SignageSolutions
Contents Contents Contents Contents Contents CoIntroduction4 Vehicle Graphics 12 External Graphics 28Welcome4 Light Vehicles Outdoor Signage 30 Cars, Wagons, Utes & Vans14Customised Solutions 8 Outdoor Banners 32Hive Marketing & Design 10 Transport & Logistics 16 Pylons34 Trucks, Cabs, Trailers, B-Doubles, Special Vehicles & Machinery Wayfinding & Directional 36 Transport & Logistics 18 Building Signage 38 Rail, Ships & Helicopters Architectural Signage 40 Large Fleets 20 Case Study 42 Hunter Valley Private Hospital Case Study Frost Catering22 Promotional44 Specialised Vehicles 24 Lightboxes46 Pleasure Time 261300 857 500
ontents Contents Contents Contents Contents CoInternal Graphics 48 Specialised Business Sectors 70Window Graphics 50Wall & Floor Graphics 52 Hospitality72 Restaurants, Cafes, Food OutletsBanners54 Hospitality74Exhibitions & Events 56 Bars, Hotels & ClubsInterior Design 58 Real Estate 76Wayfinding & Directional 60 Motor Dealerships 78Reception62 Facilities Management 80Case Study 64 Home Decor 82 Just Liberated Healthcare84Displays66 Retail86Office & WHS Signs 68 Tradies Toolbox 88 © Copyright 2012 Government & Councils 90 Hi-Vis Signs & Safety
WelcomeHi-Vis – where your visual communications come to life.We are signage specialists in a Discover Grand Format printing achieve the best possible results.full service visual communications with our Vutek 3200, the most We hope you will find valuablegroup and one of the largest sign advanced of its kind in Australia. ideas and new inspiration in themanufacturers in Australia. For over following pages. We welcome50 years, innovation has driven In this brochure you will find many your enquiry and extend a warmour business and expanded our examples of the incomparable skills invitation to a personal tour of ourcapabilities. and technologies that are at your extensive facilities at any time. fingertips when you work with the RegardsFor our customers this means team at Hi-Vis.having the opportunity to explore Brett Watsonnew ways to communicate, new From the smallest of stickers to Managing Directorways to enhance the scope of mighty building and transport Hi-Vis Signs & Safetytheir branding solutions, new ways wraps, your job is in the safestto create concepts and now, to of hands. Quality is assured andupscale the lot in terms of size and longevity is guaranteed.image quality that is quite amazing. Our people are perfectionists and pride themselves on helping you1300 857 500
Quality Hi-Vis Signs was the first Australian sign APPROVED APPROVEDAssurance company to achieve Quality Assurance COMPANY COMPANY accreditation in 1994. Since then the company Your Guarantee of has been QA certified for over 18 years. AS/NZS 4801 OH&S ISO 9001 QualityInternational Quality! Management Systems Management Systems During 2011 Hi-Vis was also Certified for Certification Certifica Services Services Environmental and WHS meaning we are now APPROVED COMPANY acmoTemraipnplaepneCyaetcrhetaifiotefvdamcluionemds pyqoauunaylai.tryTehadenesdaeclianocgnctAwirCnAePSiuOtd/NhPeiZMtSsRaa4tP8Oi0oA1VnONHEs&YSDAPPROACVPISOOEPM9DR00P1OQAuVaNlEityYD APPROVEDISO 14001 Environment andManagement COMPANYSystems Systems COMPANYManagement Systems to improve our processes, policies Management AMSan/NaZgSem4SC8ee0en1rrtvtSOiifciyHcesa&stet procedures to International Standards. Certification AS/NZS 4801 OH&S Certification ISO 9001 Quality Services Management Systems Services Management Syste ISO 14001 Environm ISO 9001 Quality Management Syste QA certif ied forAPPROVEDAS/NZS4801OH&S Management Systems APPRCertific Servic APPROVED APPROVED ISO 14001 Environmental COMPANY COMPANY COM Certification APPROVEDManagement Systems ISO 9001 Quality COMPANYCertification AS/N over 18 years!Services APPROVEDISO 1S4e0r0v1iceEsnvironmental Mana Management Systems COMPANYManagement Systems ISO 9 COMPANYManagement Systems Mana ISO 1 AS/NZS 4801 OH&S Certification AMSa/nNaZgSem4SC8e0nee1trrvtSOiifycHicse&atseStimons Mana Management Systems Services ISO 9001 Quality ISO 9001 Quality Management Systems Management Systems ISO 14001 Environmental ISO 14001 Environmental Management Systems Management Systems APPROVED APPROVEDCertification APPROVEDCertification COMPANY Services Services Our CarbonCOMPANY COMPANY Proudly Hi-Vis is proudly an AS/NZS 4801 OH&S AS/NZS 4801 OH&S 100% Management Systems Management Systems AS/NZS 4801 OH&S Australian 100% familyISO 9001 Quality Management SystemsAustralian, privateManagement Systems ISO 9001 Quality naturally. ISO 14001 Environmental ISO 9001 Quality owned and operated FootprintManagement Systems Management Systems company. Our productMsanagement Systems ISO 14001 Environmental Management Systems ISO 14001 Environmental Management Systems are made and produced Certification Certification Certification in Australia by Australians. Services Services Services We value this so much we We value our environment and have wanted to make it public so developed many unique processes to we have become a part of minimise the environmental impact of our the Australian Made national business. This has led us to some unique campaign. This logo is your product ranges as well. Our lighting is either assurance you are dealing natural or LED powered; our screens are with an Australian company washed and the wastewater is treated until with Australian values. it is clear enough to drink; our material off cuts are all recycled; we use roll coil technology to cut down on waste. Some of our environmental practices have been adopted by government organisations across NSW and Australia. www.hivis.com
Big Capabilities Hi-Vis has BIG = Big Results! capabilities... As one of Australia’s largest signage specialists we have BIG capabilities and can transform your BIG ideas into reality. We have the sophistication and scope to meet your requirements, whatever they may be. We are a diverse visual communications group with the most advanced digital printers in the Southern Hemisphere and a network Australia wide. Our commercial graphics capabilities are so extensive there is no job we will not tackle. If you have a BIG idea, we’ll help you make it happen.Large Scale Grand It’s the future of digital printing. LargeProduction Format format has been overtaken. No surface Printing is safe! Hi-Vis can print up to 3.2 metresPlace 60 + highly skilled wide and any length – now that’s a BIGprofessionals in a state of the Size really sign! There is no other technology like it inart facility spanning 8000 square does matter! Australia. Printer speeds of 223 sqm permetres, operating cutting edge hour, image quality up to 1000dpi – theequipment and processes, and you quality truly has to be seen to be believed.have BIG capabilities to produce We are now only limited by our imagination.BIG volumes of signage both large Trust us – everything is now possible.and small. Check out our megavehicle wraps for NBN Co and True Concept to CompletionABC on pages 24-25. Hi-Vis canturnaround BIG graphics in times Design Print Manufacture Installationthat will astound even the mostexperienced signage professional. Hi-Vis is a true concept to specialists; full manufacture andFor one government organisation completion company. From print capabilities; and expertalone we produced 28,000 signs in design, manufacture and installation, anywhere you want.six weeks [that’s over 900 signs per installation, we collaborate withworking day] and delivered them 3 our clients on every level, fromdays ahead of schedule! BIG signs with the simplest of designs to theBIG volumes – no biggie at Hi-Vis. most complex manufacture and installation. We’re happy1300 857 500 to provide the full service, or just the parts you need. We have talented designers and marketing professionals; graphics
Innovation National Our manufacturing base in the& Vision Capability busy port city of Newcastle in the Hunter Region is supportedHi-Vis has been established for over by a large network of distributors50 years and during this time has and installers across Australia.continually grown through the innovation We have successfully completedand vision of owners, Brett & Simon projects all over New SouthWatson. Hi-Vis continually seeks and Wales, Victoria, ACT, Queenslanddevelops new technologies and mediums and Western Australia. We workto improve the visibility and long-term with clients across the countryvalue of our customer’s messages. on a daily basis.Simon& BrettWatson White Out! Expand Your Print Effects! Our printers print a true white on any substrate, enabling total design and print flexibility and freedom. White can also be used as a bump layer to enhance images and make them literally POP out of the image. Check out these graphics on page 39.Who Do We Work With?We work with a diverse client of stickers to the largest ofbase from designers, architects, building signage and everythingadvertising agencies and direct in between. Check out someclients from the corporate, retail, of our recent work in thesegovernment, hospitality, transport sectors starting on page 70.& logistics, building & constructionand property sectors. We produceeverything from the smallest www.hivis.com
Customised Solutions Flat Panels VehicleBranding To Any Size Specialist& Design Hi-Vis pioneered the process We have templates for all makesTake advantage of our of utilising roll-coil aluminium of vehicles so your design can bequalified designers and technology, rather than sheets, so tailored perfectly to fit. We applymarketing practitioners who we can make signs to literally any signage to small cars, bikes,can assist you with designing size with less joins and seams. ships, helicopters and everythingyour logo and sign, applying Utilising this technology provides in between. With our Platinumyour design for maximum a superior and highly durable Graphics Programme you’reeffect, marketing, strategy substrate for digital printing, guaranteed for 3-5 yearsand campaign materials. screen printing, or the application against any fading of vinyl film & laminates. and peeling.Fast Creativity We’re big on ideas and have theRebranding ways and means to make your sign sing. New technology continuallyWhen there is a change of opens up new avenues for originalcompany identity, we understand and stunning signage.the need to move quickly. We canrespond rapidly to major rebrandsof buildings, vehicles, internal andexternal signage across Australia.Engineering, With our onsite builders, we can Building engineer and build anything from large-scale displays to LED sign & Custom panels. Check out pages 66 to see Fabrication some highly creative and unique projects we’ve brought to life! Our large fabrication area is fully equipped with all the required tools for cutting, shaping, bending and welding all types of structures and manufactured components using timber, steel and aluminium. Highly skilled, our team works from customer supplied artwork or Hi-Vis prepared drawings.1300 857 500
Unique Print si EnPap Gc –xcUhno–rUcrloeyupntaednatdinrcsqpoiiatiqndoineutrzytieulgoeeof3a/etonurw3Dwlrnuiarpsmieihllgttreaihiiiacnmhtfwyfettteeliehampcregisnigrttfrwaseikfseanegshpjttcvoeieinh&ttiibsecnsgicrhs–ias–nnanukoancp,lnodypytg–olsuybes11aa00nm0ncs0eorl,dopuirs Capabilities bPuosteinnetsiasl –four ynoluirmited.Wh &r– Paea cC wIgf ecw–tanElwToeurrarknadfpoydcnaaerdtltrrtLoitbnreccaaiiolanvoeotrte,lnunetnsaafEpmtsrltosegersserddCnoedxeiaeAggb,tiovublaanepfioclifgottinlaplno,ytSairatyghalrayninue–icfesnilsldyuapsu–aokuy–lmttimsdubtpenoimoo1uri,sgrufnania0stniPe1tinrsuwdtePta0VaykymirpatwneosCisneayrngasthoe,laetrsfao–afrmoiowebtrfpsraiyalaimotyripreuocaesonur,tr?ye, For fast turnaround, superior quality and ultimate flexibility, Hi-Vis operates a range of cutting edge, digital printers, contour cutters, plotters and engravers including the most technologically advanced Grand Format printer in Australia. Imagine the possibilities! We literally have designer dream machines! Capable of transforming any surface or substrate into a unique, memorable print. You imagine it and we can print it – it’s really that simple! possImibailgitiniees!the Hi-Vis It’s no accident Hi-Vis are one of the leading signage manufacturers in Warranty the country. We work very closely with international and local materialProgramme manufacturers and we just do the best job from a client’s perspective. Unlike many sign companies we are approved converters for all the major international brands as shown below and have been a 3M Diamond Partner for 25 years. Combine this with our expertise and experience and Hi-Vis can offer exceptional warranties on all its products. Just take a look! H i-Vis Signs In House Warranty on approved media F ull Warranty Guaranteed 3 Year & 5 Year Warranty using EFI inks – 3 Year direct print & 5 Year with protective clear over laminate www.hivis.com
StraMteagrikCetingCreative DesignBEE FOCUSSED BEE INTEGRATEDYour Business. Our Focus Hive Marketing is a full service integratedThe Hive team are 150% focussed on you and marketing communications agency. Our teamyour business. We want to fully appreciate members work with you and each other in ayour vision and see ourselves as an extension spirit of collaboration to define your marketingof your business, focussed on achieving your needs and develop integrated solutions, bothbusiness objectives and outcomes. traditional and digital.BEE ORGANISED SHOW ME THE HONEY!Cost Effective Convenience It’s all about results. If you get results we getYou know, a real bee hive is a highly results. It’s really that simple.organised society of hard working bees who The Hive can assist you launch a newhave an awesome sense of time, distance business, find new customers, introduce newand direction. products or improve your corporate image.Hive Marketing is just like a real bee hive.We are literally a one stop solution for allyour marketing and communications needs. BEE Smart and give us a call with your next projecthivemarketing.com.au 02 49202757 / [email protected]
DID YOU KNOW?HAaWasiLn-eVLdwihysedaoleclvusaaerinsgmanypadortroeeukfadreemistsciinsa,gigtHnoeanimdvgaeamelltyM?eardraikaereklssteii.gnt.i.ngng HECPwbivRUrvitieeehERrfyAiPpsitnTrhOoatIionVSdsguETEtcuA,wBtdNieoTiUoGnHpI.LwIrOBToiWU,tLdhbEuGeuacHRtterdaTi,EnifniFSftseesUUfnrgoLeLorrnaTtamctSoneendy.d.olyur & Design.STRATEGY PROMOTE §§§§§B eDACMMeauaaatdSmarrikkbetperenaaattcsiiintngeeeggngMRsCPiegc&losataenPcasrhrocijnehgcts §B eBeraOnudtinTghere § SignageORGANISE CREATE § Advertising § Social Media § Events § EDS-piMreoacnrtskoMertasinhrkgipeting §§B eBGerraCanprdheiinacgtiDveesign § § § Web Design § IDWlluigesbittraaDltPeiovrnoedloupcmtioennt § BeE Friendly & § LIKE US ON § Corporate FACEBOOK! Communications§§§§§B ePPISEnerraviconlOeemetnnsrMottgsitPaviaor&enonnsamEai/gsRlxoeeIhettmideiwobmenaitnsrisodt nss ACCESSORISE §§§B eWRCeeaoOtlralpuAilotrFrstaitttoaeunOtsdffiincge Design § Receptions § Internal Displays
1300 857 500
Vehicle Graphics 13Vehicle GraphicsVehicle Graphic Specialists since 1960! www.hivis.com
Light Vehicles Cars, Wagons, Utes & Vans Mobile Marketing is one of Turn non-productive drive time into to design, print and installthe most cost effective means shameless self promotion. Hi-Vis graphics onto any light vehicle. vehicle graphics come will full Any vehicle, any budget. to drive your brand and key protection and warranties under Driving your brand harder. marketing messages 24/7. our Platinum Graphics Programme so rest assured your graphics will probably outlast your vehicle! From the smallest SMART car to the largest van, Hi-Vis has the expertise1300 857 500
24Hh7iogudhrasVyasisdaibaiwyliet,eyk! Vehicle GraphicsDid you know? 15Hi-Vis has installed graphics www.hivis.comon over 15,000 vehicles!
1300 857 500
Transport & LogisticsTrucks, Cabs, Trailers, B-Doubles, Special Vehicles Vehicle Graphics& Machinery... 17Hi-Vis understands the old motto“time is money”. Time off the road isnon-productive. We understand youneed your vehicle back on the road inthe fastest amount of time.Hi-Vis has the capability to wrap vehiclesof any size. Our massive 8000 sqm facilityallows large vehicles to be quickly and easilydriven in, wrapped and then back on theroad again.The vehicle comes in at a pre-scheduledtime and is promptly completed and readyto be back on the road. At all times ourcustomers know exactly how long thevehicle will be off the road so they can alsoplan within their own schedules.Hi-Vis started as a sign writing company,so it stands to reason we can offer ourcustomers a range of graphic applications,from traditional hand sign writing and vinyllettering to large scale digital graphics andfull truck wraps.Our printers are the largest and mostadvanced in Australia, allowing Hi-Vis tooffer the largest scale scope and rangeof any sign company.deHlivie-–rVsiestvhereygtooimdse. www.hivis.com
Transport Did you know?& Logistics Hi-Vis are currently undergoingRail, Ships & Helicopters certification with CASA, so Hi-Vis can wrap large scale aircraft1300 857 500 in the very near future.
Vehicle GraphicsWhen large scale vehicles can’t be easily transported to the Hi-Vis 19facility, the Hi-Vis A-Team rolls into action and installs on site. www.hivis.comHi-Vis regularly installs signage onto name onto the port, starboard andlarge scale transport and logistics stern of the vessel including thevehicles and vessels across NSW. helideck. This all had to be done in a very short timeframe and hadAs an example, signage on the to take weather conditions intoOcean Protector [pictured] was account. At least we know the teaminstalled by the Hi-Vis A-Team. is not afraid of heights!The team had to climb a scaffoldmounted onto the Hi-Vis floating Every day the Hi-Vis team tacklesbarge, bobbing around the harbour, large scale, challenging projects.to reach the starboard side of the We have the experience, expertisevessel, 20 metres above water level, and equipment to make theand then be placed into the crane’s seemingly impossible, possible!main bucket to gain access fromthe port with a 40 metre elevatedplatform. Our team did a great joband managed to install the ship’s
Large Fleets From 1–1000, Hi-Vis Has You Covered!Ask about our Fleet branding is a viable option for brand awareness, recognition, recall and even call to action.1300 857 500 Branding or rebranding a fleet of and key messages – from vehicle to vehicles can be a daunting process. vehicle. We also develop our own Partnering with a sign company templates for most vehicle makes such as Hi-Vis can take away an and models, so it really doesn’t endless amount of hassle and lost matter what vehicle is in your fleet, time on the road. we can adjust the designs to suit the vehicle. Hi-Vis only use high quality materials and digital printing and installation We also understand that each driver techniques so the entire fleet will will treat their vehicle in different be consistent with your branding ways, and offer a complete 3 year
Vehicle Graphics 21aHreiY-osVuarisffeleweittsh Did you know? INTEGRATED DESIGN & PRODUCTION Door handles, bumpers, windows, warranty on all our fleet graphics. Designing for a vehicle is more wheel arches plus visibility and Our Platinum Graphics Programme specialised design. Some companies presence on the road... it really does aims to educate fleet drivers how to go wrong by investing a lot of time pay to come to a specialised sign care for the graphics over the longer and effort with designers who do not design team to have your vehicles term as well as understand what understand the different variables to designed for the application. vehicle graphics are designed to be considered. achieve whilst on the road. www.hivis.com
1300 857 500
Case Study FiTslehCeetoKnBesyrisattneodnicnygCatering Vehicle Graphicsto yourFleet 23Harness The Power Of Fleet BrandingFrost Commercial Kitchens & Bars are one companyutilising the power of fleet branding.Over 20 vehicles have been wrapped valuable brand recognition whileby Hi-Vis from small Holden Barinas, our fleet is on the road.”wagons, and utes right through tolarge scale Isuzu trucks. “Hi-Vis has been instrumental in our rebranding project and veryManaging Director of Frosts professional to work with. Initially,said, “Our fleet is a critical part the design we had done by ourof communicating our marketing advertising agency didn’t workmessage of being a unique, with some of our vehicles, somodern, progressive company. We Hi-Vis reworked many of thehave worked with Hi-Vis to ensure designs to ensure the applicationall our vehicles, no matter shape was consistent and withoutor size, have consistent corporate glitches. I am very pleased withbranding, allowing us to gain the results.” www.hivis.com
Specialised Vehicles When It’s Bigger Than Big... Hi-Vis has developed Over recent times, Hi-Vis has of the new optical fibre cable rollquite a reputation...for wrapped many large scale out. Over 260 square metres of specialised vehicles. material was used, wrapping sides, big capabilities! back, front and even the roof! The NBN Co “Discovery” exhibition trailer was wrapped by Hi-Vis. It ABC National’s new trailer has is now seen travelling across the also recently spent time with the country providing demonstrations Hi-Vis crew. Stunning artwork was1300 857 500
Vehicle Graphicscreated by the ABC’s design team 25and then given the Hi-Vis treatmentto ensure application surety. wBitihgeparsoejectsWhat makes Hi-Vis truly unique www.hivis.comamongst other sign companies, isour big capability. Investmentin cutting edge equipment andin-house staff experience andtraining means we can do a lotof really big and very cool stuff...
Pleasure Time We Can Wrap Anything!1300 857 500
Transform the Hi-Vis has wrapped some pretty Did you know? ordinary into cool items. We love to be creative. Fridges become footy fans, Unique Modelling Servicetreasured and skateboards become the envy Hi-Vis can provide a modelling service. unique! of friends, speed boats become If you need to present your concepts faster with snazzy graphics. to the powers that be – a real life Anything is possible. No surface model might be more powerful than is off limits. a powerpoint! Hi-Vis has access to all the latest in international materials and techniques enabling our teams to design and wrap any surface. Vehicle Graphics 27 Boats Bikes Helmets F S SRrGRkiudaaoorcgftabeeCedobsaCaobrartaidskrrssdess CCTaraarrsialevrasns www.hivis.com
1300 857 500
External Signage 29External GraphicsBe Seen. Experience The Quality With Hi-Vis. www.hivis.com
Outdoor Signage Think Outside the Square...1300 857 500
Did you know? External SignageHi-Vis can add greater exposure to your 31outdoor sign by using reflective materials.We are 3M and Reflexite reflective filmconverters, so if you want that extraPOP after dark – give us a call. Thisis the same reflective used by Roadsand Maritime Services, NSW Policeand NSW Tourism road signs [pictured].From supersites to SIMPLE, CONCISE, BRIGHT – in house engineering and fabricationroadsides, outdoor these are the key concepts when facility for custom and unique thinking outdoor. Different viewing signage projects. signage reaches angles and perspectives need to consumers on be considered. Hi-Vis are preferred suppliers the move. of signage to Roads & Maritime Hi-Vis are your outdoor signage Services, NSW Tourism, National specialists. For over 50 years our Parks & Wildlife Services, local expertise has been honed to know government and councils. These what works and what doesn’t. organisations trust Hi-Vis with We also use the highest quality their highly compliant signage materials to ensure longevity requirements every day of the year. from the elements in an outdoor Why not you? environment. We also operate an www.hivis.com
of LbiananrAgneeusrssttraraanlnyiagwehereOutdoor External SignageBannersAttention Seekers 33Outdoor banners are inexpensive & attract attention quickly.Banners come in all shapes and and can be water and salt resistant.sizes and are primarily used toattract attention to a particular Contact Hi-Vis for the best attentionsite or event. Hi-Vis can supply a seeking solutions!massive range of banners includingteardrops, bowheads and POSflags, vinyl banners with ropes andeyelets and site banners such asdigitally printed banner mesh.Banner skins are an inexpensiveoption to mount large scale signageto external areas such as buildingswith sail track, as an alternative toprinted metal. With our in housedigital printing capability, graphicsare enhanced with photorealisticquality and to 1000 dpi, materialsand mounting accessories are builtto last in an outdoor environment www.hivis.com
1300 857 500
Pylons External SignageMake a Statement 35 Pylons make a real Pylons really make a statement. cdaa&ennsPycibgyoeslnlohocenuadusrps!tet,oosmize visual statement Generally they stand straight and tall in today’s busy above everything else around them. and cluttered Hi-Vis can produce customised environment. pylons to any shape, size and colour. We also have access to the latest in full colour LED technology with remotely programmable messaging systems. Whether they be for entrances, informational, wayfinding or directional, Hi-Vis has the solution for your site. Hi-Vis has special capabilities. Hi-Vis invented & developed the core technology of flashing school zone signs as seen throughout NSW and QLD. These signs use the mobile network to programme activation/deactivation from our office in Carrington. Hi-Vis design, engineer, fabricate and install all parts of the pylon and have our own in house equipment and specialised technicians to ensure not only the pylon is fabricated and installed correctly but the electronics systems are fully operational from Day 1. If LED messaging is being utilised full training is provided. Hi-Vis is uniquely positioned to offer a full service to clients when pylons are a desirable option. www.hivis.com
Wayfinding& DirectionalDirecting your customers around your site is easy when Hi-Visbecomes involved.When needing to direct people or Car parks are a speciality! We cantraffic around a site, Hi-Vis is your provide a complete range of notone stop shop for all wayfinding & only signage but safety productsdirectional signage. Not only can including wheel stops, linemarkingwe design a unique concept, we and the latest in motion sensorare preferred suppliers for most technology to control traffic enteringmodular signage systems including and exiting your site.curved frame and backlit signs.
youtDrowoHany’i-tV–liossc.eome External Signage 37Case Study National Parks & Wildlife Services Hi-Vis Signs are a preferred supplier We also provide the to National Parks & Wildlife Services parks with a number throughout NSW. We have of customised safety produced a range of park signage products all branded including major park entry, primary with the NPWS directional, totems, regulatory, trail lyrebird! sign panels, and minor park signs.
Building Signage Outside Looking In1300 857 500
Did you know? External SignageWhite Ink technology, now available at 39Hi-Vis, can literally make your imagesPOP. By placing a layer of white inkbehind an image – the image lifts off theprint giving the image a 3D effect. Ourwhite ink printer can print both back andfront window graphics in a single pass soboth sides of the window appear with thesame image! Amazing image quality!Branding or rebranding Communicate the right messages to All types of materials can be used your workplace, your customers and staff by adding depending on budget, level of fresh signage to the external facades use and longevity required. Hi-Vis building or work site and windows of your workplace. can visit on site and are happy to has never been easier. Buildings can be transformed prepare full recommendations on by adding company logos to the optimising visible areas. building, photorealistic images can be installed on accessible Just give us a call. windows, even boundary fencing can be utilised to reinforce company messages and key information to clients, suppliers and staff. www.hivis.com
Image courtesy of Murray McKean & EJE Architects.1300 857 500
Architectural Signage We’re Your New Dream Team Hi-Vis is literally an architect’s dream team. We can supply everything an architect requires from a signage company. Working with architects on a beginning, sometimes the ideas External Signage daily basis, we have built up an are too big for the client’s budget! understanding of an architectural When we work with the firm at the firms ultimate requirements. Some specification stage, Hi-Vis can add of the most challenging projects optimal value by inputting ideas, emanate from an architectural material recommendations and design studio, but that’s ok we like relevant manufacturing times. a challenge - it extends our ability and ultimately our capability. Hi-Vis also has in-house the most advanced digital printing equipment No matter the scale of project, in Australia so nothing is beyond Hi-Vis can enter at any level, your scope of works! although it is always best to get a sign company involved from the 41HDi-rVeaism Team www.hivis.com
1300 857 500
Case StudyHunter Valley External SignagePrivateHospitalOld Is New Again...When Hunter Valley Private Hospital built a new wing, theyrequired a signage approach that integrated the old and the new. HVPH is situated adjacent to the Feature vinyl lettering was includedHunter Wetlands, home to a cute on the first floor to communicatelittle character, the long neck the story of the connection with 43turtle. This local inhabitant features the hospital and intrepid explorer,prominently in all signage design Douglas Mawson.completed, including windowgraphics, wall signage, illuminated All signage was designed andlight boxes on entry and signage manufactured by Hi-Vis at oursystems throughout the hospital. Newcastle facility and installed by the Hi-Vis install crew.Colour coded floor plans weredirectly printed onto anodisedaluminium at reception and lift areasplus white ink technology wasutilised as a bump layer and as atrue white print to delineate differentareas of the hospital. In choosinganodised the hospital was searchingfor something new, unique andprofessional to reflect the values andquality of the facility.As a health initiative, stairwellswere dressed up with frostedgraphics on glass panels toencourage visitors and staff totake the stairs over the lift. www.hivis.com
Promotional Stand Out From The Crowd Hi-Vis can assist you stand out from the crowd in so many different ways. Any promotional signage is there to From inexpensive corflutes and inform, promote or draw attention. promotional flags to more expensive This can take the form of many permanent fixtures installed on different signage options and posts into the ground, Hi-Vis can will depend on several factors. assist with the right product for the Longevity required, budget and right situation. message are all important issues guiding the most suitable options and applications.1300 857 500
External SignageDid you know? 45Designer Dream Machine www.hivis.comOur new Vutek GS3200 digital printer is themost technologically advanced digital printer inthe Southern Hemisphere! No, we’re really notjoking – it is truly amazing! Capable of printingdirect to any substrate or surface includinganodised aluminium, corflute, colorbond, acrylic,glass, polycarbonates, pvc, vinyl, reflective sheeting,canvas, synthetic paper, plyboard and the listgoes on! The printer’s super image quality isliterally a designer’s dream machine.New white ink technology allows highlightingof specific parts of an image and transforms thatimage with 3D-like quality in a single pass.Large volumes are not a problem either –we can print 223 sqm per hour at 600 dpi withphotorealistic images that will blow you away!
Lightboxes Light Up Your Life!Lightboxes are a unique Hi-Vis can fabricate any size or LED’s have far greater potentialalternative for exposure shape lightbox required. Utilising with lit products such as lightboxes. LED lighting technology not only day and night. outputs far greater light than normal External graphics are generally fluorescent tubing, but is much digitally printed onto either acrylic more economical over the lifespan or polycarbonate to assist in not of the sign. only longevity but also safety of passing customers. Hi-Vis have led the way with commercial and industrial LED LED lighting can also be placed lighting initially in a bid to use onto logo signs on the external less energy in our own extensive facades of buildings and pylons. manufacturing facility however,1300 857 500
sLuasEvineDgs tlelihsgeshtpeilnnaegnregtyb!y External Signage 47Case Study BIS Industries boardroom windows and several internal offices. The boardroom door was spruced When BIS Industries established a new up with a fresh new door wrap with the corporate HQ in the Newcastle CBD, new BIS Industries branding. Hi-Vis were engaged to provide some much needed signage to identify the new Client happy = Hi-Vis happy! tenants and give the place a mini facelift before the CEO arrived! A new external lightbox was placed on the top of the building, name blades were installed on the front entrance wall, optically clear privacy film with the BIS logo was used on the front doors and reception,
1300 857 500
Internal Signage 49Internal GraphicsCreate a BIG impact with Hi-Vis capability www.hivis.com
Window Graphics Not Just Window Shopping!1300 857 500
Search
