Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore A4 WMS_Catalogue Optimized for WEB (1)

A4 WMS_Catalogue Optimized for WEB (1)

Published by amitdogra35, 2020-08-08 12:45:50

Description: A4 WMS_Catalogue Optimized for WEB (1)

Search

Read the Text Version

Design adds value faster than it adds cost. Catalogue 1 Brunel Way, Slough, SL1 1FQ T: 020 34750507 || W: www.whitemagicstudios.co.uk || E: [email protected]



White Magic Studios is the marketing arm of Studio24. Studio24 has been working in the field of allied publishing activities since the year 2000, thus aquiring an enormous experience in the field. We are proud to list below the services that we provide. • Book Designing (Covers & Internal Layouts) • Web Designing & Development • Motion Graphics (Animated Audio Visuals – 2D Animations, 3D Animations, E-Learning Modules, Event Presentations, and Explainer Videos) • 2D / 3D Illustrations • Branding & Stationery (Business Cards, Brochures, Displays, Advertisements, Letterheads) We offer a variety of additional services that go beyond our usual offerings. • Editorial Services • Short-run / Custom Printing • E-Book Conversion • Book Trailers • Author Websites • Author / Publisher Branding We treat all our clients, small or big, with our best efforts, support and dedication. We are passionate about meeting our commitment to our clients.

BOOK layout 45 Amazing tshetfmaEcrrvhuouvaemsncedtnocweulovorionsangentsrysrdtiauorwentucurhcitsctaiuhtehctrenooiedvwwtusitlestiwtuzitmhhachhetahieeiycvosmhemnmpstamoeuojdhoeadspaestkatrvleeyinec. Architectural Wonders Rearrange the letters and write the names of the countries in which these wonders are located. 1. The Colosseum was a huge oval arena used to contest fights between men called gladiators or with wild animals to entertain the audience. (EORM) Machu Picchu, which means 2. ‘old peak’, was built by the Inca Empire on top of the Andes Mountains. It is believed to have been a royal estate or sacred religious site for Inca leaders. (EUPR) 3. The Great Wall is the world’s longest man-made structure. It was built to protect the borders of the Empire from foreign invaders. (HCNIA) ©PERIWINKLE® 58 Let’s Discover Our World 2

40 Football inTbhyteoLdroSaentydrd’seoaefnnto’dosttrKybaeeaflnflllioscwwinlieggcrthaeortnsidn.sHspuigisrheedd During the 12th century, the game of football was more of a ‘mob football’, far removed from rules, often leading to riots. It was much later in 1863 that the game, now called ‘soccer’, began to be played according to the rules laid down by the English Football Association. Today’s footballs are very different from those used hundreds of years ago. The balls used in Early Britain were made from inflated animal bladders. They were covered with leather and sewed. Balls of real leather were used in the 1982 World Cup for the last time. Thereafter, balls made of durable synthetic leather were introduced. bladder – inner layer – ► Football shoes are called cleats. holds air provides cushion ► A football usually has 32 panels. Its circumference is 27 to 28 inches. outer cover – lightweight Studs give a better and water-resistant (made grip on grass pitches. of synthetic leather) I. Circle the correct answer. ©PERIWINKLE® 1. Each team consists of 11/13 players. 2. A match is played in two 45/60 minute halves. 3. To score a goal, the ball needs to merely touch the line/ cross the line. 4. The player is shown a yellow/red card as a warning for a serious foul. The player is dismissed from the game if he receives a yellow/red card. 5. All players, except the one that takes the penalty kick, must be outside/inside the penalty area until the ball is kicked. Let’s Discover Our World 58 3

BOOK layout Exploration – Let’s learn about the 32 Boats and Ships journey from the early boats to the modern ships. Dugouts (log boats) and rafts were used as boats in ancient times. The Vikings were The people of Ancient Egypt explorers and travelled the river Nile by warriors. Their war boats made of reeds, wood, ships were long and palm fibre. and narrow with the carvings of animal head as posts. The manufacturing of stronger and larger ships led to longer voyages and frequent explorations by Europeans. Vasco da Gama, Christopher Columbus was an a Portuguese Italian explorer. Santa Maria was commander, the largest of the three ships used sailed from by Columbus in his first voyage. Lisbon with a fleet of four vessels in quest to discover India. One of his ships was called Sao Gabriel. Did You Know? ©PERIWINKLE® Vasco da Gama took along cinnamon and pepper, silk and jewels, together with some Indians when he returned to his country. 42 Let’s Discover Our World 4

Beach and Water Beach volleyball was 39 Sports included officially as a sport in the 1996 Name these sports. 1. Olympic Games. 2. 3. 4. 5. 6. water skiing windsurfing beach volleyball surfing jet skiing parasailing ©PERIWINKLE® Let’s Understand ! 51 • In snorkelling, you remain near the surface of the water. You breathe through your mouth with the help of a snorkel (a mask and a tube). • In scuba diving, you go deep inside the water and breathe through an oxygen mask. Let’s Discover Our World 5

BOOK layout 36 Annual Academy 1tT9eh5ilnee3vtAiesarcennaddaditenhimoatnvyhaeelAlbyUwenseaininrtdecbedsrow1Sa9tedar6cet9aefss.itriensdt Awards In 1929, the Academy of Motion Picture Arts and Sciences, located in Beverly Hills, California, US, started giving awards to recognize achievement in the film industry. These awards are popular as ‘Oscars’. Name the following to test your knowledge 2. Name the actor about the Oscar-awarded movies. 1. Actor Tom Hank’s who received the ‘Best splendid performance as a Supporting Actor Award’ in the movie the Godfather. slow-witted but good-hearted He played the role of the person who becomes son who is reluctant to involved in historically accept the dynasty of crime run significant events won him an Oscar in 1994. Name by his father. this romantic-comedy 3. This historical-period based on a novel of the same name. drama is directed and coproduced by Steven Spielberg. It is based 4. Name this epic fantasy drama on the life of a German businessman who saved which is the third instalment of the series the lives of more than a The Lord of the Rings. It showcases thousand, mostly Polish- the final stage of the main antagonist Jewish, refugees during the Holocaust by Sauron’s conquest of Middle-earth. employing them in his factories. Name the movie. 5. The movie Titanic won 11 Oscars out ©PERIWINKLE® of its 14 nominations at the 70th Academy Awards in 1998. Name the lead actress who was nominated for the ‘Best Actress Award’. 52 Let’s Discover Our World 6

6. This is a 2009 film 7. The Sound of Music, a directed by Danny Boyle, 1965 American musical drama an adaptation of the film, received the award for novel Q & A by Indian the ‘Best Original Music author Vikas Swarup. Score’ besides four other The film revolves awards. Name the around a young man lead actress, who played living in the slums of the role of a governess and Mumbai who ends up at was nominated for the ‘Best a quiz show. Name the film. Actress in a Leading Role’. 8. This biopic on the band Queen 9. Name the actor who won four Oscars in 2019. The actor received the ‘Best Actor Award’ for his role as a Rami Malek won the Hispano-Roman General ‘Best Actor in the Leading in the epic historical drama The Gladiator. Role’ award for his outstanding performance as the lead singer Freddie Mercury. Name the movie. 10. This 2017 fantasy romance film tells the story of an isolated woman who is trapped in a life of silence until she discovers a unique relationship with an amphibious creature. Name this movie which won ‘The Best Picture’ and ‘The Best Director’ award. Julie Andrews The Shape of Water Forrest Gump Al Pacino Russell Crowe Kate Winslet Schindler’s List The Return of the King Bohemian Rhapsody Slumdog Millionaire ©PERIWINKLE® Let’s Know! The Oscar winner receives a gold-plated statuette: a knight standing on a reel of film and holding a sword. It was designed by Cedric 53 Gibbons, art director of Metro-Goldwyn-Mayer (MGM) Studios Inc. Let’s Discover Our World 7

BOOK layout 39 Flamboyant Fashion fpmahsarhd‘aiHoeseanbuawytbehlleeic,caohadunirtnduegfreeefrxa’ scsilshtuoiasoinveFexrhpecoenluonctsshehivsee.s, Man has come a long way from the stage of primordial ancestors who wore clothes merely to cover and keep themselves warm. Today, man uses clothes to serve other purposes also: to express one’s personality, to stand out, or even to intrigue. There are some fashion houses and designers who have had a more defining and lasting influence than others on how fashion evolved. Louis Vuitton is a French fashion house which was founded in 1854 by Louis Vuitton. Starting solely with handcrafted trunks (suitcases), it expanded to clothing, purses, shoes, and other accessories. It is widely recognized by its branding patterns on its products. GUCCI was founded by Guccio Gucci in 1921 in Florence. It is an Italian luxury brand of fashion and leather goods. In a move to do better for the environment and animals, Gucci banned the use of fur in its products 2018 onwards. CHANEL was started by Gabrielle ‘Coco’ Chanel in Paris in 1909. This fashion house is involved in haute couture and retail. Since its inception, Chanel replaced over-the-top and constrictive clothing for women with elegant suits, dresses, and trousers that were more functional. DIOR, founded in 1946 by Christian Dior in France, made its brand name in jewellery, perfumes, clothing, makeup, and accessories. It also continues its tradition of haute couture. Yves Saint Laurent, a renowned designer himself, was first hired by Christian Dior to work alongside him. VERSACE is an Italian luxury fashion company founded in 1978 by ©PERIWINKLE® Gianni Versace. The company’s logo was inspired from the floor of the ruins where Gianni and his siblings used to play as children. Versace also has hotels under the name of ‘Palazzo Versace’. 56 Let’s Discover Our World 8

A logo is a creatively designed motif/design associated with a particular company or brand. It not only helps the people to recognize the brand easily but may also serve as a status symbol. Match the logos to their brand names. 1. Louis Vuitton b. a. 2. Chanel c. e. 3. Gucci d. 4. Versace 5. Giorgio Armani f. 6. Yves Saint Laurent g. 7. Dolce and Gabbana ©PERIWINKLE® Let’s Know! 57 ► The official syndicate of couture designers organizes shows twice a year in Paris (in January and July). The most exclusive and expensive fashion houses present outfits that might be ordered by potential clients and also showcase the designers’ ideas about fashion trends and brand image. ► The first dedicated fashion magazines appeared in England and France in the late 18th century. Let’s Discover Our World 9

BOOK layout Letter Aa A is for ants, ants ate an apple, straight from the plants. A arrow ©PERIWINKLE® a axe 8 ankle alligator Literacy Book – Junior 10

Circle big A with green crayon and small a with red crayon. A C A aA a x za B a A dP Practise the strokes. Trace the letters. 1 2 3 12 ©PERIWINKLE® Literacy Book – Junior 9 11

BOOK layout ©PERIWINKLE® 12

2 8 My Bicycle let ride down away put bicycle orange wheels helmet This is my new . It is big and . It has two . I wear a when I ride it. I like to ride my . ©PERIWINKLE® Reader ( JKG) 33 13

BOOK layout THEME 1 Transport of Food & Minerals in Plants Syllabus – Key concepts Transport in Plants • Diffusion – definition • Osmosis – definition, example, semipermeable membrane, root pressure; active transport • Transpiration – definition, importance, and factors affecting transpiration • Structure and function of Xylem and Phloem in detail • Importance of minerals: macro- and micro-nutrients; three deficiency diseases caused by lack of these essential nutrients All living cells need energy to carry out their basic life processes. We eat food; it gets digested in our alimentary canal, and then the nutrients are transported through blood to all our body cells. Blood also supplies oxygen to all cells. Using this oxygen, cells derive energy from the nutrients. Did you ever wonder how the cells of a tree get their nutrients? Do they also have a circulatory system with a heart, blood, and blood vessels? If not, then how does the transport of food, water, and minerals take place? All the living cells of a plant need food (glucose), water, and minerals to carry out various metabolic activities such as photosynthesis, respiration, and synthesis of proteins and enzymes. Unicellular organisms such as Amoeba and Chlamydomonas and multicellular organisms such as Spirogyra do not need any transport system as their entire body is always in contact with the surroundings. In other words, these organisms have a large surface-area-to-volume ratio (i.e. the surface area of an organism’s surrounding water as requirement of nutrients body/the volume of the body). Hence, they source of nutrients can directly absorb water and nutrients from the surroundings through diffusion across the body surface. But in case of a tree, e.g. a mango/coconut requirement of nutrient source ©PERIWINKLE® tree, only the roots are in contact with the nutrients Mango tree soil – the source of water and nutrients – Spirogyra and leaves prepare food. So, such plants whose all the cells are not in contact with their nutrient source (surroundings), need a transport system. 6 Biology – Grade 8 14

Such transport of substances at the expense of energy is called active transport. Passive processes do not require energy, e.g. diffusion and osmosis. Root Pressure Roots anchor the plant firmly to the soil and absorb water and nutrients from the soil. Root hairs present on roots increase the surface area of roots for an efficient absorption of water and minerals. path of epidermis cortex Let us have a rough idea about the water internal structure of plant root to path of water understand the movement of water root hair and minerals through it. The outermost layer of the root which is in contact with the soil is called epidermis. Few cells in the epidermis differentiate into root hairs. The region following the epidermis is called cortex, which is multilayered. The cortex phloemxylem endodermis is followed by a layer of cells called pericycle endodermis. Endodermis encircles the central region of the root. This region Path of water consists of vascular tissue. Vascular tissue soil water  root hair cell/epidermis  cortex  is the conducting tissue of plants and is of two endodermis  xylem vessels types – xylem and phloem. Internal structure of a plant root The root hair is enveloped by soil particles soil particles surrounded by a film of water with minerals dissolved in it. Some salts/ film of water minerals diffuse and some are root water actively transported into the root hair entering hair, thus increasing the solute cell root hair concentration inside the root hair higher concentration cells. The water (solvent) in the soil of water molecules ©PERIWINKLE® starts moving into the root hair cell due lower concentration to osmosis. As a result, the contents of the of water molecules cell start pushing the cell membrane to the cell Absorption of water and mineral wall. This pressure is called turgor pressure. salts by roots of plants Transport of Food & Minerals in Plants 7 15

BOOK layout THEME 2.2 Reproduction in Humans Syllabus – Key concepts • Sexual reproduction in humans • Main organs of male and female reproductive systems Male Reproductive System The male reproductive organs or the genitals include: • A pair of testes • The duct system made up of the epididymis and the vas deferens • T he accessory glands – a pair of seminal vesicles and a prostate gland • The penis backbone The testes are oval-shaped organs that secrete testosterone and produce millions of sperms per day once a boy has attained puberty. Mature sperm cells are extremely small. They have a tadpole-like structure with a head that contains the genetic material and a tail that helps it push its way through. The epididymis is a set of coiled tubes (one on each testis) that stores sperms. It connects to the vas deferens. Vas deferens is the muscular tube that carries the sperm-containing fluid called semen till urethra (the tube that emerges from the urinary bladder). seminal urinary bladder The epididymis and testes hang in a pouch- vesicle vas deferens like structure called the scrotum. For sperm rectum production, the testes temperature needs to prostate gland be 1–3°C lower than the body temperature. anus urethra Male reproductive system penis The scrotum helps to regulate the testes epididymis temperatures. When the body is cold, the scrotum shrinks and becomes tighter to hold testicle the body heat, and when the body is warm, it scrotum becomes larger and loose to get rid of extra heat. (And the male doesn’t even realize it!) nucleus The accessory glands – seminal vesicles and the prostate gland – produce a whitish fluid called seminal fluid that nourishes the sperms and facilitates their mobility. head middle tail Semen is the thick, whitish fluid that consists of sperms ©PERIWINKLE® piece and secretions from seminal vesicles and the prostate gland. A sperm 4 Biology – Grade 8 16

Female Reproductive System pelvis Unlike males, females have their reproductive system or genitals within their pelvis. It consists of: fallopian uterus • A pair of ovaries tubes vagina • Fallopian tubes ovaries • Uterus cervix • Vagina Ovaries are small, oval-shaped, paired organs, each lying on one side of the uterus near the lateral walls of the pelvis. They produce eggs and hormones fallopian egg implanted (estrogen and progesterone) that help in the tube in the uterus development of eggs and the foetus. The process fimbria by which an egg is released into the fallopian tube is called ovulation. Ovulation is periodic – it occurs around the mid of the menstrual cycle – with each ovary taking turns in alternate months. Only one egg is produced in each ovulation process. ovum develops thickened walls of in ovary uterus to hold the Fallopian tubes are like two arms of the uterus, developing foetus each around 10 cm long and connecting the uterus to the ovary. The end of a fallopian tube near the Female reproductive system ovary is funnel-shaped and fringed. The fringes are called fimbria. This funnel end wraps around the ovary but is not completely attached to it. On ovulation, the egg enters the fallopian tube through this funnel end. The tube has a lining of tiny hairs to facilitate egg movement within the tube. The egg stays in the fallopian tube for some time. If it is fertilized by a sperm, it forms a zygote, which later gets implanted in the uterus. However, if the egg is not fertilized, it dies off and moves out of the body along with the menstrual flow. The uterus or womb is the major part of the female reproductive system. The fertilized egg gets attached at a fixed position in the uterus after a week. ©PERIWINKLE® This process of attachment of the developing embryo to the uterus wall is called implantation. The foetus develops in the uterus. The uterus provides mechanical protection and nutrition to the foetus and helps remove waste from it. When the foetus is completely developed into a mature baby, the uterus walls undergo strong, recurrent muscular contractions (labor) that help in pushing the baby out of Reproduction in Humans 5 17

BOOK layout 3 Natural Vegetation and Wildlife We will learn about... › Wildlife › World distribution of wildlife › Natural vegetation › Wildlife in India › World distribution of natural vegetation › Conservation of wildlife › Natural vegetation in India › Conservation of natural vegetation Natural vegetation and wildlife are renewable natural resources of Earth. Natural vegetation and wildlife are found in the contact zone of lithosphere, hydrosphere, and atmosphere, called the biosphere. There are about 1.75 million different species of plants and animals on Earth. All living and non-living organisms are inter-related and inter-dependent on each other in their physical environment, thus forming an ecosystem. An ecosystem is a functional unit of nature, where living organisms interact among themselves and also with their surrounding physical environment. Ecosystems vary considerably in size – from a small pond to a large sea or forest. The terms flora and fauna refer to the species of plant and animal life of a particular region or period, respectively. A region with naturally occurring flora and fauna that are adapted to their natural environment forms a biome. A biome can be made up of many ecosystems. The term biome is derived from two words ‘bio’ and ‘home’. Major biomes of the world include forests, grasslands, deserts, and tundra. Natural Vegetation Natural vegetation refers to the plant cover that has grown under natural conditions and has not been disturbed by humans over a long time. Natural vegetation comprises trees, shrubs, and grasses that grow on their own without any human interference. Forest Grassland Shrubs The distribution of natural vegetation largely depends upon two main factors, namely the relief and climate of a ©PERIWINKLE® particular region. 28 LET’S DISCOVER GEOGRAPHY 18

The distribution of natural vegetation largely depends upon two main factors, namely the relief and climate of a particular regLioens.son at a Glance Relief includes landforms and soils. The nature of the landform influences the type of vegetation in a particular reg³ion.HMuomunatnabinesi,npglsaatereauths,eaunldtimplaatinesressuopuprocrettdhiafftecraenntmtyapkeesaonfavteiognetsattrioonng. and developed. So³il supTphoertwsoarllldthpeofpourleasttios,ngrisaspsrlaensednst,layngdrocwroipnsg fartoma vwehryichhiaglhl lrivaitnegabnedintghseoennEtiarerthwdoerlrdivpeotphueilratfiooondi.sTnhoetre are a nuemvebnelyr odfisstoriibl tuytpeeds. which provide a base for a variety of vegetation. For example, cacti and thorny bushes gro³w inTdheesnerutmsobiel,rwofhpereeoapslecolinvinfegropuesr utrneietsoaf raenparreedaoims cinaallnetdinthme oduenstaitiynosfopil.opulation. Cli³matiTchfeaccutorrresnltikpeopteumlaptieornatoufrteh, esuwnolirgldhti,samnodreprtehcainpi7ta.6tiobnillionnflu. ence the distribution of natural vegetation. Th³ese cTlihmeareticarfeactthorreseinmflauiennccaeutshees toyfppeoopfuvlaetgioetnagtiroonwitnha: bpiartrhticrautlea,r daereaath. Trahteev, arniadtmioingrianttioenm.perature changes adthnue³dravtaeimogcMneootiuoaugnftrniatsotturnoiioneffnlsrir.goaihsmintthfhtaehallvemeatolrfsvaooespmtiienceraflnlugtrreeoongwfcioepthnetohotpoefltetgrheraoeecwsrsouatshnbsdtorreofrgepnigioaciontaunsl rsraaentlghdviaoettnegrsreertticatoeotiirtvoiheenesh.tpeoItoacvlaaayrgnrrrabeeiagentifwoaenlilxtshht.eiaTnnvhtea.ecdRdoeeuungrnsiaoettrnriyosvnoewrgobeifttehsatutwlionoenlnieggnahesrt com³parPeodptuolarteigoinonpsyrwaimthidleosrsargaein-fsaelxl. pyramid shows the gender and age structure of a population. Learn More: About Biome http://www.nationalgeAogrSaSphIiGc.oNrgM/enEcyNcloTpSedia/biome 1W. orFldill Dinitshteribbluantikosn. of Natural Vegetation The vaa.riatAiorenassinwirtehliefefratinledscoliimls aatnicd cpolenadsiatinotncslihmaavteeraerseulted in various typpeospouflantaetdu.ral vegetation in different partsbo. f thBeirwthorraldte. is the number of live births per people in year. c. Areas with climate are not suitable for human habitation. Tropdic.al Evergreen Forestsis the most populous country of the world. Tropeic.al evergreen forestscoacncbuer iwnittrhoipniacacloruegnitornysotrhbaettrweceeeinvecohueanvtryieras.infall and experience high temperatures tthrereosuf,.gshhoruPutobtpsh,uealyanetdiaor.cnrApeseyapraermerssiudgltiiv,sitnahlgessoietkfanoomrewsutnlstiahlasayveereadlusxturruiacntutrvee.gTertpeaeytisroanamr–eid. 2ta.ll aSntdatberowahde-tlehaevretdr,uaenodrhfavlseev. igorous growth. There is no definite timeaf.or tTrheeesmtaojosrhiteydofthpelaircelesawveitsh, hhiegnhcpeotphuelsaetiofonrdesisttsriabpuptieoanragrreefeonund in the Southern Hemisphere. tashorermomeubcag..imhinolpyuPTotfhoroetptuhaupnneleadtyottieiprnoaelntere.hsgwRerfohoAosowumentmwahdzootoivoannekdteB,orseoaubspptiolinoacnfacinyela,eSdcavoouneuuedrtngthmrtoerAayedhmneaocrefgeroreaicrcaneaasysl,iltnetashgdr.eeTdimCheeoxaematsnhmieggorrfpaaoBltnereaetssssao.itlnssfo. in Afdri.ca,InatnedrnMatailoanyasilamaignrdatIinodnorneefesiras tino msoouvtehm-eeanstt oAfspiae.opThleeotvreorpsictaatle boundaries. everger.eenTfhoerewsotsrkairnegkpnoopwunlaatiso’nseislvians’thineSaoguetghroAumpeorifc3a5. –69 years. Selvas ©PERIWINKLE® GETVaTluOe KBaNseOdWQuestion The ATmhaezpoonpruailnatfioornesptyirnamSoidutchlaAssmifieersicoaucrogvraenrsd2p.a1rmeniltlsioansseqlduearrley mdeilpeesnodfalnantsd..HItoawcecvoeurn, itns rfeoarlmityoirteisthnaont shoa.lf of theEexnptliarienwhoowrldo’surraeilndfeorrsepsltasy. Iatnisimalpsoortraenfetrrroelde itnooausrtfhaem‘iLliuensgasndofcothmempulanniteite’sb. ecause it produces more than 20 per cent of the world’s oxygen. 30LET’S DISLCETO’VSEDRISGCEOOVGERRAGPEHOYGRAPHY 101 19

BOOK layout 2UNIT Fiction HUMAN VIRTUES Salt on a Magpie’s Tail a Swedish folk tale Think About Don’t wish it were easier, Wish you were better. Do you have a wish list? Write down any three wishes here: What can you do to make these wishes come true? If you had to advise a friend on how to turn wishes into reality, what would your advice be? ©PERIWINKLE® 36 Let's Discover English 20

©PERIWINKLE® Ayoung lad named Olle spent his time daydreaming about things he fancied: toys, a clasping knife, a wagon, a pony, a house with a garden, etc. His widowed mother, who sold brooms after his father’s death, could hardly make ends meet, let alone get him the things that he fancied. Their situation was miserable: they lived in a dilapidated house — as cold and uncomfortable as a broken down house could be — and they barely managed a square meal on some days. The young lad was of no help to his mother as he spent most of his time daydreaming. One morning, sitting on a garden bench, Olle was as usual muttering1 to himself: “If I had a sharp knife, I’d carve out toys to play...”; “If I had a wagon, I’d carry my toys everywhere...”; “If I had a pony...”. An old man sitting beside him smiled as he heard Olle talking to himself. He tapped the young lad’s shoulder and advised: “Go to the woods and sprinkle some salt on a magpie’s tail; its magical powers can make wishes come true. Wish while the salt is still on the bird’s tail, otherwise the spell may break.” Olle thanked the old man and set off immediately in search of a magpie. As per the old man’s advice, he carried with him some salt. The woods were not far away. He came across a congregation of magpies; however, not a bird let him near. On seeing him advancing, the birds would fly away in a flick. Finally, disappointed and tired, Olle decided to head for home. “Tweet-tweet!” He heard a bird call. Olle turned around to see who could be calling; imagine his excitement when he found a tiny magpie hovering close by. He watched closely the movements of the bird as it flew over and around him; it seemed to be inviting him to interact. The bird finally perched2 on a nearby bush and said: “Were you looking for me?” “You talk!” cried Olle, surprised. “Oh yes,” said the bird. “You see, I’m an enchanted princess with magical powers. I know you want to sprinkle salt on a magpie’s tail.” “You do?” said Olle, feeling hopeful. “Oh, yes! I’ll let you put salt on my tail if you run my errand3.” “I’ll fetch anything that you want!” Olle said eagerly, at the same time watching her movements more closely now; he did not want to miss an opportunity to sprinkle salt. “Get me a sparkling new knife to trim my claws and clean my beak,” said the magpie. “A princess must look well-groomed.” Whoosh! She flew over his head and into the deep woods. Salt on a Magpie’s Tail 37 21

BOOK layout 5. GYPSIES  Rachel Field A gypsy is a member of a travelling group of people traditionally living by trade and fortune telling.  What do you think is the most characteristic feature of gypsy life?  Would you like to live like a gypsy? Explain with a reason. Last night the gypsies came -  Nobody knows from where. Where they’ve gone to nobody knows, And nobody seems to care! Between the trees on the old swamp1 road I saw them round their fire: Tattered2 children and dogs that barked As the flames leaped high and higher; There were black-eyed girls in scarlet3 shawls, Old folk wrinkled4 with years, Men with handkerchiefs round their throats And silver loops in their ears. Ragged5 and red like maple leaves When frost comes in the Fall, The gypsies stayed but a single night, In the morning gone were all - Never a shaggy6 gypsy dog, Never a gypsy child; Only a burnt-out gypsy fire Where danced that band so wild. All gone and away, Who knows where? Only the wind that sweeps Maple branches bare. 1swamp - marshy land; wet, muddy area 4wrinkled - having creases on the skin (mainly due to old age) ©PERIWINKLE® 2tattered - dressed in worn-out and torn clothes 5ragged - shabby, untidy 3scarlet - a particular shade of red 6shaggy - not groomed/combed; not well-kept 22 English Course Book Grade 7 22

6. THE FOOTBALL FAN  By Kevin Halls Introduction A fan is an admirer or enthusiast, often a follower or a supporter of a particular person because of his work or even appearance. For instance, we have sports fans, movie fans, media fans, etc. Are you a fan of any such person, especially a sportsperson? Share your reasons for the same with your class. They love their football team, their loyalty is never in doubt; they rarely ever miss a match – from the stands they scream and shout. Even when the team’s playing poor, and their favourite player is off key, that will never stop them from, going as the ground is where they want to be. Football is always on their minds, they think about it night and day, non-football fans think they must be crazy watching men kicking a ball home and away. Relationships can become strained and tense as football takes the leading role, partners can become irritable and even jealous when the fan talks for hours about a wonder goal. ©PERIWINKLE® English Course Book Grade 7 33 23

BOOK layout 23 He, She, and It Look at the following sentences. Mohan is a clever boy. The girl is running. The cat is asleep. He is a clever boy. She is running. It is asleep. He stands for Mohan. She stands for the girl. It stands for the cat. He, she, and it are used in the place of nouns. He and she are used for people. It is used for things. Fill in the blanks with He, She, or It correctly. a Rohan likes milk. b The train is very fast. likes milk. is very fast. c The frog is hopping. d Aslam lives on the second floor. is hopping. lives on the second floor. e Seeta is dancing. f David is in Goa. is dancing. is in Goa. g Our father is a doctor. h Jinal is my cousin. is a doctor. is my cousin. i Leena is my friend. j The bicycle is mine. ©PERIWINKLE® is mine. is my friend. 38 Grammar – 1 24

24 Fox and the Grapes Look at the pictures below and write what the fox did, in the correct order with the help of the clues given below. a So he went away, saying, “The grapes are sour.” b He jumped and jumped but could not reach the grapes. c A fox saw a bunch of grapes. d He wanted the grapes. ©PERIWINKLE® 39 Grammar – 1 25

BOOK layout ©MRIDULA VYAS® The Snowman and The Sunshine In Switzerland December 25th On the morning of Christmas as Kira wakes up and looks out the window, she screams with joy. “Kai, wake up, wake up. You got to see this.” Kai wakes up. He jumps out of his bed and runs to the window. “WOW! Says Kai, he just cannot believe his eyes. “We have a WHITE CHRISTMAS Kai!!” says Kira The trees, the bushes, the grass in the yard, the red and green and yellow rooftops of the cottages, and the dark purple headed mountains around the village in the valley are all white. Even the tree house, the swing, the see saw, the slide and the hammock in the backyard are all buried under mounds of fresh, soft snow. So they gaze out the window when Kai says. “Doesn’t it look like the sky has dropped a great, big, white blanket on the ground?” “Yes, it sure looks that way!” Says Kira, “Or maybe when we were sleeping, someone quietly tiptoed with a huge bucket of paint and a brush in the middle of the night and painted everything white.” “Uh haa… I like that Kira,” says Kai. That morning Kira and Kai have something else on their minds. Just then their mama calls out from the kitchen. “Kira and Kai, come have your breakfast please.” 16 26

©MRIDULA VYAS® “Will you help me with my plan Kira?” “Of course, I will. We will come up with a plan that will make every child in this world happy and always not just on Christmas day.” “But Kira this world is so big…!” “Yes, Kai. But our plan will be so much bigger!!! It will bring the whole world together when every child is happy in this world. Don’t you think so?” says Kira. “WOW! It feels like a dream.” Kai’s eyes shine like the stars. “Yes dear. Let nothing stop you from living your dream,” says their mother. “Now both of you run along and go build your snowman.” “And let me know if you need any help,” says their papa. “Ok, papa we will.” Says Kira as they rush out the door. So they spend the morning having fun building a snowman. It is almost noon now. Suddenly Kai runs back to the kitchen, quietly grabs a carrot from the vegetable basket, rushes out the door and sticks it in the middle of the snowman’s face. “There you go,” says Kai. “That’s a nice looking nose.” 21 27

BOOK layout Subtraction 4.1: Subtraction concept and properties – review 1. Subtraction concept: The terms ‘take away’ and ‘find the difference’ imply subtraction. l Take away: Lucy had 14 cakes. Her friend took away 8 cakes. 14 – 8 = 6 How many cakes are left with Lucy still? Lucy has 6 cakes left. l Difference: What is the difference between 930 and 900? 930 – 900 = 30 The difference is 30. The terms ‘how many more’ and ‘how many less’ also imply subtraction. l How many less: June had 6 marbles. Tina had 9 marbles. 9–6=3 How many less marbles does June have than Tina? June has 3 marbles less. l How many more: Jenny had £10. She needed £14 for two 14 – 10 = 4 pencils. How many more pounds did Jenny need? Jenny needed £4. 2. Properties of subtraction: (i) 6 4 2 When ‘0’ is subtracted (ii) 2 0 0 When a number – 0 from a number, the – 2 0 0 is subtracted from 6 4 2 difference is the 0 0 0 itself, we get ‘0’ number itself. as the difference. 3. Study the terms and their relationships. 9 Minuend 3 Subtrahend 9 Minuend – 3 Subtrahend + 6 Difference – 6 Difference 6 Difference 9 Minuend 3 Subtrahend Write the missing numbers. a 1,240 – = 1,240 b 3,682 – = 0 c– 0 = 1,672 0 74 d – 8,745 = e69 31 f ©PERIWINKLE® – 2 –3 418 6 4 201 33 Periwinkle Mathematics 4 28

4.2: Subtraction of 4-digit numbers without regrouping Find the difference. aH T O bH T O c HT O 7 5 6 8 2 9 30 8 1 2 1 6 4 –3 –4 –1 0 Simplify. b 100 + 0 – 100 = a 100 + 0 + 100 = d 100 – 0 – 100 = c 100 – 0 + 100 = Example 3,245 – 1,122 Th H T O Subtract: 5–2=3 Th H T O 3 24 5 Ones 4–2=2 2123 Tens 2–1=1 –1 1 2 2 Hundreds 3–1=2 2 12 3 Thousands Read as: 3,245 minus 1,122 is 2,123. Find the difference. a Th H T O b Th H T O c Th H T O 38 7 6 97 5 5 64 8 5 –2 4 1 5 –6 5 3 2 –1 3 4 1 ©PERIWINKLE® d Th H T O e Th H T O f Th H T O 32 4 1 73 4 8 44 4 4 –3 1 1 0 –5 0 0 1 –3 4 1 2 Periwinkle Mathematics 4 34 29

BOOK layout Experiment No. 1 Objective: To measure the weight of a body using the principle of moments. Apparatus used: A metre ruler, thread, stand, given body and weight box. Theory: Principle of moments states that in equilibrium, the sum of anticlockwise moments is equal to the sum of clockwise moments, i.e. W1 x l1 = W2 x l2. Procedure: (1) Suspend the metre ruler at its centre of gravity (50 cm) from the arm of the stand with the help of a thread. The metre ruler will come to rest in the horizontal position. thread metre ruler stand weight thread 50 g solid (2) Take a 50 g weight and suspend it on the left side of the scale at the 30 cm mark. ©PERIWINKLE® (3) Tie the given solid with the thread and suspend it on the right side of the scale. The metre scale will not be in equilibrium. (4) Now slowly shift the position of the given body till the metre scale attains equilibrium. Note the position of the body on the scale. (5) Repeat the experiment by changing the positions of the given body and the known weight (50 g). Calculations: Let the weight of the given body be W g. Then, the clockwise moment = W1 x l1 = W x (80 – 50) = W x 30. The anticlockwise moment = W2 x l2 = 50 x (50 – 30) = 50 x 20. 12 Lab Manual-cum-Practical Record 30

Q.8. Which class of lever acts as a force multiplier? Ans. Class II, because class II levers always have their mechanical advantage, i.e. MA > 1. Q.9. Which class of lever acts as a speed multiplier? Ans. Class III, because class III levers always have their MA < 1.  Experiment No. 3 Objective: To determine the velocity ratio (VR) and mechanical advantage (MA) of a single fixed pulley. Apparatus used: A single fixed pulley, a light and inextensible thread, weight box and a pan for keeping the weights. Theory: A pulley is a metallic or wooden disc with a groove around its circumference through which the thread can pass over. The pulley is fixed to a frame through an axis so that the pulley can rotate on it. Load Mechanical advantage = Effort Distance moved by the effort Velocity ratio = Distance moved by the load Procedure: (1) Suspend the pulley from a rigid support by its hook. rigid support (2) Pass the string over the groove of the pulley and attach frame a light pan, for keeping the weights, to the string. (The weight of the pan should be already known.) (3) Hang a 20 g weight on the left end of the string and place T pulley suitable weights in the pan so that the pulley does not axle rotate. At this situation, the tension on the left side of the string will be equal to the tension on the right side of the string string. T (4) Repeat the experiment by replacing 20 g weight with 30 g, 40 g, etc. (5) It is observed that the weight suspended at the left side is pan with weights equal to the total weight of the pan and weight placed in 20 g the pan. (6) Now detach the pan and hold that end of the string by your hand. Hang a 50 g weight on the other side of the string. ©PERIWINKLE® (7) Now pull the string downward so that the 50 g weight moves 50 cm upward. Note down the distance moved by your hand with the help of a metre scale. (8) Repeat the same by changing the weight. It is found that the distance moved by the load is always equal to the distance moved by the effort (hand). Physics - X 15 31

BOOK layout Let’s Read, Talk and Match Work with your friend: • The following people in their conversation are using some idioms and phrases related to the world of photography. • Match the expressions given in bold type used by the speakers with their meanings given below. One has been done for you. This picture is a perfect Most of the profile pictures After reading the news example of silhouette of people on the face book in the newspaper I had a photography. are photoshopped. clear picture of what had happened yesterday in school. 1 2 3 My friend lives in a picturesque I wanted to change my I am a big fan of the Film village situated on the foothills school but when my Director Sanjay Leela of Aravali. teacher explained me the Bhansali for his picturization big picture, I understood in his movies. that changing school was not a good idea. 45 6 (a) A detailed and overall view a situation or an issue (b) To understand a situation well (c) A dark shape of an object or a person seen against a light surface (d) Representation in a picture or in a motion picture (e) To make changes in a photograph digitally using software such as Photoshop 2 (f) A place which is attractive in appearance in a traditional/old fashioned way What’s my score? ©PERIWINKLE® 123456 8 Speaking Skills 32

4.6 The Gift of the Magi – O Henry Language Study Q.1. (A) A1 Do as directed. (1) Choose the correct synonyms of the word underlined below. It is obvious that he wants to do some good works. (a) doubtful (b) clear (c) expected (d) surprised Ans. (2) Choose the correct antonyms of the word underlined below. One should lift oneself by one’s own efforts and should not degrade oneself. (a) accuse (b) lower (c) elevate (d) deliver Ans. (3) Give the correct expansion of the abbreviation – WHO. Ans. (4) Choose the correct combination for the compound word ‘blueprint’. (a) Noun + Adverb (b) Adjective + Noun (c) Adverb + Verb (d) Adverb + Noun Ans. (5) Choose the suitable meaning for the idiom found in the following sentence. Orders for the new product are coming in through thick and thin. (a) small numbers (b) limited quantity (c) appropriate level (d) large numbers Ans. (6) Complete the table. ©PERIWINKLE® Noun Adjective Verb reflection silent prepare expression English Practice Book – Grade X (33) 33

BOOK covers ©AUTHOR 34

©AUTHOR 35

BOOK covers ©AUTHOR 36

©AUTHOR 37

BOOK covers ©AUTHOR 38

©AUTHOR 39

BOOK covers ©AUTHOR 40

©AUTHOR 41

BOOK covers ©AUTHOR 42

N Redundancy A Golden Opportunity ©AUTHOR A CY R EDU An A to Z Guide N By Paul Williams D 43

Volume 1 Steven Shears BOOK covers The Universal Guide ©AUTHOR to Peace and Prosperity Volume 1 Steven Shears 44

©AUTHOR 45

BOOK covers ©AUTHOR 46

©AUTHOR 47

illustrations ©STUDIO24 48


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook