I Understand Write True or False 8) 36 AD will be shown to the right of the birth of Jesus Christ in a timeline. [ True ] 9) The new term for AD is ADE. [ False ] 10) Doctors study history to understand different diseases and cures in the past. [ True ] 11) Lifeline is used to represent events in the order in which they happened. [ False ] Short Answer Questions 12) How did human beings record their stories before they started writing? Ans. Human beings drew pictures to record their stories before they started writing. Page 48 13) How has Indian history been divided into periods? Ans. Timelines are used to divide Indian history into three periods. These are the ancient period, the medieval period and the modern period. Long Answer Question 14) How is history divided into periods based on the birth of Jesus Christ? What is PHDQWE\\%&(DQG&(\"([SODLQZLWKWKHKHOSRIDWLPHOLQH Ans. All the years before the birth of Jesus Christ are marked with the letters ‘ BC ’ (Before Christ). This is also called the ‘ Before Common Era ’ or ‘ BCE ’. The years after the birth of Christ are marked with the letters ‘ AD ’ (Anno Domini, meaning ‘the year of the Lord’). This is also called the ‘ Common Era ’ or ‘ CE ’. 2 2/27/2018 2:47:42 PM TVL_SST_G4_WB_book.indb 2
Birth of Jesus Christ BCE CE BC AD I Apply Page 49 Multiple Choice Questions 15) Who among the following people studies history to learn about different types of buildings in the past? [ B] (A) a doctor (B) an architect (C) a painter (D) an actor 16) Rashi’s grandmother is telling her stories about Shivaji Maharaj, a [ A] famous ruler of India. Which period of history is this story from? (A) medieval (B) pre-historic (C) ancient (D) modern Short Answer Questions 17) Can you write about an event from history that played an important role in our lives? Ans. :HXVHPRELOHSKRQHVWRGD\\EHFDXVH$OH[DQGHU*UDKDP%HOOLQYHQWHGWKH telephone in 1876. We have light during the night because Thomas Edison invented the electric bulb. (Accept any valid response). The Story of the Past 3 TVL_SST_G4_WB_book.indb 3 2/27/2018 2:47:43 PM
18) Arrange the following events on a timeline. (A) 25 BC (B) 1 AD (C) 2017 CE (D) 200 BCE 200 BCE 25 BC 1 AD 2017 CE (D) (A) (B) (C) Page 50 Long Answer Question 19) Rashi does not like to study history. Can you tell her how studying history can be helpful for her future if she wants to become a painter or an engineer when she grows up? Ans. Different people study history for different reasons. Engineers need to learn about the past engineering marvels. Painters need to learn about famous painters. This help them to have a good idea of what they are doing. Also, history makes one an aware citizen. 4 2/27/2018 2:47:43 PM TVL_SST_G4_WB_book.indb 4
I Explore (H.O.T.S.) Long Answer Question 0HKHUIRXQGWKHIROORZLQJWKLQJVLQKLVJUDQGIDWKHU·VROGWUXQN Ask one of your older family members to show you a few of their old belongings. Ask them to share some stories about these things. Write about them here. You can also draw pictures or paste photographs of a few of these things. Ans. the postcard that he wrote to a medal that he won in a a bright bird’s feather his father from his school trip recitation competition that he found Page 51 Learner’s response The Story of the Past 5 TVL_SST_G4_WB_book.indb 5 2/27/2018 2:47:46 PM
Page 52 Teacher Reference: Textbook Lesson 2: Sources of History 1) Name one way that you can learn about your family’s history. (TB, Pg. 7) Ans. Learner’s response Sample: We can learn about our family’s history from old photographs/ stories. 2) List three examples of sources used by a historian. (TB, Pg. 8) Ans. The sources used by a historian include literary sources, books and descriptions. 3) There is a phrase in English – ‘to create history’ – which means ‘doing something that has never been done before’. Use this phrase in a sentence. (TB, Pg. 10) Ans. Learner’s response Sample: Kalpana Chawla created history by being the first woman of Indian origin to go to space. TB: Sources of History
2Lesson Sources of History I Remember Multiple Choice Questions [ A] 1) Which of the following will help you to learn about your family history? (A) old photo albums (B) books (C) time table (D) television shows 2) Which of the following is a source of history? [ C] (A) oil sources (B) food sources (C) material sources (D) water sources Page 53 Fill in the Blanks 3) ____H_is_t_o_r_ia__n_s_____ study literary sources to record information about the past. 4) We can learn the language and the style of storytelling from ___o__ra__l ____ sources. Very Short Answer Questions *LYHDQ\\RQHH[DPSOHRIDZULWWHQUHFRUGRI\\RXUIDPLO\\KLVWRU\\ Ans. old letters (accept any valid response) 6) What do we call the place where different kinds of old objects are displayed? Ans. museum Short Answer Question 'HÀQH¶VRXUFHVRIKLVWRU\\· Ans. The objects, materials, written and oral stories, poems and songs that are used to study history are called the ‘ sources of history ’. 6 2/27/2018 2:47:47 PM TVL_SST_G4_WB_book.indb 6
I Understand Match the Following Column B Column A 8) order given by a king c a) paintings 9) oral sources d b) jewellery 10) material resources b c) farman 11) written resources a d) stories Short Answer Questions 12) What information do we get from oral sources? Ans. Languages spoken, everyday activities and festivals of the past are the various kinds of information that we get from oral sources. Page 54 :ULWHDQ\\WKUHHH[DPSOHVRIPDWHULDOVRXUFHVRIKLVWRU\\ Ans. Materials used to make buildings, tools, clothes and so on. (Accept any three valid responses.) Long Answer Question 14) What are Dolmens? How do they help us to learn about history? Ans. ‘Dolmens’ mark the burial places of people. They were built long ago. There are many dolmens in India. From these, we learn about how people in the past remembered the dead members of their communities. Sources of History 7 TVL_SST_G4_WB_book.indb 7 2/27/2018 2:47:48 PM
I Apply Multiple Choice Questions 15) Mrs Irani showed an old sari to Meher and Rashi. This sari is a part of Mrs Irani’s family history. Can you tell which type of source it belongs to? [ C ] (A) oral (B) written (C) material (D) modern 16) Rashi visited a place where a few archaeologists were working. [D] What is the place called? Page 55 (A) office (B) construction site (C) library (D) archaeological site Short Answer Questions 17) Rashi recently visited a nearby archaeological site with her school friends. Their teacher told them that we should always protect these sites. Can you suggest a few ways in which we can protect these historical resources? Ans. 7RSURWHFWKLVWRULFDOVLWHVZHFDQ L VWRSWRXFKLQJDQGZULWLQJRQWKHZDOOVRIWKH monuments, ii) always throw the garbage in the bins around the sites and iii) stop causing any form of pollution. (accept any two valid responses) 8 2/27/2018 2:47:53 PM TVL_SST_G4_WB_book.indb 8
1DPHWKHSHUVRQZKRÀQGVREMHFWVOLNHWKHVHHDUULQJV:KRZLOOXVHWKH information that this person collects? Ans. An archaeologist finds objects like these earrings. A historian will use the information collected by an archaeologist. Long Answer Question 19) What is the difference between an archaeologist and a historian? Ans. AArrcchhaaeeoollooggiisstt HHiissttoorriiaann Page 56 ͻ searches for objects belonging to ͻ visits different places to collect the past information ͻ studies different objects like tools, ͻ studies books and written weapons and jewellery information ͻ passes on the information to ͻ collects archaeological historians information to write about the past Sources of History 9 TVL_SST_G4_WB_book.indb 9 2/27/2018 2:47:54 PM
Page 57 I Explore (H.O.T.S.) Long Answer Question +LVWRULDQVDQGDUFKDHRORJLVWVVWXG\\WKLQJVWKDWDUHYHU\\ROG:KDWGLIÀFXOWLHVPLJKW they face while studying these things? Look at the pictures to write your answer. (1) (2) Hints: : KDWLVWKHFRQGLWLRQRIWKHREMHFWVLQWKHÀUVWSLFWXUH\" &DQ\\RXUHDGWKHODQJXDJHZULWWHQLQWKHVHFRQGSLFWXUH\" :KDWFDQJRZURQJZKLOHGLJJLQJREMHFWVRXWRIWKH(DUWK\" Ans. Learner’s response 10 2/27/2018 2:47:54 PM TVL_SST_G4_WB_book.indb 10
V – Appendices Usage Tip: Additional reading resources that can be read to improve your knowledge and expertise Sub‐Sections: 15. How to be a Rockstar Teacher (In Part 1B) 16. Blackboard Information Organising Tips (Graphic Organisers) Page 58
16. Blackboard Informa on Organising Tips (Graphic Organisers) There are interes ng ways to represent informa on on the black board to make learning more engaging and fun. Given below are some of them. Using these will also improve learners’ ability to process, store and recall the informa on presented, later. Mind map Word splash KWL chart Tip chart Table Venn diagram Bubble Star diagram Timeline Process chart diagram Cycle chart Tree diagram Spider Layered diagram triangle/ Pyramid Page 59
Mind map Useful to build connec ons between concepts Helps in understanding informa on and discovering new rela onships Source: h ps://in.pinterest.com/pin/107101297358882191/ Sample blackboard illustra on: Page 60
droplets form Word splash commonly Makes learning terminology easier for kids Bring out the ability to make connec ons during glaciers circulates Keywords discussed can be wri en on the comes places changes waterfrcocomofoomluhseenogadtrroftahcurilnvlsosdeelardsrscilvosfkueonydrrdssmAdAorcncHiftteifiamcearcnartseliacnyats board and learners can be asked to make connec ons see ice You can use this online tool: back vapour various h p://www.abcya.com/word_clouds.htm springs areas forms KWL chart turns cycle But goes rain snow available sources saltwater lakes region droplets ponds Builds outcome orienta on and KW L help learners/teachers to organise informa on before, during and a er a lesson/ac vity I know I want to know I have learned Air is everywhere. Why do we need air? We need air to breath. Air helps in burning. Page 61
TIP chart Term Informa on Picture Help learners to remember and understand complex terms with the help of pictures and informa on Lever A lever is a bar, rod or axle wheel Wheel and axle pla orm that can move about a fixed point. Wheel and axle make work easier by reducing fric on. A wheel helps things to move. The axle helps the wheel turn. Table Useful to note down informa on a er discussions and clearly bring out points about different things from different perspec ves Helps build modular thinking ability in kids Page 62
Venn diagram WHALES FISH Useful to remember logical rela onships between groups of things have hair have scales Can be used to indicate what is common and live in water what is different between two things or groups of things give birth to young ones have fins lay eggs can swim have lungs to breathe have gills to breathe Source: h p://www.learnnc.org/lp/pages/2646 Bubble diagram Can be used to visualise the washroom store components of a concept room along with their rela ve sizes, quan ty and bedroom kitchen connec ons between them dining room bedroom drawing car porch room entrance Page 63
Star diagram Can be used to describe the key points of a story or event using the 5Ws A document that contains a set of rules for the government and the ci zens What? The people of India Whom? Who? BR Ambedkar and a team of 300 leaders Cons tu on How long? When Three years 26 January, 1950 Page 64
Timeline Useful to recall events in chronological order with dates Timeline of evolu on of transporta on 3500 BC 2000 BC 1783 AD 1787 AD 1790 AD 1801 AD 1862 AD 1903 AD Inven on of Domes cated Inven on of Inven on of the Inven on of Inven on of the Inven on of the Inven on of the wheel and animals such as the hot air steamboat the bicycle steam automobile the modern the boat horses and balloon locomo ve aeroplane donkeys begin to carry burden Process chart The blood travels It collects more and Blood enters the Useful to represent through the body. more waste. kidneys. Kidneys filter and remember the blood which passes informa on that When passing urine, the The urinary bladder through them. follows a par cular urine from the bladder is stores this urine. When sequence thrown out through the the bladder is almost Kidneys send all the urethra. half full, we feel like waste to the bladder passing urine. through the ureters in the form of urine. Page 65
Cycle chart Useful to represent and remember informa on that follows a par cular sequence Both open ended simple process or closed cycles can be used Sample blackboard illustra ons: Page 66
Tree diagram Sources of water Helps in classifying or categorising informa on Natural sources Man-made or Ar ficial sources Rain River Pond Lake Well Borewell Tube well Spider diagram Useful to represent and remember Mango Rice complex topics Wheat Fruits Useful to build connec ons within a Grains concept or between concepts Apple Carrot Food Green gram Onion Len l Vegetables Pulses Page 67
Layered triangle/Pyramid Can be used to start with a broad topic and move to a more focussed or complex topic Can be used to start with a basic topic and move to a more evolved/complex topic Structure of State Administra on State Division District Tehsil Block Village Page 68
Search
