates per issue (once a year) 1. A 12-page corporate supplement (insert) 10,000 37,000 2. A 20-page supplement (insert) 15,000 55,000 3. A 40-page A4 book (detached) 30,000 110,000 ONLINE SPONSORSHIP FOR thecommunityuae.com The Community magazine has a dynamic website that will help advertisers to reach a worldwide audience No Description Rate in US$ Rate in AED All rates are tentative and subject to change 1. Section sponsor (per month) 3,000 11,000 For all inquiries, kindly contact: 2. Section sponsor (per year) 30,000 110,000 050-752 7299 MEDIA FACTS : A-4 PUBLISHED BY Size Sky Horizon Media Dubai A division of Sky Horizon Publishing and Date of publication : 1st of each month Distribution LLC Initial print run : 41,000 per month 206 Aspect Tower, Executive Towers Block B, Business Bay, Dubai, UAE No of pages : 48-100 PO Box 7586 Dubai, UAE Cover : 150 GSM, art gloss + full UV Phone: 050-752 7299 Inside : 90 GSM art glossy, full colour E-mail: [email protected] www.thecommunityuae.com Material deadline : 20th of every month www.skyhorizonmedia.com Subscription : AED 50 per year Distribution : Through direct distribution network, subscription and retail sales Availability : Through subscription, direct distribution, shopping malls, hotels and restaurants, coffee shops, newspaper and magazine stands, clinics and hospitals, retail outlets, books and stationary shops, gasoline stations, duty free outlets, etc Distribution areas : Dubai, Sharjah and Abu Dhabi MAGAZINES SUPPLEMENTS NEWSLETTERS BOOKS CONTRACT PUBLISHING WEB CONTENT AND DESIGNING PR DISTRIBUTION MEDIA BUYING ADVERTISING PRINTING THE COMMUNITY BRAINSTORM HEARTBEAT PROPERT.AE SEASONS DUBAI AKZENT PO BOX: 7586 DUBAI PHONE 050-752 7299 FAX: 04-349 4607 E-MAIL: [email protected] www.thecommunityuae.com www.skyhorizonmedia.com
SHOW B IZ Media and fans still can’t Ranveer and D tell whether the relation- friends or lo All Photos supplied ship between Ranveer Singh and Deepika Padukone is just friendship or are they secretly dating. Despite the fact that both Ranveer and Deepika claim to be good friends, rumours still have it that the couple is actually dating. In a recent interview Ranvir was talking about Deepika and saying that he was ‘lucky to have (Deepika) in life’. Royal baby camped outside the hospital waiting for Cate Bblaisnecxh the announcement of the royal baby’s W Beyonce’s PlanBlanicfhet,ejsinutomiscHmtesedneotoxxeosinaattlhtwrahfdaimilerpeierimlltrmsvcsaot.iletlvoataTeiertiobfi,deehmanof,tdefothsut.hhhuetestBoaoitrrtpwtaalhaMahrcssenentahimvricvdnetleeeheoasrOrwyedpshetweiasaaCdtccsledhi.tyadhleeprrhienfnunleewavsaotayotenitscshnlrknavreonaemoeesedslvdueerteenxaasiaCornbbculeuioaacatamtltuahnnesrtewyeueisnnllaimaiattlkmhh-loyeeaersr The world cheered on the arrival of the arrival.The name was chosen by Prince William and Kate, and approved by OahchorofaooyfludmtansohrwttaisteahonhlllrelsoehdsearcorWssfooetrchstoewttdpuornach,ntghiitvneeeakcecotifgeyhslglihaikwoeetortyneereetbifwecpgrncenodhsstaheevgwnthdefrtlovoetal,seherrsaearnri.ietboecuynyrlmhHssoremIynoGstetnitsooeetentoh,resiiaMkpsaseenteeBlt,td!appvasghreemgJsfeaDeoeoatwLyrhraduscoofaeoGtleehhpikmsssnoHvrnietapaeocneofgnflnodiodénaainftdgtlernaestalthocgus.yhndhbtKehaahrwecQhteltrraeidehireihnrmonsruybeeweiaegogcvsceowirvceotndKiiiegedeadatndninodhyalnprtoeglf.wirphthedniBatoAddfse royal baby: Princess Charlotte Elizabeth Queen Elizabeth. ladies! Diana. Kate Middleton, Duchess of the Cambridge gave birth to a baby girl on May 2, 2015.The princess is the second child of the Duchess and Prince William; now the adorable Prince George has a baby sister. Huge crowds of royal fans LVampires get marriedaTinsnwsicdaedntenSlithicoNlrnaieeoSevgngiomfekhctJflcmaaktoyotaniuMsoemncuaRpryogtaoehlehruaeanaeey,iprlinadidceglrtreaoeitefkeh!.hartedT,odmesptnrhetfhoteehoeceusuyerrscsemnmheoktfdodlnuooyetooporirVnfmtlnheabp.aiemalnhWlwarrlopnrahvwtihikaeoosriehmeedlstehictsoDpiare,dnnvei.ipreetatTCetrrhlawboiooreieeoolcinsseetfalgtnenaotoericdfroifaetnttnnotowshhtgrfaethheaAoneegwdpreterhedidel- 38 May
There are rumours that the entertainment reality TV star is pregnant with a second child from her husband KanyeWest. If the rumours are true it is said to be a baby boy! Kim supposedly spent $230,000 on IVF Treatments and is said to be very careful about her preg- nancy. Insiders claim that not only is the star just pregnant, but Deepika: that she is already 12 weeks long. Zayn Malik heading to overs? Bollywood? However, based on her dashing body at the MET Gala Awards, There seems to be some consequences of the ex-Di- rectioner partying with Shah Rukh Khan at the Asian Kim Kardashianthere was no baby bump to be pregnant?seen!Well, time will show! hett KfWaopreodSodhrianhgid Awards just last month. Rumors have it that Zayn xual? might be singing along with Kanika Kapoor in an up- coming Hindi movie.While Kanika is famous for her Ta JsutebhnnerfeemehoibdiwaR1rtoKveth0dteatteoahe.ajchidpposresobdhfueonnhetailittonhomfneg.iitregvrngrohIieemtalgipecfbinniiureroeissgwdoesrludlradpoeoofpussamiadlnfwla.mornednWtaatyihniotcSnrntoieoéohrhhgogfe,rauiicnnfldsdhMonteospghiaudrtde,itehprectaaluhetlea- song Baby Doll in Ragini MMS 2, a duet with Zayn Malik will be a huge hit and apparently the pair has r already met to discuss the project. Malik also shared e tweets with Bollywood filmmaker Farah Khan; the next thing you know you might see Zayn Malik s. starring along Shah Rukh Han and Sushmita Sen in a re sequel to a 2004 blockbuster Main Hoon Na. Power of influence n A group called the Hindu Janajagruti Samiti (HJS) have written a complaint against former porn star Sunny Leone for being too vulgar on her website. The group demands the former star to be deported s without allowing entrance to the country. Despite the the fact that several reports were filed, the police n its haven’t taken any action. According to the group, the increasing popularity of the ex porn star is seri- Salman Khanwns. al jailed and free ous concern. her TB was lParniydasnHkoalClyhwoporoadAsltheahaariasdrQnlmibIisfnnniaurgnweggdiatnrneinehiriawegncrotindtiarlgcenHoenbaroerFeeT.aowciaBasslVotuCltITayntschanwVythuogr,oeacoanetpwsolcocwnfserue-tpdhtraoIstiiownscrerdpsdaaksiuwielfutciabcAcahyyigicunalt.sBhltelttlhtatCbsHeuwhnesuedrfeedpiunlrlls. he Bollywood superstar was hotos sentences to five years of jail for d she his 2002 hit-and-run case. Despite four et in denying the charges, Khan was only found guilty of driving drunk Among and killing a homeless man after dashian crashing a car into a bakery. Just ed two days after the sentence was dence, announced, the actor was let out on bail while his lawyers filed an appeal to the court.The final court hearing is scheduled to be in July; as for now Salman is set free despite his sentence. May 39
CONTRACT PUBLISHING QUALITY PUBLISHING AT COMPETITIVE PRICES Bespoke magazines, coffee table books, organisations in the UAE. Our titles cover an ex- Map, etc.We work with some of the biggest names tensive range of sectors from business and sport to in Dubai,Abu Dhabi and beyond. Our titles focus catalogues, newsletters, yearbooks, guidebooks, on areas ranging from health and fitness, retail, directories and sponsored supplements in print and education and retail. From concept to distribution, fashion and sport to in-flight, duty free, property, online are just some of the solutions Sky Horizon we offer the full spectrum of publishing services. education and business.With years of experience Media offers to its clients in the UAE. So whatever your business, whoever your audience, in various sectors, our team of editors can produce we are well placed to meet your requirements. content for a range of audiences. So whatever the Our contract publishing division boasts of an Some of our contract publications include Prop- industry sector, we have the expertise to help our extensive portfolio of B2B and B2C publications. clients communicate with their readers. We produce numerous multilingual tailor-made ert.ae (a magazine for Knoticka Holdings, Dubai publications for a host of national and multinational Akzent (a German magazine), GlobalVillage Guide SERVICE PACKAGES FROM SKY HORIZON MEDIA g Magazine content Content is the backbone of any business. But g Website content creating fresh content at short intervals can be g Newsletter content both time and cost prohibitive.We create excellent g Guidebook, yearbook, coffee table book content in one go so that you can leverage it to content derive the full potential of your business thus saving g Tabloid content recurring expenditure on time and money! g Articles and blogs Be it an in-house newsletter that reflects your g E-learning content brand values, or a sponsored supplement to coin- g Marketing content cide with your company event, we can custom- g Directories make it to suit your requirements. g Sponsored supplements Our experienced team of editors will ensure g AD copywriting that your product truly reflects your brand to g Editing the people who matter most — your clients and OUR USP g Proof-reading customers. g Our content is tailored to cater to your specific OINDUSTRY SECTORSur titles cover an extensive range of sectors tion and business.With years of experience in business, thoroughly researched and catchy various sectors, our team of editors can produce g It is 100 per cent original and goes through a from business and sport to education and retail. content for a range of audiences. So whatever your strict quality check before final delivery Sky Horizon Media Contract Publishing produces industry sector, we have the expertise to help you g It compels a user to‘act’ — buy/spread news titles focused on areas ranging from retail, health communicate with your readers. about your products and/or services and fitness, fashion and sport to property, educa- g It results in improved rankings, high conversion rates and enhanced return on investment for your business WHAT WE DO From conception to distribution, we offer the full spectrum of publishing services DISTRIBUTION CONCEPT DESIGN You tell us the target audience for your publication Getting the right message to the right people at We understand that if your publication doesn’t and we’ll make sure that it gets to them.Whether the right time requires the right planning.Your look right, then no one will read it, no matter it’s door-to-door, targeted distribution by area, or brand…Your audience…Your publication… By how good is the content. Our experienced team placement in outlets and businesses, our unparalleled listening to and understanding your needs, we of designers ensure that your publication truly distribution network ensures that your message is transform that idea into a stunning reality. reflects your brand to the people who matter seen by the right people at the right time. If you have most — your clients. any queries or comments about our services, don’t hesitate to get in touch with us. EDITORIAL We believe that there needs to be a perfect synergy ADVERTISING SALES For all inquiries contact: 056-206 8075; 0504943921 between the client and the editor. Our team of You don’t need to spend money on your publica- highly qualified editors is well placed to offer tions. In fact, they can make money for you.We Sky Horizon Media Dubai one-to-one services to suit your requirements. can help you do it. Our professional sales team has A division of Sky Horizon Publishing The editorial team is client focused, skilled and developed excellent relationships with some of extremely proud of what we create.We produce the biggest advertisers and advertising agencies.As and Distribution LLC titles for clients from all sectors, so you are safe in we possess a keen understanding of the markets in 206 Aspect Tower, Executive Towers Block B the knowledge that whatever your business or audi- which we operate, we can develop accurate busi- ence, you are assured of quality publications. ness plans and strategies to keep your costs down. Business Bay, Dubai, UAE PO Box 7586 Dubai, UAE Phone: 04-441 2928; 056-206 8075; 050-494 3921 E-mail: [email protected] www.skyhorizonmedia.com MAGAZINES SUPPLEMENTS NEWSLETTERS BOOKS CONTRACT PUBLISHING WEB CONTENT AND DESIGNING PR DISTRIBUTION MEDIA BUYING ADVERTISING PRINTING THE COMMUNITY BRAINSTORM HEARTBEAT PROPERT.AE SEASONS DUBAI AKZENT PO BOX: 7586 DUBAI PHONE 050-752 7299 FAX: 04-349 4607 E-MAIL: [email protected] www.thecommunityuae.com www.skyhorizonmedia.com
Where: Building 27, Dubai Healthcare City atmosphere. Where: Media Rotana,TECOM Contact: 04-435 5650 When: Saturday toWednesday 7.30pm- Contact: 055-505 7580; 1am;Thursday to Friday, 7.30am-2am www.rotana.com CLASSIFIEDPleTathsheeeCocsrooeWcmmnadammlnliuunl0tinnnt4yoiieo-tt4yygu‘4C’@ers1ltdaCs2feksle9atsya2ashit8fisuoil;seirrf0deiiwze5’doida6tnith-nsm2et0hec6edti7isoa8un.1cb?0ojemct LE CLASSIQUE: Traditional Where: Wafi, Oud Metha HEALTH French fare in a casual setting. Contact: 04-324 4777; PANACEA MEDICAL & WELLNESS When: Saturday toThursday, www.wafi.com CENTRE: A health centre that strives to 7.30pm-midnight 32 MARINA STREET KITCHEN: offer only exemplary health care, and be Where: Emirates Golf Club, Moderately-pricedThai food from the a source of comfort and advice to all their Emirates Hills Bangkok-based chain. patients. Contact: 04-417 9999; When: Open daily, 7am-midnight When: Saturday toThursday, 8.30am- www.dubaigolf.com Where: Dusit Residence Dubai Marina 12.30am; 4.30pm-8.30pm BRAUHAUS: A German res- Contact: 04-425 9999 Where: Easa Saleh Al Gurg (Dunlop) Build- taurant selling Bavarian food and MUSIC AND NIGHTLIFE ing,Tariq Bin Ziyad Road imported draughts. ROCK BOTTOM CAFÉ: (Bur Dubai) An Contact: 04-358 2020; When: Open daily, 6pm-1am old-school Dubai institution offering gritty, www.panacea.ae Where: Jumeirah Rotana, Satwa back-to-basics fun, with live band and DJ. URBAN ENERGY: A great all-round fitness Contact: 04-345 5888; Dress code: casual. centre. Specialist classes on offer include Ur- www.rotana.com When: Open daily, noon-3am ban Running, Urban Kick and Urban Reach. EATING OUT Where: Regent Palace Hotel, Bur Dubai Where: Star International School, Umm TURATH AL MANDI: Diners can expect Contact: 04-396 3888; Suqueim. Other locations include Safa Park to experience dishes that embrace traditional ASHIANA: This popular venue is helping to www.regentpalacehotel.co.uk/dubai.asp and Arabian Ranches Arabic cuisine, featuring flavours from the set the benchmark for Indian food. THE MUSIC ROOM: Live music institu- Contact: 055-886 9158; region fused with those from India,Africa When: Open Sunday toThursday, 1pm- tion with regular rockin’ cover bands.Watch www.urbanenergyfitness.com and Europe. 3pm, 7.30pm-11.30pm; Friday to Saturday, out for one-off themed billings. BODYWORX: A health and fitness club Where: Jumeirah Beach Road, Jumeirah 3 7.30pm-11.30pm When: Open daily 6pm-3am (cover charge kitted with free and fixed weights, a cardio When: Open daily, noon-midnight Where: Sheraton Dubai Creek Hotel and some nights for music) theatre and a number of classes. Contact: 04-395 3555; Towers, Deira. Where: Majestic HotelTower, Bur Dubai Where: Rimal, Jumeirah Beach Residence, www.turath-almandi.ae Contact: 04-228 1111; Contact: 056-799 6355 Dubai Marina www.sheraton.com ARBAT RUSSIAN CLUB: Head here for Contact: 04-374 6871; Russian karaoke, dance and food. Dress code: www.bodyworxme.com CARIBOU COFFEE: A favourite with cof- KIZA: The styled-up Africa restaurant serves smart casual. PASTELS SALON: Great Salon with well- fee lovers in the UAE, Caribou is now open a selection of signature dishes from the four When: Open daily, 10pm-3am trained staff. at numerous locations around the region. corners of the continent. Where: CarltonTower Hotel, Deira When: Saturday toThursday, 9am-7pm; Coffee and snacks are served in a casual and When: Open daily, 7pm-3am Contact: 04-222 7111; Friday, noon-6pm relaxing atmosphere. Where: The Lodge,Al Nasr Leisureland, www.carltontower.net Where: AlWasl Road, Jumeirah When: Open daily, 7am-11pm Oud Metha KITAKITS KAFE & KLUBB: Filipino Contact: 04-394 7393; Where: Various locations, Dubai Mall Contact: 04-334 4159 hangout with a house band and lively atmos- www.pastels-salon.com Contact: 04- 339 9491; ROSSO: Authentic Italian cuisine served in a phere. Dress code: casual. Where: Ritz Carlton, JBRTheWalk www.thedubaimall.com/en/restaurant/ casual atmosphere. When: Open daily, 6.30pm-3am Contact: 04-399 5016 caribou-coffee-2 When: Open daily, 12.30pm-1am Where: Marco Polo Hotel, Deira AURA SPA: Specialises inThai massage and AWTAR: Offering a lavish selection of hot Where: Amwaj Rotana, Dubai Marina Contact: 04-272 0000; reflexology. and cold mezze, a range of grilled items Contact: 04-428 3088; www.kitakitsdubai.com When: Open daily, 10.30am-midnight designed to share and a choice of authentic www.rotana.com CABANA: A poolside vibe combines with Where: The Atrium Centre (opposite Four Middle-Eastern deserts. BENTO-YA: ‘Simple’ and‘genuine’ sum views of the Burj and stellar DJing to make Points Sheraton), Bank Street, Bur Dubai When: Open daily,7.30pm-3am up this diminutive Japanese joint.A favourite this slick bar tick. Dress code: casual. Contact: 050-156 6762 Where: Grand Hyatt Dubai, Oud Metha with Japanese expats. When: Open daily, 9am-2am NSTYLE NAIL LOUNGE: An all-white Contact: 04-317 2222 When: Open daily, noon-4pm; 6.30pm- Where: The Address, Downtown Dubai space that offers full-body waxing, blow- RIVINGTON GRILL: A slick eatery, with 11.30pm Contact: 04-888 3444; dries, massage and manicure/pedicures and fantastic service, consistent food and a great Where: Behind Sketchers shoe shop, Shaikh www.theaddress.com plays sitcoms on loop. terrace. Zayed Road MAHARLIKA CAFÉ: One of Dubai’s finest When: Saturday toThursday, 9am-9pm; When: Open daily, noon-11pm Contact: 04-343 0222 live music venues, featuring a wide range of Friday 10am-9pm Where: Souk Al Bahar, Downtown Dubai SONAMU: Beautifully presented, delicious Filipino cover bands. Dress code: casual. Where: Jumeirah Contact: 04-423 0903 Korean fare made with quality ingredients. When: Open daily, 6pm-3am Contact: 04-349 0123 BIDI BONDI: Aussie eatery with a laid-back When: Open daily, 6.30am-10am; noon- Where: President Hotel, Karama SPORT AND OUTDOOR vibe, sports onTV, decent sandwiches and 3pm; 6pm-11pm Contact: 04-334 6565; DUBAI DOLPHINARIUM: A place to burgers, plus outdoor seating. Where: Asiana Hotel, Deira www.presidentdubai.com meet some of the world’s most intelligent When: Saturday toThursday, 10am-mid- Contact: 04-238 7777 K-WEST BAR: Swanky bar specialising in and friendly mammals.With emphasis on night; Friday to Saturday, 10am-1am LOCA: Tasty, fun and filling Mexican fare. cigars, Scottish specialties, mixed drinks and entertaining whilst educating, it’s a great Where: Shoreline apartments 1-5, Palm When: Open daily, noon-2pm live jazz. Dress code: smart casual. When: experience for all ages. Jumeirah Where: Dubai Marine Beach Resort and Open daily, 3.30pm-1am Where: Creek Park, Dubai Contact: 04-427 0515 Spa, Jumeirah Where: Kempinski Hotel & Residences Contact: 04-336 9773; BEST BURGERS FOREVER: A quirky Contact: 04-346 1111; Palm Jumeirah www.dubaidolphinarium.ae burger joint, offering decent fast food, and www.dxbmarine.com/home Contact: 04-444 2000 HELI DUBAI: Heli Dubai operates a fleet of the chance to try camel meat burger. TAGLINE: Beautiful interior and authentic 1 UP: New Brit-themed pub with live music, Agusta 109 E Power helicopters for sightsee- When: Saturday toWednesday, 11am-mid- Moroccan cuisine. pool table and sports on the screen. Dress ing trips. Dh10,000/ hour for group flights. night;Thursday to Friday, 11am-5am When: Tuesday to Sunday, 7pm-11.30pm code: casual. When: Open daily, 7.30am-2.30pm Where: Dubai Marina Where: One & Only Royale Mirage, When: Open daily, noon-3am Where: Za’abeel Contact: 04-458 1564 Jumeirah Where: Boutique 7 Hotel and Suites, Contact: 04-224 9888; CRUMBS ELYSEE: A Parisian style cafe Contact: 04-399 9999; TECOM www.helidubai.com serving a range of great pastries. Home www.oneandonlyresorts.com Contact: 04-448 7928 BRISTOL MIDDLE EAST: This impressive delivery available. BEACHCOMBERS: Serving top-quality RARE: THE PLACE: A brave mix of gothic fleet of luxury boats is crewed by a team of When: Open daily, 6am-midnight Where: pan-Asian fare in a family-friendly atmos- décor and sleek furnishings, this trendy venue Frenchmen. See website for further informa- AlTanyah Street phere. boasts great resident DJs and fine mixed tion. Contact: 04-346 8899 When: Open daily, 7.30am-midnight drinks. Dress code: smart casual. Where: Dubai Marina SINO CHAI: Dubai’s onlyTaiwanese restau- Where: Jumeirah Beach Hotel When: OpenTuesday to Sunday, 7pm-3am Contact: 04-366 3538; rant offers expertly prepared classics with a Contact: 04-406 8999; www.bristolcharter.com focus on healthy eating and many tea-infused www.jumeirah.com recipes. SEVILLE’S: Spanish tapas served in a great May 41 When: Tuesday to Sunday, 11.30am-4pm, 6.30pm-10pm
Horoscope: By Astrologer Mary MAY 2015 Aries Taurus Gemini Cancer (March 21-April 19) (April 20-May 20) (May 21-June 20) (June 21-July 22) Carrying on the romantic feel of Something that has been put on A very sharp mind sees quick pro- Continuing to look within yourself this month, Aries, there is love hold or that has stalled for want of gress this month, Gemini. Some- for answers works well.This is in the air! Make the most of this interest can now move forward. thing of a spark of genius comes especially true at the time of the full month to pamper and show your The full moon mid-month sparks your way with the full moon moon mid-month. Be sure that you appreciation of those around creativity on both the home and mid-month.Whatever you are do- want what you are asking for.This you.The full moon mid-month work fronts. Intimate talks with ing, however, be sure to take care same moon highlights any serious highlights any joint finances.These a loved one concentrate on the of your health. It is a good time to matters in your life. Finances and may need some attention now. long-term future, while with get any check-ups and adjust your health may be linked. Even so, if you Excitement around the planning colleagues, rapid progress can be diet where necessary. A frantic need to spend on any check-ups, of a holiday or family event adds anticipated. Good news you’ve social life may revolve around a don’t skimp.What is more impor- an extra dimension to everyday. been waiting to hear arrives. new romantic attachment. tant than good health, Cancer? Leo Virgo Libra Scorpio (July 23-August 22) (August 23-September 22) (September 23-October 22) (October 23-November 21) The creative period for you This is a month of travel plans Plotting and planning this month There is a good news.The full continues. Keep pursuing ambi- and work ambitions. Get ahead revolves around travel and moon mid-month can change tions of an artistic kind. Music with both by putting your ideas romance. Combining the two can your perspective. Perhaps a pro- and words fill your leisure time. ahead of others. Don’t hold back be especially exciting.Those who posal or someone new in the fam- Romance and satisfaction follow on speaking out and giving the have a partner become closer to ily brings unexpected joy. Both hard on the heels of relaxation. power of words to your thoughts. them.Those who still seek love finances and your health need Perhaps you are planning a holiday Although this month may see you and commitment are highly tuned special attention. Don’t delay on with a loved one? The mid-month being a little more emotionally to find it.The full moon mid- these. Serious matters apart, how- full moon, this highlights some vulnerable, there is no substitute month lights up your financial and ever, there is a spontaneity about progressive but serious issues. for listening to your heart. health sector. this time that is full of happiness. Sagittarius Capricorn Aquarius Pisces (November 22-December 21) (December 22-January 19) (January 20-February 18) (February 19-March 20) You are at your charming best this Having a certain amount of This is a lovely month for both Activity on the home front speeds month, Sagittarius! An element of restlessness about you this month, romance and communications. up this month. Socialising seems the spontaneous and experimental decide where to use the energy. You have both charm and the to take everything over as you aim flows through the days.When If it’s properly channelled, great right words in your favour. Ask to please friends and family. Fi- your imagination takes a front progress can be made both on for something that you want on an nances should pick up around the seat everyone around you can a personal and a work level. emotional level?Who knows, you time of the mid-month full moon expect to be entertained! Throw Even so, stay in charge of your may actually get it! Bring all of and will have a rippling effect on your passions into both work home and health situation. Deal your confidence out and use tal- your plans. Some which have been and romance, creating sunshine promptly with any concerns in ents liberally. Giving yourself time put on hold can now go forward. wherever you go. either area. to think can throw up answers. Take advice and let friends help. 42 May
THE COMMUNITY Get your copy of The Community magazine fresh off the press every month for only Dh50 annually! Sign up now and get your first two copies free! Name Ms Mr City: Emirate: PO Box: Phone (Office): (Home): (Mobile): Date of subscription (new): Subscription renewal: Address: Where would you like your magazine delivered? E-mail: Date: Signature: Payment: Cheque / Cash All cheques must be drawn in the name of Sky Horizon P & D Cheque number: Cash receipt number: Booking staff’s name: Phone number: Signature: Company seal: To subscribe, send in the above form to: Or e-mail us your details to: Sky Horizon Media, PO BOX 7586 Dubai [email protected] Phone: 050-752 7299
Friday Magazine Dubai’s genius boy wonder... Pritvik is a walking encyclopedia on dinosaurs.... only seven... he has an IQ higher than Albert Einstein’s, is a science and maths whiz and has already written his first book on dinosaurs Gulf News and KHDA The Grade Four boy has now estab- lished himself as a little genius and is charting his course for the future The National Pritvik’s colourful book with dramatic ing of the world of dinosaurs in theTrias- The talk also revolved around Taking both the creative and scientific illustrations of dinosaurs explains in sic, Jurassic and Cretaceous periods research on topics such as prehistoric worlds by storm is 7-year-old Pritvik clear, concise language the different Emirates 24/7 Sinhadc, perhaps the UAE’s youngest creatures of the prehistoric world. 8-year-old Dino expert’s... Emirates extinction and man-made nuclear author....When Dinosaurs Roamed the Already written, his second book Environmental Group’s lecture on the disasters that have deleterious effects on will be about Suchomimus and other Earth focuses on the Triassic, fish-eating dinosaurs, while he is also impact of radioactive and nuclear waste the genetics of marine and Jurassic and Cretaceous periods, with planning another book about animal on marine and land species left the audi- land species, hence creating facts on the biomechanics of almost all ence of environmentalists, academicians, mutations within generations the major dinosaurs of those periods, mutations in a format that appeals to both children 103.8: Mark Lloyd students and scientists spellbound to come and young adults. Sinhadc goes into The little genius’ first masterpiece prom- Gulf News Antinuclear.net ises to inspire children and adults of all Youthful genius on palaeontology detail about birth processes, body age groups to gain a greater understand- Young environmentalist talks about explains the hazards of systems, eating and behavioural harmful effects of radioactive waste... human caused ionising patterns, and the environmental radiation and scientific reasons for their extinction 7Days A student in Dubai who is an expert on everything to do with dinosaurs and the pre-historic world, has had his first book published at the age of just seven Khaleej Times Despite only being seven years old, it’s clear to see that Pritvik has a bright future ahead in palaeontology....When Dinosaurs Roamed The Earth takes his academic achievements to a new level. About the author Born on July 23, 2004, Pritvik Sinhadc, “I have every confidence “This book is a celebration of eve- $10.99 a student of Dubai British School, has that we are likely to see his rything Pritvik has so far learned shown incredible interest in palaeon- name amongst the experts Order and enquiries to ISBN978-9948-16-696-2 tology since his very early years. His about dinosaurs and he has a astounding and exhaustive knowledge of in palaeontology in the special way of making you forget Customer Services: the prehistoric world and the creatures future and those of us who his age and draws you in with the 0097156-206 8075 in the Precambrian, Cambrian, Silurian, have known Pritvik at DBS way he shares his knowledge.” Sky Horizon Publishing Ordovician, Devonian, Carboniferous, —Georgina Williams, Deputy Head and Distribution LLC Permian, Triassic, Jurassic and Creta- will remember this early PO Box 7586 Dubai, UAE ceous periods, has often baffled his start to his career.” of Primary at Jumeira www.skyhorizonmedia.com friends, family, and teachers. Pritvik’s Baccalaureate School in Dubai and interest lies in the bio-mechanics of —Peter Moore, Head of all land, water, and flying creatures in Primary School, Dubai Brit- Pritvik’s Year 1 Teacher at Dubai these eras — their birth, body systems, British School eating and behavioural patterns, and ish School environmental and scientific reasons for their extinction. This book covers the fascinating dinosaurs in the Triassic, Jurassic, and Cretaceous periods. Call 056-206 8075 to get this amazing book (AED 37 only) signed by the author himself! You can also buy this book at all stores in Magrudy’s, WH Smiths and Bookcorner
Search
Read the Text Version
- 1 - 44
Pages: