Design Engine Architects Universities Projects Portfolio

DESIGN ENGINE ARCHITECTSUNIVERSITIES2001 – 2018



FUTURE PROJECTS Our vision is to create beautiful architecture where the site and building merge sothat you can no longer imagine one without the other. — Design Engine Architects Philosophy 1

DESIGNDESIGNENGINEARCHITECTS\CONTENTSTHROUINNOV 2

0 CONTENTS ABOUT 1 2 UNIVERSITIESN4–19 UNIVERSITIES 104–119 18–103 INTRODUCTION COMPLETE PROJECTS FUTURE PROJECTS 04 our values 18 arts university bournemouth 104 arts university bournemouth 104 student accommodation 06 our expertisee 18 design workshops & studios 08 sustainability 24 photography building 110 university of winchester 10 transforming campuses 30 student services building 110 west downs campus 12 university clients 14 our approach 36 oxford brookes university 116 london metropolitan 36 john henry brookes building 116 new learning & teaching buildingUGH16awards 44 abercrombie building 50 john payne building 56 university of winchester 56 winton chapel 62 st alphege building 68 performing arts building 74 university centre 80 john stripe lecture theatre 86 university of oxford 86 st peters college, perrodo building 90 examination schools 92 london school of economics 92 old building receptionV 98 university of southampton interiors 98 jubilee sports centre reception 100 vice chancellors reception 102 susu cafe 3

OUR VALUESEst.DESIGNENGINEARCHITECTS\ABOUTOur vision is to create beautiful architecturewhere the site and building merge so that you canno longer imagine one without the other. a short overview Richard Rose-Casemore, Richard Jobson and Rodney Graham formed Design Engine Architects as a Private Limited Company in December 2001. Since 2001, our dedicated team of staff in our Winchester-based studio have been sculpting award-winning, dynamic architecture in the education, business, public and private sectors, with projects in local, national and international arenas. Our signature lies not in formulae or style, but in unique high-quality design and technical resolution, where intensive research leads to responsible innovation. We are challenging in our approach, believing that the potential for quality lies behind every unpromising beginning. So we do not always need big budgets to achieve big results, and we often exceed our clients’ expectations by achieving striking architecture from modest budgets. The professional delivery of our projects is important to us; so we2000monitorthequalityandserviceofconstructionuptoandbeyondoccupation. 4

INTRODUCTIONRodney Graham Richard Rose-Casemore Richard JobsonFounding Director Founding Director Founding Director0DavidGausden John Ridgett Tim O-Rourke Director Appointed 2016 Director Appointed 2016 Director (London) Appointed 2018 director led design We believe in a design approach we call ‘Design by Dialogue’. This can involve one-to- one briefing or wider presentations but involves close consultation with all stakeholders of a project along the way so that they feel part of the process and a sense of ownership. This is a key part of our service and is never a time-limited exercise. The client briefing process in particular, is a key part of the relationship-building process and when properly undertaking always leads to a truly successful project. Our projects are always director-led from inception to completion. 5

DESIGN ENGINE ARCHITECTS \ ABOUT OUR EXPERTISE We have found that by not restricting ourselves to one discipline we have enjoyed a considerable range of exciting projects within our practice. Ultimately this has led us towards new specialisms. Within our practice, we find that each and every project has its own journey to make where there is rarely a one–size–fits–all solution to be found. After all, ‘architecture’ is a collaborative act and design without dialogue can be an empty and unfulfilling vocation. The eclectic nature of our work at Design Engine does suggest that our skills are not restricted to one particular field. Whether designing furniture, bridges, interiors, housing, theatres, schools or universities, the tools that we use to solve problems and make things are the same. It is in an architect’s nature to want to design everything with the same enthusiasm and vigour, and we are no exception. Interior Design Interior design is often considered to be a specialism, and not necessarily part of an architect’s armoury. But, like most architects, we like to blur the boundaries between interior and exterior and find it difficult to consider the external expression of a building if it is divorced from its interior. When designing interiors within existing buildings, we take time to understand and decode the spaces that we inherit. The general overview or masterplan resulting from this process often creates new specialist opportunities in the form of graphic design, signage wayfinding, furniture/product design, lighting design, mobile buildings and sometimes even a new building.IMAGINATIVE,PROFESSIONAL & 66

INTRODUCTIONarchitecture bridges campus designWith our understanding of materials, and Our bridge designs in particular display Our University and School projectsexperience with the reality of making a very pure fusion of structure and demonstrate how flexible accommodation,buildings, we create robust architecture architecture, with strong sculpture and easy wayfinding, environmental controlthat matures with dignity. geometrical qualities. and quality external space all benefit the teaching, learning and social development experience.landscape interior design masterplanningWherever possible our designs integrate We often design the interiors of our own The masterplan is a living document whicharchitecture with landscape in order to new buildings, but also enjoy breathing describes a framework for development.capitalise on the symbiotic relationships new life into existing spaces and places.between the flora, fauna, people andbuilding. graphics conservation Our buildings should speak for themselves We enjoy breathing life and dignity back in terms of navigation and use, but clear to forgotten or mis-used buildings and wayfinding can also help orientation. spaces. 7

DESIGN ENGINE ARCHITECTS \ ABOUT SUS TA IN A BILIT Y We take seriously the impact our buildings have on the environment and as a standard always aim for BREEAM Excellent. In the work we complete for our clients we recognise our responsibility to the environment so we always design from first principles. This way we ensure best practices from the outset rather than applying secondary green ‘bolt-ons’ to help improve the performance of our buildings. We adopt passive systems rather than high- tech solutions, which involves making the building work hard in its own right. The practice also recognises its responsibility to promote the sustainable use of the world’s valuable natural resources and it understands the impacts that it could have upon the environment during the course of carrying out its work. We are committed to achieving excellent environmental performance at all times, regardless of the size or type of work that is being undertaken. All our recent University buildings have achieved their energy targets in design, operation and use. Alongside the professional advice that we give to our clients we also adopt these procedures into our everyday business activities. The practice is therefore ISO 9001 and 14001 accredited.8

INTRODUCTION john henry brookes st. alphege BREEAM Excellent & EPC B BREEAM Excellent & EPC A• Exposed thermal mass acts as a heat sink • Natural ventilation & air quality• Night-time purging • Heating and cooling• Cross ventilation • Individually controlled rooms• Natural ventilation by solar chimneys • Daylight harvesting• Façades minimise solar gain & maximise daylight • Low water usage and leak detection british embassy, sana’a gifford headquarters LEAF Award 2008 Low Energy Building of the Year• Brise soleil minimises solar-gain • Minimal energy loss through the building fabric• Exploits the cool night air • Highly insulated robust breathing wall system• Concrete structure provides thermal mass • Optimised glazing ensures good natural light• A labyrinth pre-cools air • Exposed thermal mass• Rainwater & solar collecting roof • Air intake duct & Swirl diffusers photography building student services BREEAM Excellent Passivhaus (design)• Glazed fins reflect, diffuse & moderate natural daylight • Innovative insulated concrete formwork• Roof lights, windows and ventilation louvres • Triple-glazed facades• Controlled natural light • Bespoke mechanical & environmental systems• Low-energy environmental control • Air-tight building envelope • Minimal energy consumption and running costs 9

DESIGN ENGINE ARCHITECTS \ ABOUT1234 10

INTRODUCTION TRANSFORMING CAMPUSES Our buildings demonstrate how flexible accommodation, easy way-finding, environmental control and quality external space all benefit the teaching, learning and social development experience.1 ← Arts University Bournemouth, Higher EducationPhotography Building before (left) and after We work across all sectors and scales but have developed a specialistpicture (right ©Jim Stephenson) team for the design and delivery of exceptional academic facilities.2 ← Arts University Bournemouth, As a practice we are fascinated by the exploration of new teaching andStudent Services Building before (left) and learning environments. We have lectured at education conferences on theseafter picture (right ©Nick Kane & ©Jim ideas as well as researching emerging trends in the UK and abroad.Stephenson) Ultimately all of our work, designed closely with our higher education clients,3 ← University of Winchester, University is focused on improving the student experience. This involves creatingCentre Building before (left) and after picture exciting, vibrant, uplifting buildings, which remain serious in their respect(right ©Kieth Collie) for academic teaching and learning, whilst at the same time being cognisant of the need to be sustainable, affordable, robust and maintainable.4 ← University of Winchester, St. AlphegeBuilding before (left) and after picture (right We have delivered a wide range of projects for higher education clients©Kieth Collie) including University of Oxford, London School of Economics and University of Southampton and are currently working on campus developments for London Metropolitan University and University of Winchester. This booklet includes work from the many institutions we have worked with including: University of Winchester, Oxford Brookes University and Arts University Bournemouth. These projects are a mixture of new build and refurbishment, and are illustrative of the range and flexibility of spaces required in a modern higher education learning environment, all enlivened through the use of colour and materiality. 11

DESIGN ENGINE ARCHITECTS \ ABOUT123 12

INTRODUCTION UNIVERSITY CLIENTS We are proud to have received repeat commissions from many of our Clients, which we consider a testament to exceeding their expectations.1 ← Oxford Brookes Building Aerial shotsbefore (left) and after (right)2 ← Hubert Perrodo Building before (left)and after picture (right)3 ← Arts University Bournemouth,Workshops & Studios before (left) and after(right ©Jim Stephenson) 13

DESIGN ENGINE ARCHITECTS \ ABOUT APPROACH Our buildings must provide a continual source of enjoyment whilst achieving functionality at all levels. So throughout the design and construction process we always have the eventual users in mind, as well as the building’s impact on the public realm.14

INTRODUCTION01 02 03Understand Respond ExploreWe establish clear communication with the Complex issues can be simplified with A chance to challenge conventionsclient and stimulate discussion. We listen metaphor and the underlying logic of the and explore the unexpected throughto the client’s aspirations and develop the site and brief is pursued and understood. rigorous thought process and analysis.brief with them. The aim is to understand Radical proposals are used to stimulate Inspiration is sought from outside the realmthe essence of the site and brief and debate and focus minds. of architecture to reach beyond simpleidentify the unique characteristics and functionality.needs.04 05 06Refine Deliver FeedbackWe never rush to early conclusions so Our experience has taught us that clear Our quality assurance ensures the deliveryto allow for serendipitous discovery. We communication and co-ordination with retains the ambitions of its conception butconstantly check that priorities are aligning contractors and specialists allows for we like to reflect on our projects as therewith our sustainability standards as well as an efficient and enjoyable construction are always lessons to be learnt.analysing any cultural concerns of the site experience.and brief. 15

DESIGN ENGINE ARCHITECTS \ ABOUT Design Workshops & Studios, Arts University Bournemouth RICS: Design Through Innovation Award, RIBA Regional AwardAWARDS2001–2018 Winton Chapel, University of Winchester RIBA Regional Award, Civic Voice Design Award Overall & Historic Buildings Winner Student Services, Arts University Bournemouth SPACES Highly Commended Award: Innovation Category Civic Building of the Year, SPACES Client of the Year Award Winner56 overall awards Christchurch Bridge, Reading Civic Trust Award CommendationWe see awards as recognitionof our commitment to Student Services,creating outstanding projects. Arts University Bournemouth RIBA Regional Award Bradbury Place, Andover Housing Design Awards Richard Feilden Award6Universities Design Engine Architects3Bridges RIBA South Practice of the Year Award7Schools3Commercial Clocktower Court, Radley College RIBA Regional Award, Civic Trust Award, Oxford Preservation Trust Award Les Beaucamps High School, Guernsey Civic Trust Award, Guernsey Design Award John Henry Brookes Building, Oxford Brookes University RIBA National Award & Stirling Prize Midlist, RIBA Regional Sustainability Award, RIBA Regional Building of the Year Award, RIBA Regional Award, AJ Retrofit Higher Education Award, Education Estates Student Experience Award, Oxford Preservation Trust Award St Alphege Building, University of Winchester Civic Trust Award, Solent Urban Design Award Jesselton Quay, Malaysia MIPIM Future Project Awards, Highly Commended, Mixed Use St Alphege Building, University of Winchester RIBA Regional Award, City of Winchester Trust Joint overall Winner, City of Winchester Trust Sustainability Award Winner Les Beaucamps High School, Guernsey RIBA Regional Award, RIBA Regional Client of the Year Award Public Performing Arts Building, University of Winchester Civic Trust Award9Residential University Centre, University of Winchester Best Bar None Award Practice Redhayes Bridge, Exeter16 British Construction Industry Award, IStructE Structural Award

INTRODUCTIONHatherley Studio, WinchesterRIBA Award, RIBA Stephen Lawrence Prize,City of Winchester Trust AwardEgbert Road, WinchesterRIBA South East & South Downland Prize IbstockPrivate House, WinchesterRIBA South East & South Downland Prize IbstockComfort Station, Leighton BuzzardBritish Toilet Association, Five Star AwardGifford HQ, SouthamptonBuilding Services Award Best Office Project,IStructE David Alsop AwardHill Close Gardens Visitors Centre, WarwickForce Award for Low Energy BuildingsJohn Stripe Theatre, University of WinchesterCity of Winchester Trust AwardRoseville Housing, GuernseyRIBA Award, Civic Trust Special AwardBritish Embassy, YemenEmirates Glass Leaf Environmentally SustainableBuilding of the Year, RIBA International Award,Quality in Construction Awards InternationalProject Highly CommendedRoseville Housing, GuernseyRTPI Award South West CommendationUniversity Centre, University of WinchesterRIBA AwardBuro Happold Offices, BathDesign Quality Award Listed BuildingHill Close Gardens Visitors Centre, WarwickLandscape Institute Award, Heritage & ConservationHighly CommendedUniversity Centre, University of WinchesterCity of Winchester Trust New Building Design Award 17

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES DESIGN WORKSHOPS & STUDIOS arts university bournemouth A transformation of the two former on-campus halls of residence into modern studio and teaching spaces.our role: Architecture | Interiors The AUB Design Workshops & Studios Conversions consistclient: Arts University Bournemouth of the transformation of two former on-campus halls ofproject manager & qs : Selway Joyce residence, originally constructed in 2001, into modernstructural engineer: AKS Ward studio and teaching space for Arts University Bournemouth’sservices engineer: AVUS Consulting internationally renowned higher education courses.main contractor: Morgan Sindall The success of the institution, and the wider changinglighting consultant: Michael Grubb demands of higher education, instigated a reappraisal offire consultant: LFA the Halls’ use as part of Design Engine’s 2009 vision for theacoustic consultant: ARUP future masterplan for the University.landscape consultant: HED The outline brief was to facilitate the wider transformationfurniture consultant: Izit & Broadstock of the campus with the re-use of buildings whose originalcdmc: Scott White & Hookins | Morgan Sindall function had become redundant, but whose structure andbuilding control: MLM envelope remained largely sound. Collaboratively, the designplanning consultant: Turleys team undertook a programme analysis that demonstrated how through the retention of the existing buildings the2016 University could both achieve delivery of new teaching space each year, and at significant saving against that of a newcompletion building. The university’s Model-Making, Performance Make-Up6.4M and preparation for Higher Education departments were identified as having commonality in their specialised andcontract value technical requirements, and by sharing facilities could reduce unnecessary duplication. Design Engine led a series3000M² of stakeholder design forums, helping formulate a brief for their needs within the constraints of working with an existingarea building.18

COMPLETE PROJECTS↑ The new facade and telemagentapink roof lights. © Jim Stephenson 19

Heavyweight, highly-serviced mechanised modelling ↑Students working withinand prosthetic workshops are concentrated on the the Design Workshops &ground floor. This enables a structural strategy for a Studios. © Jim Stephensonnew steel frame to be inserted with the outer masonryskin, thus allowing the removal of cellular loadbearingpartitions to create large open plan studios, whichin turn facilitate the proposed natural ventilationstrategies.A series of ground floor extensions for 3D printingspill out onto re-landscaped courtyards. Theseextensions act as shop windows advertising theoutput for the courses; fulfilling a desire to showcasework and continue the cross-fertilisation of ideasacross the wider campus.The buildings are capped by a series of saw-toothnorth-facing roof lights atop a raised roof podiumproviding even natural daylighting to new drawingstudios for for model-making, illustration and fashiondesign students. Clad in telemagenta pink, theypoint to a concept of feature surfaces and planes thathighlight new interventions into the existing fabric.The transformation of the building is completedwith a perforated aluminium veil over the existingbuilding at first and second floor. A pattern of twosized circular apertures is formed into a randomisedarrangment that extends across the upper façades.Working within the grids of both the former windowarrangements and new steel structure, the 50%overall free area patterns allows continued ventingwhilst regulating excessive solar gain.Delivered on programme, the project has been a hugesuccess for the University, allowing it to build on thesuccess of its oversubscribed creative courses andfacilitating a wider strategic programme of campusrenewal.“cTrheeatbivuiitlyd.i”ng seems to be a beacon of — RIBA Jury South West Awards 2017 1→ The new facade and 1 telemagenta pink roof lights. (and top right) 2↗ © Jim Stephenson

COMPLETE PROJECTS 2↑Internal staircase with student's workon display. © Jim Stephenson 21

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES “eWquoirpkpinegd in an environment that is so well for our needs is amazing. The studios, workshop rooms and facilities being so well designed to meet our needs as artists, not only allows us to work in a professional setting but also provides us the capacity to produce the best possible work. ” — Carter Hawkins, Student, Make-up for Media and Performance22

COMPLETE PROJECTS← The new entrance facade and telemagentapink roof lights. © Jim Stephenson↗→ Students working within the DesignWorkshops & Studios. © Jim Stephenson Civic Trust Award Commendation Winner 2018 RICS Awards Design Through Innovation Award Winner 2017WINNER RIBA South WestRIBA SOUTH WEST Regional AwardAWARD2017 Winner 2017 AJ Retrofit Finalist 2016← Computer visualisation section of the newfacade to the Design Workshops & Studios. 23

DESIGN ENGINE ARCHITECTS \ UNIVERSITIESPHOTO GR APHY the atrium and circulation spacesBUILDING providing low-energy environmental control.arts university bournemouth, poole The DesignA square site between wings of an existing A new staircase is a feature of the1980's building, conceptually informed by design, a sculptural element made ofphotographic processes. folded steel, it serves for both primary circulation and emergency egress. Internalour role: Architecture | Interiors The New Photography Extension voids connecting between floors at keyclient: Arts University Bournemouth building infills a square site between wings circulation points aid the orientationcost consultant : Capita of an existing 1980’s building, where the of building users, also allowing naturalstructural engineer: AKS Ward existing technical darkroom and studio light and air movement as part of theservices engineer: AVUS Consulting areas are located. The new four-storey environmental design, and providemain contractor: Morgan Sindall building provides associated support excellent spaces for the display andplanning consultant: Turleys spaces such as break-out, communal, exhibition of artwork.steel fabricator: Hollandia social learning and general teachinglandscape consultant: HED spaces, lecture theatre and I.T. suites, as Internal timber cladding and ceilingbuilding control: MLM well as connecting to the existing building baffles provide acoustic control, which is circulation routes at each floor level. important for the flexiblity of uses within the spaces, an aspect that has informed the furniture selection, which was also specified by Design Engine, to achieve a balance of aesthetic rigour, introducing colour, and enabling a variety of types of group and individual study spaces. The Arts University Bournemouth is nationally and internationally recognised as a leading university offering high quality specialist education in art, design, media and performance. This project is an initial phase of a master plan by Design Engine for the expansion and development of the Arts University campus at Wallisdown, Poole.2015 Conceptually, the design has been informed by photographic processes, thecompletion principle west-facing facade features an array of digitally printed glazed fins that3.4M act as an environmental filter to reflect, diffuse and moderate natural daylight intocontract value the building interior, utilising modern printing and imaging technology whilst referencing the early forms and glass plate negatives of early photographic procedures.1000M² The building’s exterior refers to early → West-facing facade featuring cameras, taking the form of a black digitally printed glazed fin informed byarea box with apertures forming roof lights, photographic processes. windows and ventilation louvres allowing ©Jim Stephenson controlled natural light and air through24

COMPLETE PROJECTS 25

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES ↑Entrance approach to the Photography Building. ©Jim Stephenson26

COMPLETE PROJECTS12 1↑ West-facing facade featuring digitally printed glazed fin informed by photographic processes. ©Jim Stephenson 2↑ View into the building stairwell. ©Jim Stephenson 27

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES12 1↗Interal view of entrance to 3← Staff Common Room. the Photography Building. ©Nick Kane ©Nick Kane 2↗Lecture Theatre.3 ©Nick Kane 28

COMPLETE PROJECTS↑ Students working in communal sociallearning area. ©Nick Kane 29

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES STUDENT SERVICES BUILDING arts university bournemouth Defining a new approach to the campus with a suite of new facilities for the Universities’ Student Services.WINNER RIBA South WestRIBA SOUTH WEST Regional AwardAWARD2016 Winner 2016our role: Architecture | Interiors A suite of new buildings providing insulated and air-tight building envelopeclient: Arts University Bournemouth improved and expanded facilities for the that minimises the building’s energyproject manager & qs : Capita University’s Student Services, Student consumption and running costs in use.structural engineer: AKS Ward Union, and Facilities Management Internal structure and finishes haveservices engineer: AVUS Consulting departments. Two-storey brick-clad been optimised for acoustic control, andmain contractor: Morgan Sindall new buildings, together with re-clad care has been taken to select furniturelandscape consultant: HED and refurbished existing spaces, provide and specify colours and fabric finishescdmc: Capita improved reception areas, new staff offices that create a suitable sense of comfortbuilding control: MLM and meeting spaces, including dedicated and coherence to the building interiorsplanning consultant: Turleys consultation and counselling rooms, and that supports the atmosphere ofpassivhaus advisor: Warm a GP surgery space, connected by a new communication and counselling which foyer, stair and lift. was at the heart of the client’s brief for the2015 A sculptural steel external canopy project. extends over the road to link visually The Arts University Bournemouth iscompletion the new spaces, as well as identifying nationally and internationally recognised the building entrance and adding impact as a leading university offering high quality2.3M in defining a new approach to the AUB specialist education in art, design, media campus. The brickwork cladding and and performance. This project is an initialcontract value aluminium facades have been detailed phase of a master plan by Design Engine to appear both contemporary and also for the expansion and development of the736M² integrate with existing buildings on the Arts University campus at Wallisdown, site. The construction system uses an Poole.area innovative form of insulated concrete formwork, which together with triple- → Sculptural steel external canopy30 glazed facades, and bespoke mechanical identifying the building entrance. and environmental systems, are designed ©Jim Stephenson to target ‘Passivhaus’ environmental performance standards, producing a highly

COMPLETE PROJECTS“sIpt'escviearliystiminpsotirttuatniotnwliitkhebouuirldoiwngnstihnaat it goes beyond the cliched phrase… fitness for purpose. What we need are spaces that accommodate the types of work that are undertaken but also signify care over design and are themselves inspirational. ” — Stuart Bartholomew, Principal & Vice-Chancellor, Arts University Bournemouth 31

↑New reception, foyerarea. ©Nick Kane→ Internal corridor©Nick Kane

COMPLETE PROJECTS↑ Building entrance with sculpturalsteel canopy. ©Nick Kane 33

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES ↑Exterior brickwork facade of the Student Services Building. ©Nick Kane34

COMPLETE PROJECTS123 3↑ Consultation councelling room. ©Nick Kane 1↑ Entrance with brickwork facade and canopy. ©Jim Stephenson 2↑ Central circulation staircase. ©Nick Kane 35

36DESIGN ENGINE ARCHITECTS \ UNIVERSITIESJOHN HENRYBROOKES BUILDINGoxford brookes universityA central heart to the University consisting ofinterconnected internal and external spaces,embracing new ways of learning.our role: Architecture | Interiors The Concept which reach out to interconnect with theclient: Oxford Brookes University At the core of the concept is the ambition existing campus.project manager & qs : Turner & Townsend to bring cohesion to a disparate campus; These pegs, whilst fulfilling the need forstructural engineer: Ramboll integrating existing buildings with new new and better university space, cruciallyservices engineer: Grontmij central student facilities. These links provide the enclosure to a series ofmain contractor: Laing O’Rourke provide fluid movement across the new new but different external spaces. Thelighting consultant: Speirs & Major campus for the first time, where academic Colonnade peg running towards Londonfire consultant: Grontmij spaces co-exist with social areas for the Road will form the Eastern boundary toacoustic consultant: Sandy Brown Associates enjoyment of students and staff alike. the new Piazza. The Abercrombie peglandscape consultant: Land Use creates a new façade to the Southern edgefurniture consultant: Broadstock Above all, the scheme provides adaptable of a re-modelled central courtyard. Thecdmc: QMP and flexible accommodation for changing Library peg relates to the internal Forumbuilding control: HCD curricula and teaching patterns. Designed and creates a new north/south street. Andsignage consultant: Holmes Wood from first principles for low-energy finally the Pooled Teaching and Food Hall consumption in construction and in use, peg forms the edge to a future courtyard2014 the John Henry Brookes and Abercrombie behind Sinclair as well as a new western Building are designed to meet the courtyard and terrace.completion University’s vision for a ‘holistic approach to enhancing the student experience’.83M To achieve the University’s vision for ↗ Detail of the John Henry Brookescontract value a holistic approach the new building Library facade. ©Nick Kane needed to contain a critical mass of24,320M² accommodation. This includes social learning spaces, main library, lecturearea theatre, teaching rooms and catering. To give cohesion to the whole campus36 the core conceptual idea is of a central glowing box interpenetrated by pegs,

COMPLETE PROJECTS 37

12 ↑ John Henry Brookes Forum Space at 1↑ Students sitting above the lecture Oxford Brookes University. ©Tim Crocker theatre. ©Peter Tait 2↑ Lecture Theatre filled with students. ©Peter Tait ↗ Long section through the John Henry Brookes Building.

COMPLETE PROJECTS “ tThhreoubguhiloduint ganhdashaaspaecrshoienvaelidtyimwmhiecdhiaisteevimidpeanctt and popularity. Various different sizes and types of internal and external space encourage informal use in many ways. The existing building is carefully adapted and integrated into the new buildings seamlessly. ” — RIBA Jury, South Awards 201412 2↑ Courtyard area outside the John Henry Brookes Forum Space looking towards the 1↑ The John Henry Brookes Forum Space lecture theater which penetrates the glass. looking towards the lecture theatre with its ©Tim Crocker vertical timber fins. ©Tim Crocker 39

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES↑ Pooled teaching facade with glazedfins. ©Nick Kane40

COMPLETE PROJECTS 1 2↑ The weathered steel ribbon providing 1↗ Student sitting at the entrance to the The Ribbonsolar-protection to the food hall and JHBB ©Paul Tait The ribbon has been introduced to address a numberincorporates a cellular pattern. ©Tim Crocker of issues around and within the building. Firstly 2↗ View looking towards the food hall and it acts to tie the various components (the ‘pegs’)↓ Drawing showing the ribbon's path pooled teaching block. ©Tim Crocker together, running as a continuous thread through thethrough the building. building. This helps to enhance the principle point of entry as well as reinforce the primary circulation route at level 1. On a practical level the colonnade element of the ribbon helps to give unity to the retail units behind, and provides shading to the food hall at the south end of the building. The ribbon, which runs from the Colonnade building, through the library and terminates at the food hall, is designed in weathering steel. Weathering steel does not require any protection, such as paint, but instead forms a protective layer of oxidised material which prevents further corrosion from occurring. The internal elements of the ribbon were pre- weathered offsite and then sealed once installed. The engineering aesthetic of the element is further reinforced internally with visible flush-bolted connections reminiscent of the rivets on a ship. The combination of the ribbon and the textured concrete within the Forum contrast with the finer elements of joinery and cladding. 41

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES “ THE JOHN HENRY BROOKES BUILDING reflects well on both client and architect. It is a place of learning, administration and relaxation that works at various speeds and various levels of privacy from the ultra-public to the ”ultra–concentrated. It gives the institution a focus and a sense of physical stature that it previously lacked. — Hugh Pearman, RIBA Journal42

RIBA RIBA COMPLETE PROJECTSSTIRLING NATIONALPRIZE MIDLIST AWARD RIBA2014 2014 SOUTH REGIONAL AWARD 2014AJ RETROFIT RIBA RIBAHIGHER SOUTH SOUTHEDUCATION REGIONAL REGIONAL(OVER £5M) BUILDING OF SUSTAINABILITYAWARD THE YEAR AWARD2014 2014 2014 EDUCATION OXFORD ESTATES PRESERVATION STUDENT TRUST EXPERIENCE AWARD AWARD 2014 2014 43

ABERCROMBIEBUILDINGoxford brookes universityA dramatic interior connected by glass bridgesand workshop spaces opening onto the void.our role: Architecture | Interiors The Abercrombie Building forms the firstclient: Oxford Brookes University phase of the much larger New Library andproject manager & qs : Turner & Townsend Teaching Building for Oxford Brookesstructural engineer: Ramboll University.services engineer: Grontmij The extended Abercrombie buildingmain contractor: Laing O’Rourke rehouses and consolidates the Faculty oflighting consultant: Speirs & Major Technology, Design and Environment,fire consultant: Grontmij which includes the School of Architecture.acoustic consultant: Sandy Brown Associates The extension runs to the south oflandscape consultant: Land Use Abercrombie and engages with the mainfurniture consultant: Broadstock New Library and Teaching Building,cdmc: QMP helping to knit the new with the old. Thebuilding control: HCD new extension is linked to the existingsignage consultant: Holmes Wood building by means of glass bridges and shared meeting galleries, forming a2012 dramatic interior with internal spaces opening onto the void.completion The building is an example to students of best practice in terms of sustainability,16M construction, design and facilities. The void itself, with its high glass roof formscontract value an environmental moderator, allowing light and air in as well as framing views of4800M² areas not only on the same level, but to other parts of the school and outside to aarea courtyard.

COMPLETE PROJECTSWhilst the upper floors serve thefaculty the ground floor is part of thewider University domain. The spaceincorporates a gallery space as well as caféand experimental social learning spaceThe specific brief for the AbercrombieBuilding was to bring together for thefirst time the various disciplines ofArchitecture, Planning and Constructionunder one roof. As part of the overallmasterplan it was necessary to demolishan existing 1980’s building (The LloydBuilding). This building containedthe department of planning and whilstconnected to the existing Abercrombiethe physical linkages were tenuous withconvoluted circulation and various halflevels, meaning the spaces did not flowfrom one area to another.The FacadeThe Abercrombie facades are the firstrealised element of this intensive designdevelopment. They included a complexlayering of structural and planning gridsto create a flexible building. The use ofcoloured glass in the façade along withthe glass bridges creates shafts of intensecolour.In order to maintain the integrity of the‘pegs’ as they pass from outside to insidethe internal facades have been designedto mimic the external skin. However torespond to the different environmentthe external dark grey fibre concreterainscreen has been replaced with darkgrey acoustic panels.← View across the atrium towards the newextension.©Nick Kane 45

“tOhxefuonrdivBerrsoiotykethsahtaaslbl neeenw universities want to be. Now it will have the buildings for others to emulate as well. ” — The Independant1 1← Coloured glass bridges span the atrium. ↑ Main entrance of the new Abercrombie ©Rob Boltman extension. ©Rob Boltman 2← Atrium space. ©Nick Kane2

COMPLETE PROJECTS↑ Atrium space within the new extension (left) and re-clad of existing building facade (right) ©Nick Kane 47

DESIGN ENGINE ARCHITECTS \ UNIVERSITIES “oTfhaisgirseaabt smooludteerlynecxaqthueisditrea…l othfilseaisrnthinegb.e”ginning — Shami Chakrabarti, University Chancellor, Director of Campaign Group Liberty.48