1-113__5_files_merged_

CS/SPD PULL THRU™ The multiple wiper design of the CS/SPD PULLSingle Use Cannulated Instrument THRU™ provides a completeCleaning Device circumferential seal in the lumen channel, therebyThe 360° seal creates a vacuum which draws detergent removing almost all residuethrough the channel removing residue from crevices or in a single pass.other areas of minor damage in the channel. The vacuumensures the channel is completely filled withdetergent to attack and remove bioburden.Disposable/single use device - removes the need for thecomplicated and expensive cleaning of traditional brushes• Effectively cleans lumen channels from 1mm-15mm with a single pass.• Reduces the time required to manually clean cannulated instruments.• Removes the residue bristle brushes leave behind, enabling detergents to attack and remove bioburden more effectively• Wipers are constructed of soft plastic, non-abrasive material and will not harm the lumen walls. The CS/SPD PULL THRU™ is available in 6 sizes, each is color coded to clearly indicate the wiper circumference. ECO-Bedside Kit Endoscopy Kits The Only ECO-FRIENDLY All-in-One Bedside Care Kit that Pre-packed Removes Synthetic Lipids Assortments or Create A • Begins cleaning on contact Custom Pack! • One time use • Stacks for easy storage Reduces time, inventory costs and Tray and Lid are Certified packaging waste! 100% Biodegradable. Endoscope ChannelTransport Bag Cleaning BrushesSafely Transport Clean Interior Scope Channels andScopes After Valves Safely and EfficientlyProcedures • Wide variety available for• Strong leak-proof all styles and sizes of liner and absorbent flexible and rigid scopes inner pad keeps bio-hazard fluids contained and protects scopes from damage during transportFor More Informationwww.ruhof.com • 1-800-537-8463 Copyright ©2015 Ruhof Corporation





FOREWORDT he healthcare sector in the GCC continues to expand exponentially and this overall growth is mirrored by the year-on-year increasing number of exhibitors, visitors and delegates we see at ArabHealth. A Frost and Sullivan forecast reports that healthcareexpenditure in GCC states will have reached US$79.2bn bythe end of 2015, with Saudi Arabia leading the way and withboth UAE and Qatar showing unprecedented growth.In tune with the ever-evolving healthcare industry, ourshows also improvise and adapt to enhance our visitors’experience. This year, the annual Arab Health productdirectory has undergone a revamp with a new design andmore pages than ever. In its handy new A5 size, it’s easy tonavigate and adds to the visitor experience by ofering awhole new array of extensive product information.Pick up your free copy of the directory available throughoutthe four days of Arab Health, the perfect product guide tonot only the show, and for the rest of 2015.I would like to wish you a warm welcome toArab Health 2015.Joseph ChackolaDirector - Publications 7 ARAB HEALTH PRODUCT DIRECTORY 2015

iLED 7: The world’s first OR lightwith built in intelligenceIn the OR, everyone knows what to do, and the new iLED 7 is no different.As a surgeon, this OR light reacts to you and adapts to changing situationsand movements. This new dimension of light management reflects TrumpfMedical’s commitment to patient safety and efficiency in the OR. Experience the new iLED 7 at Arab Health trade show, booth 4F30.

INDEX Company/produCts page numBerCategories 3B Scientic 32 3B LASER NEEDLE - The New Dimension 32Acupuncture equipmentand accessories Altera 34Anesthesiology Disposable Breathing and Infusion Systems 34 GPC MEDICAL LTD 35Arthroscopy GPC Anaesthesia ProductsBalnealtherapeutic equipment Maquet Middle East FZ-LLC FLOW-iCardiology GPC MEDICAL LTD ActiFix Unbescheiden GmbH Arm and leg baths Height-adjustable burn-care tubs Maquet Middle East FZ-LLC CARDIOHELP Medicom MTD Ltd Neuromyoanalyzer “Neuromyan” Norav BLUE ECG - Wireless Resting PC ECG NECG-12C 12 Lead NH-301 Holter Monitoring System NM700 Telemetry ECG The 1200W Wireless Exercise Testing ECG SCHILLER AG BR-102 plus PWA CARDIOVIT CS-200 Ergospiro CARDIOVIT CS-200 family 9 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories CARDIOVIT MS-Line 43 medilog ECG Holter SystemsCatheters Toray 46 INOUE-BALOON 48Cleaning EquipmentClinical chemistry Curative Medica 50 NAVAJO - peripheral balloon catheter 51Clinical Diagnostics URSA diagnostic angiographic catheterDentistry GPC MEDICAL LTD Medical Catheters Malaysian Rubber Export Promotion Council Catheters Ruhof Endozime® AW Triple Plus® with A.P.A. Endozime® Bio-Clean Prepzyme® Forever Wet Ortho Clinical Diagnostics The VITROS® 5600 Integrated System VITROS® 350 Chemistry System Pointe Scientiic Enzymatic Creatinine Reagent Set Homocysteine Reagent Set NEW*** TORCH Immunoassay Kits Associate of Cape Cod Fungitell® kit Dr. Frigz Intl Dentistry Instruments10ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerDiagnostics Equipment MIR Medical International Research 52 FlowMIR 54Disposable Products Spirobank I spirolab III Spirotel Beta Healthcare Products Pvt Ltd PRISTEEN- SURGICAL GLOVES - STERILE-POWDERED DTR Medical Ltd Crocodile Fine Jaw Micro Forceps Rotating Cervical Biopsy Punch GPC MEDICAL LTD Surgical Disposables Products Intersurgical Anaesthetic Face Masks i-gel - single use supraglottic airway Malaysian Rubber Export Promotion Council Gloves Surgical Gloves Nitrile gloves Condoms Medical Innovations Uno-Flush Medu-Scientiic Limited Feeding Bag Sharps Containers Micros Microtome blades MS24 – Universal Blade Neotec Medical Industries Pte Ltd. 3-Way Stopcock IV CANNULA WITH INJ.VALVE SAFETY IV CANNULA WITH INJ.VALVE Ningbo Greatcare Trading Co., Ltd Cleansing Enema Set 1500ml 11 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories Enteral Feeding sets Flocking material disposable urine Leg bag L40 750MLECG GREATCARE brand laryngeal Mask Airway Irrigation Set 1500MLEducation / Training Silicone Foley CatheterEEG Silicone Self-Adhering Male External CatheterElectro Medical Device Urinary Drain Bag Luxury Urine bag U8 2000ML Vomit bag Wound Drainage reservoir Ritter Disposable articles for laboratories 71 Mortara Instrument ELI™ 230 Electrocardiograph ELI™ 350 electrocardiograph WAM™ Wireless Acquisition Module Nihon Kohden Middle East FZE Electrocardiograph ECG-2550 Welch Allyn CP 50 Resting Electrocardiograph 73 3B Scientiic Human Anatomy Educational Tools Unisex Torso 74 Medicom MTD Ltd Epileptological studies – EEG Videomonitoring «Encephalan-Video» Neuromonitoring by «Encephalan-EEGR-19/26» Nihon Kohden Middle East FZE Electroencephalograph EEG-1250 76 Dr. Frigz Intl Electro Medical Devices GPC MEDICAL LTD12ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerEmergency Medicine / Electro Medical DevicesRescue Equipment Kare Medical and Analytical Devices ECOASPIR series compact suction unitsEndoscopy Medicom MTD LtdEndotoxin Testing Somnological studies «Encephalan-PSG» Ningbo Greatcare Trading Co., Ltd Microinfusion Pump Resmed S9 Series GEM SRL 80 GLUBRAN 2 GLUBRAN TISS 84 Metrax GmbH 86 DeiMonitor EVO Norav Norav Holter Blood Pressure Monitor SCHILLER AG ARGUS PRO LifeCare 2 FRED easy Online Ruhof ScopeValetTM ECO-Bedside Kit The ScopeValet™ PULL THRU™ The ScopeValet™ COLONOSCOPY & EGD KIT Associate of Cape Cod Pyrochrome Pyros EQS Pyros Kinetix Flex Pyrosate kit Pyrotell® lysate Pyrotell®-T lysate 13 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEXCategories Company/produCts page numBerENT 90First AidGas and compressed air systems KARL STORZ Endoskope - East Mediterranean & GulfHaematology / Histology / Cytology ENT Merry Electronics Merry ME300D mini stylish pocket hearing aids Personal Sound Ampliie Merry ME700 mini Personal Sound Ampliier 92 J D Honigberg International Transport Ventilators Metrax GmbH HeartSave AED HeartSave AS - Fully Automatic 94 GMP Technical Solutions Pvt. Ltd Laminar Air low Kare Medical and Analytical Devices Hikokeb OxyBreath Mini Oxygen concentrators Mini 3 and Mini 5 ULTRA CONTROLO INTERNATIONAL LDA ULTRAOX - Medical Oxygen Production Plant ULTRASEG Anesthetic Gas Scavenging Systems 96 Glaswarenfabrik Karl Hecht GMBH & Co KG 345 Electronic Memory Counter, CE Ortho Clinical Diagnostics ORTHO AutoVue® Innova ORTHO BioVue® Sysmex Middle East FZ-LLC XN-1000 XP-300 XS-500i XT-Series14ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerHospital Furniture & Fitting Altro 100 Altro Aquarius™ Altro Stronghold 30™ Altro Suprema™ Altro Whiterock Chameleon™ Altro Whiterock Digiclad™ Altro Whiterock Satins™ Alvi Srl 1338 CR Dolly trolley for boxes 1380 CR truck for linen Sack holders Shelving trolley 3500 CR Shelving Trolleys 3950 CR Alvo Medical Doors for OR Operating Table ALVO Sonata Surgical scrub sink with wall panel no 2-091 Anetic Aid Ltd QA3 Variable Height Patient Trolley QA4 Surgery Trolley System CHINESPORT spa EXERCISE STAIRCASES HERCULES SHOWER TROLLEY TEST UROGYN TILT TABLE 2BT Ferno Mondial Lift-Of Stretcher Chairs Mondial Transporter GMP Technical Solutions Pvt. Ltd Bio Safety Cabinet GPC MEDICAL LTD Hospital Furniture Hill-Rom M.E 405 Electric Hospital Bed Ainity® 4 Birthing Bed Excel Care® ES Bariatric Hospital Bed 15 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories Sabina® 200 Mobile Lift TotalCare® Bariatric Plus Hospital Bed Viking® mobile lift J D Honigberg International CHAMPION MEDICAL RECLINING CHAIRS CONTRAST MEDIA FLUID WARMERS from Enthermics IDI C-ARM IMAGING TABLES MRI medical carts PEDIGO STRETCHERS Stretchers Warming cabinets Lemi Group- Brusaferri & c. s.r.l. DREAMED GYNO PLUS HAIR-TECH LEMI MED Medical Innovations Video endoscopy equipment carts Medu-Scientiic Limited Portable Suction Pump Merivaara Oy HYGIENE patient room PHOENIX Medical Equipment S.A. Delivery Bed Dialysis / Chemotherapy Chair Patient Trolley Physical Therapy & Rehabilitation Beds Schmitz u. Soehne GmbH & Co. KG MEDIMATIC STL, STS, STX VARIMED Tecnimoem 97 Bariatric Marina Powerlift 175 Vitality Unbescheiden GmbH Shower trolleys16ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerHospital Infrastructure 134Imaging Equipment Medic Clean AirImmunochemistry MedicCleanAir - Air Puriication Unit - PRO 100 SeriesImmunochemistry (Immunology) MedicCleanAir - Isolation Unit - ISO 100 SeriesImport / Export MedicCleanAir - Isolation Unit - ISO 200 Series MedicCleanAir - Remote Control RC200 136 Biodex Medical Sound Pro™ Table Combination Table Micros MICROS BioAnalyze software packages NDS Surgical Imaging 27» Radiance® Ultra, Ultra Bright Surgical Display Dome S6c LED, Premium 6MP Diagnostic Color Display ZeroWire® Ultra, Wireless OR Imaging Solution ExpandOR™, Bi-directional HD video/audio streaming 139 Ortho Clinical Diagnostics The VITROS® 3600 Immunodiagnostic System VITROS® ECiQ Immunodiagnostic System Roche Diagnostics Elecsys 2010 Disk System 140 Access Bio CareStart Dengue Combo CareStart G6PD RDT CareStart Inluenza A&B Test 142 GNH India Pharmaceutical Distribution Malaysian Rubber Export Promotion Council Import / Export 17 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories 144Intensive and critical care Drager Medical GmbH Babylog® VN500Interventional Radiology and Pulmovista ® 500special procedures IntersurgicalIn-Vitro Diagnotics StarMed Respiratory Hood Kare Medical and Analytical Devices KMV 5010 SleepOne Bilevel ST SleepOne ProPSV SleepOne ProSV SleepOne ProVT Shenzhen Mindray Bio-Medical Electronics Co., Ltd SynoVent E5 Ventilator 149 Medtron AG Accutron HP Accutron HP-D 150 77 Elektronika DocUReader - Compact Size Urine Analyzer Express Diagnostics Int›l, Inc. AlcoCheck® FC300e Evidential Breath Alcohol fuel cell device DrugCheck® GHB Single dip drug test SalivaScan Oral Fluid Drug Test with sponge saturation indicator Fujirebio Europe (formerly Innogenetics) INNO-LiPA® HPV Genotyping Extra LUMIPULSE® G600 II TENDIGO™ Nihon Kohden Middle East FZE Hematology Analyzer MEK-7300 OK Biotech Co., Ltd OKmeter Blood Glucose Monitoring System OKmeter Direct Blood Glucose Monitoring System Shenzhen New Industries Biomedical Engineering Co., Ltd18ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerIT & PACS MAGLUMI 2000 plus MAGLUMI 4000Laboratory MAGLUMI 600 157 CompuGroup Medical Bilgi Sistemleri A.S CGM iCNG (Mobile Client) Drager Medical GmbH Remote Service Link OR Technology (by Oehm und Rehbein GmbH) dicomPACS® ORCA (OR Technology Cloud Archive) SCHILLER AG SEMA3 Trumpf Medical TruVidia Manager – To be simply connected Visus JiveX ECG JiveX Enterprise PACS JiveX Integrated Imaging JiveX Medical Archive JiveX Mobile and JiveX Web JiveX PDF Print Gateway 164 77 Elektronika LabUReader Plus - Semi-automated Urine Analyzer Access Bio CareStart G6PD Biosensor Biodex Medical Atomlab™ 500Plus Dose Calibrator Dirui FUS-2000 Urinalysis Hybrid F.L. MEDICAL S.R.L Serological pipettes Test tubes Test tubes sterile Glaswarenfabrik Karl Hecht GMBH & Co KG 19 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories 2395 Microscope Slide Drying Bench With Heating, CE 2409 Adhesion Microscope Slide, Polysine CELaparoscopy 347 Assistent Rotating Mixer, CEMicrotomes 365 Safety Blood Lancet Safe Lite IIMolecular Biology Jinhua YIDI Medical Appliance CO.,LTD Automatic Embedding Center YD-6L Full Automatic Microtome YD-355AT Semi Automatic Microtome YD-335 Microlit BEATUS-Bottle Top Dispenser BOTTLE TOP DISPENSER MICROPIPETTE MULTICHANNEL 12 CHANNEL FULLY AUTOCLAVABLE MICROPIPETTE MULTICHANNEL 8 CHANNEL FULLY AUTOCLAVABLE MICROPIPETTE SINGLE CHANNEL VARIABLE VOLUME Micros Crocus 5MP MCX100 Ginger HD MCX51 Lavender MCX100 LCD Lotus MCX51 Petunia MCX50 Vanilla 3MP MCX51 Pointe Scientiic NEW*** Pointe 180 impulse™ ISE Analyzer 178 Dr. Frigz Intl Laparoscopic Instruments KARL STORZ Endoskope - East Mediterranean & Gulf Laparoscopy 180 Micros Automatic Microtome Manual Microtome 181 Access Bio CareStart HPV Screening/Genotyping Test20ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerMonitoring CareStart RSV Bioneer CorporationMRI AccuPower® EBOV MDx Kits AccuPower® Tuberculosis MDx Kits ExiStation™ Universal Molecular Diagnostic System Nucleic Acid Extraction Device in a Pocket, MagListo™ Save Time on your Protein Synthesis projects with ExiProgen™ siRNA 186 Curative Medica Acumen 7 - ambulatory PSG Drager Medical GmbH Ininity® Acute Care System Medicom MTD Ltd Cerebral functions monitor “Encephalan-CFM” Mortara Instrument Ambulo™ 2400 Ambulatory Blood Pressure Monitor Nihon Kohden Middle East FZE CO2 Sensor Kit Life Scope TR BSM-6000 Omron Healthcare Europe B.V. M6 Comfort MIT Elite (Plus) SCHILLER AG MAGLIFE Serenity Shenzhen Mindray Bio-Medical Electronics Co., Ltd BeneView Series Patient Monitor iMEC Series Patient Monitor Welch Allyn Connex Integrated Wall System Connex Vital Signs Monitor 194 Medtron AG Accutron MR Accutron MR3 SHENZHEN BASDA MEDICAL APPARATUS CO., LTD. 21 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories Bstar-150 Superconductive MRI System BTI-020S MRI SystemNebulizers BTI-035 MRI SystemNuclear Medicine BTI-050 MRI SystemOncology BTI-070 Open Superconductive MRI SystemOperating Room Equipment 198 Kare Medical and Analytical Devices Hikoneb 906 S/LCD Ultrasonic Nebulizer Hikoneb AeroCare II piston Type Nebulizer 200 Biodex Medical Atomlab™ 960 Thyroid Uptake System SHENZHEN BASDA MEDICAL APPARATUS CO., LTD. BDH-L Gamma Camera BDH-180 Single-Photon Emission Computed Tomography (SPECT) 202 STERYLAB BEST-LISAS BTT MIELO-CAN PARAGON Varian Medical Systems International AG BrachyVision™ Treatment Planning System EGDE™ Radiosurgery Suite GammaMedplus™ iX, 3/24 iX Afterloaders ProBeam® – The Varian Proton Therapy System RapidArc®. Speed and Quality Across the Spectrum RapidPlan™ – Knowledge-Based Planning The Varian Oncology Software Solution TrueBeam® VITESSE™ 3.0 Real-Time Planning for HDR Brachytherapy 212 Anetic Aid Ltd Operating Theatre Accessories22ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerOrthopedics Drager Medical GmbH Polaris® 100/200 - One design, Two choices! Etkin Medical ETC LED Lights GMP Technical Solutions Pvt. Ltd Modula Operation Theatre GPC MEDICAL LTD Operating Room Equipment Merivaara Oy Flexion orthopedic traction device Ningbo Greatcare Trading Co., Ltd Safety Scalpel Handle Schaerer Medical AG schaerer® MIS-System Stille imagiQ2 Schmitz u. Soehne GmbH & Co. KG DIAMOND Trumpf Medical TruPort – Flexibility has never been easier TruConnect – The innovative OR integration system from Trumpf Medical TruSystem 7000 – A table that meets every one of your surgical needs, simply and eiciently 222 3B Scientic GmbH ORTHObones Auxein Medical 3.5mm Wise Lock Anterolateral Distal Tibia Plates, Left 3.5mm-Wise-Lock-Clavicle-Hook-Plate 4.5-5.0mm-Wise-Lock-Distal-Femur-Plate 4.5mm-Proximal-Femur-Plate ACL Elbow Aimer ACL Screw Austin Moore Hip Prosthesis - Standard Stem, Stainless Steel, Satin Finish Colles Fixators 23 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories Elbow Clamp External FixatorOrthotic Large Fragment & DHS-DCSPediatrics / Baby Care Ligament-StaplesPhysiotherapy Equipments Lineix FixatorsRadiology Locking Plate & Screw Mini & Small Fragment Square Frame Plates for 2.0mm Screws Thompson Hip Prosthesis, Standard - Stainless Steel, Satin Finish Three-Legged-Staples Wise Lock DHS Plate Wrist Fixator GPC MEDICAL LTD Orthopaedic Products KARL STORZ Endoskope - East Mediterranean & Gulf Orthopedic & Sports Medicine 240 Amit Inc Contact Digitizer Impress Scanner Orthotic Fabrication System 241 GPC MEDICAL LTD GPC Baby Care Products 242 CAPENERGY CIM 100 - Physiotherapy & Sports CIM 200 - Physiotherapy & Sports Fiber rupture regenerator CHINESPORT spa SINTHESI MI.TO 246 Control-X Z motion 224ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBer Medtron AG Accutron CT Accutron CT-D OR Technology (by Oehm und Rehbein GmbH) Amadeo Divario Leonardo DR systems Medici SHENZHEN BASDA MEDICAL APPARATUS CO., LTD. BLA-600C medical electron linear accelerator BTF-50 digital luoroscopy system BTM-10 DIGITAL MAMMOGRAPHY SYSTEM BTR-640 Digital Radiography System (DR) Varian Medical Systems International AG i5DR Imaging System MCS-8064 Replacement X-Ray Tube PaxScan® 4336W Wirelss Flat Panel DetectorRehabilitation Equipment and Devices 256 Biodex Medical Balance System™ SD BioStep® 2 Semi-Recumbent Elliptical Glaswarenfabrik Karl Hecht GMBH & Co KG 2884 Kinesiology Tape GPC MEDICAL LTD Rehabilitation equipment and devicesRespiratory Care system 258 Hamilton Medical AG HAMILTON-C1 HAMILTON-C3 HAMILTON-G5 HAMILTON-H900 HAMILTON-MR1 HAMILTON-S1 HAMILTON-T1 25 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories 265Scales DETECTO SCALE USA EU WAREHOUSESleep Diagnostic Systems CHAIR SCALESSleep Therapy WHEELCHAIR SCALES J D Honigberg InternationalSterilization Doran ScalesSurgical Equipment 266 Resmed CPAP & Non-Invasive Ventilation Masks Elisee 150, 250, 350 Ventilators Sleep Diagnostics (PSG, PG, Screening) 268 Curative Medica CURASA - CPAP/AutocPAP - sleep apnea treatment Kare Medical and Analytical Devices SleepOne Auto CPAP SleepOne Bilevel S SleepOne CPAP 272 Celitron Medical Technologies Kft Bench-Top Steam Sterilizers - Sting 11 B Family Large Steam Sterilizers - Azteca A Series Medium Steam Sterilizers - Azteca AC Series GPC MEDICAL LTD Sterilisation Products RENOSEM Co., Ltd. LOW TEMPERATURE PLASMA STERILIZER Sklar Instruments Sklar Sterile procedure kits 278 Biodex Medical C-Arm Table - 840 Dr. Frigz Intl General Surgery Equipments26ARAB HEALTH PRODUCT DIRECTORY 2015

Categories Company/produCts page numBerTraining equipment Surgical EquipmentsUltrasonography GPC MEDICAL LTDVentilator GPC Surgical Equipments & instruments Lotus Surgicals Private Limited Hemosec – Open Applier POLYESTER Suture Prosec – Skin Stapler Maquet Middle East FZ-LLC MAGNUS operating table system Nuvo, Inc. Nuvo, Inc Nuvo line of LED lights Nuvo V Series Surgical Tables Nuvo Vplex Video Integration System Nuvo Equipment Management System Nuvo line of LED lights Verde NV4 Sklar Instruments Sklar Reusable Surgical instruments O.R. grade Trumpf Medical iLED 7 – The world’s irst OR light with built in intelligence 289 3B Scientic CPRLilly™ CPRLillyPRO™ Professional Life Support Training Epidural and Spinal Injection Trainer Kinesiology Taping with 3BTAPE 293 SHENZHEN BASDA MEDICAL APPARATUS CO., LTD. BTH-100 COLOR DOPPLER ULTRASOUND SYSTEM Shenzhen Mindray Bio-Medical Electronics Co., Ltd DC-8 Diagnostic Ultrasound System 294 Curative Medica FLEXO - noninvasive ventilator Leistung Mechanical Ventilators LUFT1-g pediatric ventilator LUFT-NEO neonatal ventilator 27 ARAB HEALTH PRODUCT DIRECTORY 2015

INDEX Company/produCts page numBerCategories PR4D-02 transport ventilator PR4-g transport ventilatorVeterinary Nihon Kohden Middle East FZEWaste Management Piston HFO/IMV ventilator for neonate and infant Humming VueAddendum 299 Dr. Frigz Intl Veterinary Instruments 300 Celitron Medical Technologies Kft Integrated Sterilizer & Shredder - ISS 25L Integrated Sterilizer & Shredder ISS AC-575 304 ATMOS Medizintechnik GmbH BERCHTOLD GmbH & Co. KG CIM med GmbH HEINE Optotechnik GmbH & Co. KG Leader Healthcare FZCO MEIKO Maschinenbau GmbH & Co. KG MICROS Produktions- und HandelsgesmbH Montmed Richard Wolf GmbH Rudolf Riester GmbH MEDICREA International28ARAB HEALTH PRODUCT DIRECTORY 2015

Hands-on Training! Test the new Injection Trainer at Arab Health, booth Z3 N30IED THE 3B CIENTIFICG EPIDURAL AND SPINAL F S OUP INJECTION TRAINER GERMANYQUALITDYESCIOGNNTERDO&LLED INR • Extremely realistic haptic feedback IS • High-quality material, needles don’t leave a trace • Fluid-filled spinal canal with realistic outflow rate IS • Practice loss-of-resistance and hanging-drop technique 9001 CERT Call us for more information! OI ►3bscientific.com 3B Scientific GmbH | Rudorffweg 8 | 21031 Hamburg | Germany phone: +49 (0) 40 739 66 231 | e-mail: [email protected]

A-Z COMPANY LISTINGS3B Scientic DTR Medical Ltd77 Elektronika Etkin MedicalAccess Bio Express Diagnostics Int›l, Inc.Altera F.L. MEDICAL S.R.LAltro FernoAlvi Srl Fujirebio Europe (formerly Innogenetics)Alvo Medical GEM SRLAmit Inc Glaswarenfabrik Karl Hecht GMBH & Co KGAnetic Aid Ltd GMP Technical Solutions Pvt. LtdAssociate of Cape Cod GNH IndiaATMOS Medizintechnik GmbH GPC MEDICAL LTDAuxein Medical Hamilton Medical AGBERCHTOLD GmbH & Co. KG HEINE Optotechnik GmbH & Co. KGBeta Healthcare Products Pvt Ltd Hill-Rom M.EBiodex Medical IntersurgicalBioneer Corporation J D Honigberg InternationalCAPENERGY Jinhua YIDI Medical Appliance CO.,LTDCelitron Medical Technologies Kft Kare Medical and Analytical DevicesCHINESPORT spa KARL STORZ Endoskope - EastCIM med GmbH Mediterranean & GulfCompuGroup Medical Bilgi Sistemleri A.S Leader Healthcare FZCOControl-X Leistung Mechanical VentilatorsCurative Medica Lemi Group- Brusaferri & c. s.r.l.DETECTO SCALE USA EU WAREHOUSE Lotus Surgicals Private LimitedDirui Malaysian Rubber Export PromotionDr. Frigz Intl CouncilDrager Medical GmbH Maquet Middle East FZ-LLC30ARAB HEALTH PRODUCT DIRECTORY 2015

Medic Clean Air RENOSEM Co., Ltd.Medical Innovations ResmedMedicom MTD Ltd Richard Wolf GmbHMEDICREA International RitterMedtron AG Roche DiagnosticsMedu-Scientiic Limited Rudolf Riester GmbHMEIKO Maschinenbau GmbH & Co. KG RuhofMerivaara Oy Schaerer Medical AGMerry Electronics SCHILLER AGMetrax GmbH Schmitz u. Soehne GmbH & Co. KGMicrolit SHENZHEN BASDA MEDICAL APPARATUSMICROS Produktions- und HandelsgesmbH CO., LTD.MIR Medical International Research Shenzhen Mindray Bio-Medical ElectronicsMontmed Co., LtdMortara Instrument Shenzhen New Industries BiomedicalNDS Surgical Imaging Engineering Co., LtdNeotec Medical Industries Pte Ltd. Sklar InstrumentsNihon Kohden Middle East FZE STERYLABNingbo Greatcare Trading Co., Ltd Sysmex Middle East FZ-LLCNorav Tecnimoem 97Nuvo, Inc. TorayOK Biotech Co., Ltd Trumpf MedicalOmron Healthcare Europe B.V. ULTRA CONTROLO INTERNATIONAL LDAOR Technology (by Oehm und Rehbein Unbescheiden GmbHGmbH) Varian Medical Systems International AGOrtho Clinical Diagnostics VisusPHOENIX Medical Equipment S.A. Welch AllynPointe Scientiic 31 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGS3B scientiic gmbH3B Laser needLe - the new dimensionExpand your range of treatmentsWith the new 3B LASERNEEDLE you use up to 12 laserssimultaneously. An instrument version with red laser light (660nm) is provided as a proven standard. The instruments can beindividualised according to the focus of your therapy, so thatin addition to red laser light and infrared light (808 nm) can beused and combined.Technical Details:• 3B LASER unit with 12 laser diodes• Mobile Control Touch Screen• Painless and side-efect-free treatment• High patient acceptance• Amortisation after only a few treatmentswww.3bscientiic.comalteradisposable Breathingand infusion systemsManufactures and assemblesDisposable Breathing and InfusionSystems with the Altech® brandmanufacturing in clean rooms of10.000 and 100.000 class.The products are CE marked andcomply with ISO 13485:2003+AC:2007 quality regulations.In addition to the supply of itsown branded products, thecompany also ofers contractmanufacturing services to thehealthcare industry”www.altera.com.tr 32 ARAB HEALTH PRODUCT DIRECTORY 2015

AgpC medical Ltdanaesthesia productsAnaesthesia Machine Major, AnaesthesiaMachine Mini, Anaesthesia Machine MiniMajor, Anaesthesia Machine Portable,Artiicial Manual Resuscitators in Rubberand Silicon, Angle Mounts, CorrugatedTubes, Anaesthestic Face Masks (Padded,Silicon, Rendell Baker) Oxygen Flowmeters, Rebreathing Bags, OxygenRegulators.www.gpcmedical.commaquet middleeast FZ-LLCFLoW-iFor more than 30 years, MAQUET hasbeen a leader in setting mechanicalventilation standards with systems suchas SERVO-i. Today MAQUET is bringingthose optimised ventilator principlesto the ield of anesthesia. Early in 2010MAQUET is introducing a modular,ergonomic system that combinesadvanced ICU ventilator performancewith anesthesia delivery: FLOW-i.www.maquet.com 33 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSgpC mediCaL Ltd The instrumentation range includes- Drill Guide System, Drill Bits, Reamers, Strippers, Elevators, andactiFix: Curettes, etc.Complete Solution to Arthroscopy! All our instruments are designed to allow easy accessibility & maneuverability to speciic areas ofThe GPC Orthopaedic Division ofers a complete menisci.range of Knee & Shoulder Arthroscopy Implants www.gpcmedical.com& Handheld Instrumentation- ActiFix! It is acomprehensive Arthroscopy solution from jointaccess to tissue & suture management.The Implant range is as follows-• ActiButtons• Interference Screws• Spiked Washer Staples• Low Proile Screws• Cross Pins• Tibial Base Plates• Tibial Post Screwsunbescheiden gmbHarm and leg baths – for localhydrotherapeutic treatments. Unbescheidenofers an extensive range of systems andequipment for all common therapeutictreatments, including electrogalvanic arm andleg baths, jet contrast baths and jet whirl baths,Kneipp and Hauf leg and arm contrast bathsas well as sitz baths. The automatic controlfunctions of the arm and leg baths makethings easier for the therapist. The system iseasy to use and treatments can be selectedfrom 12 pre-programmed options. The four-basin bath, arm and leg baths and the sitzbaths consist of high-quality acrylic glass andare seamlessly shaped.www.unbescheiden.com 34 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Cunbescheiden gmbHHeight-adjustable tubUnbescheiden’s compact height-adjustable tub is recommended forsmaller treatment rooms. The tub isequipped with a thermometer andan anti-scalding device. Optionalaccessories for wound treatment includea lowfrequency ultrasound system. Thetub itself has slightly rounded cornersand is made of premium acid-resistantstainless steel, which increases usercomfort and convenience and makesit easier to clean and disinfect formaximum hygienic safety. There isa shower head on both sides of thetub for efective wound treatment.Unbescheiden – ideal solutions forpatients and medical staf.www.unbescheiden.commaquet middle east FZ-LLCCardioHeLpA heart-lung support system no bigger thana suitcase – MAQUET has made this vision areality. CARDIOHELP is not only the world’smost compact and lightweight heart-lungsupport system, it is also a complete solutionfor use in intensive care, cardiac surgery,cardiology, and emergency medicine.www.maquet.com 35 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSmedicom mtd Ltdneuromyoanalyzer neuromyan2, 4 or 5-channel modiications of a patient›sunit and diferent versions of software extendthe choice of neuromyograph for users – froman inexpensive variant to an elite expert classdevice. • EMG studies: F-wave and H-relex,motor and sensor conduction velocity, motorunit potential, blink relex, express surfaceEMG, surface multichannel EMG, and needleEMG. • EP studies: Brainstem Auditory EvokedPotentials, Long and Middle Latency AuditoryEP, Flash Visual EP, Pattern Reversal Visual EP,Somatosensory EP: Short and Long Latency.www.medicom-mtd.comnorav medical gmbHBLue eCg - Wireless resting pC eCg• Without an ECG patient cable• Caregivers have greater freedom of movementwhile acquiring EKGs.• No cable induced artifacts• Clean Traces• Easy to Use• Software includes export and interface optionswww.norav.com 36 ARAB HEALTH PRODUCT DIRECTORY 2015

Cnorav medical gmbHneCg-12C 12 Lead• Compact and lightweight• Alphanumeric keypad• Internal memory for up to 200 ECG recordings• Real-time ECG waveforms freezing and review• Transfer of stored data to the NoravECG Management System NEMS Easy to Usewww.norav.comnorav medical gmbHnH-301 Holter monitoring system“Holter monitoring has never been easier”Norav’s true 3-12 lead holter system features:• Atrial Fibrillation Detection• Outstanding on-screen graphics• Remarkable speed for downloading patient datafrom the recorder to the PC,using a USB cable or Flash Card Reader.• Analysis is completed and ready to be printedwithin minutes after downloading• Maximum patient comfort thanks to the smallHolter ECG recorder.• Comprehensive, reliable Holter report.• Up to 7 Day Recording.www.norav.com 37 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSnorav medical gmbHnm700 telemetry eCg• Up to 6 Channel Display• Small Lightweight Transmitters• Arrhythmia Detection• Ideal for Cardiac and PulmonaryRehabilitation• Simple to Operate• PC Based Central Station• Comprehensive reports of patientactivity• Compatible with NEMS Norav ECGManagement Systemwww.norav.comnorav medical gmbHthe 1200W Wirelessexercise testing eCg - DigitalRF Wireless systemproprietary wireless data acquisitionbetween the patient and theworkstationallowing for maximum safety andcomfort. Has the cleanest ECGtracings in the stress market.No restrictions on movement,patient is free to walk around theoice without signal degradation.Triggers the image without anyinterference/blockage.Perfect for image testing needs suchas ultrasound. Controls diferentbrand treadmills and ergometers.Interfaces with leading brandmetabolic systems.www.norav.com 38 ARAB HEALTH PRODUCT DIRECTORY 2015

CsCHiLLer agBr-102 plus pWaSCHILLER’s Pulse Wave Analysis (PWA): CircadianCentral Hemodynamics and blood pressuremeasurement in one.SCHILLER introduces the irst solution thatcombines the non-invasive, cuf based preciseauscultatoric and the reliable oscillometricmeasurement to generate a 24 hours proile ofstifness parameters like pulse wave velocity andcentral and peripheral blood pressures.www.schiller.chsCHiLLer agCardioVit Cs-200 ergospiroErgospirometry has become an indispensabletool for cardiopulmonary function diagnostics.SCHILLER›s innovations in this area, such as the CS-200 Ergo-Spiro, are highly advanced and combinevarious features in a single device. Comprehensivefunction analyses of the heart, lungs, circulationand metabolism are therefore possible and all areasof cardiopulmonary diagnostics are covered.www.schiller.ch 39 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSsCHiLLer agCardioVit Cs-200familyThe next generation of stresstest systemsIn the year of its 40thanniversary, SCHILLER isvery pleased to announcethe CARDIOVIT CS-200family, a combination ofhigh diagnostic qualityand maximum lexibility toprovide the perfect solutionfor everyone:- CS-200 Excellence- CS-200 Touch- CS-200 Oicewww.schiller.chsCHiLLer agCardioVit ms-LineIn the year of its 40thanniversary, SCHILLERproudly presentsan algorithm whichimmediately andaccurately localisescoronary occlusions andprovides early detectionof STEMI. This algorithmis now integrated in thesophisticated touch ECGdevices, the CARDIOVITMS line:- MS-2007- MS-2010- MS-2015www.schiller.ch 40 ARAB HEALTH PRODUCT DIRECTORY 2015

CsCHiLLer agmedilog eCg HoltersystemsSophisticated longterm ECGrecorders with 99.9% accuracyOur longterm ECG recorders of themedilog® plus series are designed for1, 3 or 12-channel ECG recordings,ofering a wide range of ECG analysisoptions.Main analysis features:- PureECG Technology- HRV-Analysis- Fire of Life detection- Apnoea detectionwww.schiller.chtoray“inoue-Balloon”catheter is indicated for PTMC(Percutaneous Transvenous MitralCommissurotomy) in patientswith mitral stenosis. The volumecontrolled hour-glass shape of theballoon assures proper positioningat the stenosis, prevents migrationof the catheter and providesoptimal dilation. The unique balloonconstruction exhibits dynamicinlation properties suicient forvalvular expansion. Rapid inlation/delation cycle (5sec.) quicklyreturns valve to normal function.www.toray-medical.com 41 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSCurative medicalthe naVaJo pta ballooncatheter is designed for transluminalangioplasty in peripheral vasculature.High Pressure, low proile with excellenttrackability• Durable TEXLON balloon material• Kink resistant catheter construction• LoFold technology for easy lesion cross• High pressure (up to 16 atm), low proile,excellent results• Hydrophic coating facilitate cathetertrackability• Tapered soft tip for track through tortuousvessel and tight stenosis• Low proile shaft for 5F sheath compatibleup to 7mm balloon and less invasivepuncture sitewww.curativemedical.comCurative medicalthe ursa angiographiccatheter is designed to be used fordelivering radiopaque media to theselected sites in the vascular system.• Advanced braided design yieldeiciency 1:1 torque transmission andsuperior support• Unique polymer blend provides optimalstifness for navigating through tortuousanatomy, achieving optimal shaperetention• Robust and 3 layers shaft constructionallows the downsize and gets thedesirable performance• Large lumen allows high low, and thebest visualization• Atraumatic soft tip reduces potentialvessel trauma during selection andcontrast injection• Durable and luted luer with a moldedstrain relief to ease manipulationwww.curativemedical.com 42 ARAB HEALTH PRODUCT DIRECTORY 2015

System-based perfectionATMOS® i View Outstanding technology: A coordinated, complete system consisting of lense and LED light Quality: “Made in Germany” Perfect HD image quality Outstanding 3D image quality Outstanding handling: Ergonomics and suitability for everyday use ATMOS MedizinTechnik GmbH & Co. KG Ludwig-Kegel-Str. 16  79853 Lenzkirch/Germany  Tel: +49 7653 689-374  Fax: +49 7653 68986-374 [email protected] www.atmosmed.com

A-Z PRODUCT CATEGORY LISTINGSgpC medical Ltd.medical CathetersCatheters are tubes used in hospitals to delivermedications, luids or gases to patients or todrain out bodily luids such as urine. These areinserted into a body cavity, duct or blood vessel. Acatheter may be left in the body either temporarilyor permanently. GPC provides a wide range ofcatheters such as Foley’s Balloon Catheters, UrinaryCatheters, Nelation Catheters and many more.A range of polymers is used in manufacturingdiferent catheters. We use the highest quality rawmaterial to ensure biocompatibility.All these catheters come in sterile, individuallypacked and in peelable blister packing.www.gpcmedical.commalaysian rubber exportpromotion CouncilCathetersFor quality rubber medical devicesmanufactured to international standrads,look to Malaysia. Malaysia - world›s No.1 inmedical gloves, condoms, and catheters.www.mrepc.com 44 ARAB HEALTH PRODUCT DIRECTORY 2015

“The Clinical Advantage”™Biodex Medical Systems, Inc. Providing customers with innovative products and service excellence for more than 60 years.Our dedicated employees work as a team to bring promise of functional and elegant design to life. PHYSICAL NUCLEAR MEDICAL MEDICINE MEDICINE IMAGING• System 4 Dynamometer • Dose Calibrators • C-Arm Tables• Balance Systems • Thyroid Uptake System • Ultrasound Tables• Ergometers • Lung Ventilation Systems • Radiation Protection• Gait Trainers/Treadmills • Syringe & Vial Shields • MRI Stretchers BIODEX www.biodex.com 1-800-224-6339 Int’l 631-924-9000 BIODEX BOOTH # Z4AC17 MADE IN 
 


 U. S. A.FN: 14:365 11/14

A-Z PRODUCT CATEGORY LISTINGSruHoFendozime® aW triple plus® with a.p.a. is a multi-tiered enzymatic detergent with Advanced Proteolytic Action (A.P.A.)and rust inhibitors. A.P.A. is the latest enzymatic breakthroughdeveloped by Ruhof that greatly increases protein enzyme activityto provide a faster more thorough penetration into hard-to-reachplaces on surgical instruments and scopes. Recommended forreprocessing of all instruments-from the most diicult to clean tothe most delicate -ENDOZIME® AW TRIPLE PLUS® has biologicaladditives that speed the process of liquefaction and solubilization,facilitating enzymatic action and contributing to the product›ssuperior efectiveness. Designed for use in all washers, washersterilizers, ultrasonics and manual cleaning, the detergent is low-sudsing, free rinsing, has a neutral pH and is 100% biodegradable.www.ruhof.comruHoFendozime® Bio-Clean is a unique neutral pH multi-tieredenzymatic detergent designed to target insoluble polysaccharidesallowing for the complete elimination of all Bioburden andBioilm on semi-critical and critical medical devices by highlevel disinfectants or liquid chemical sterilants. Endozime® Bio-Clean is the only enzymatic detergent on the market clinicallytested to pass ISO 15883 Annex F*. It accomplishes this diicultISO standard by dissolving the extracellular polymeric layerencasing the bacteria in Bioilm and exposing them to high-leveldisinfectants or liquid chemical sterilants.www.ruhof.com 46 ARAB HEALTH PRODUCT DIRECTORY 2015

CruHoFprepzyme® Forever Wet with Bio-Clean Technology is a multi-tieredEnzymatic humectant spray which promotes the long lasting retention ofmoisture on soiled instruments and scopes thus helping to prevent the adhesionof bio-burden. This unique formulation gently coats instruments to maintainmoisture making it an ideal pre-cleaner for soiled instruments during transport orwhen left for an extended period of time.Perfect for use in Operating Rooms, Endoscopy Suites, OutpatientSurgery, Dental and other departments where instruments are transported todecontamination.www.ruhof.comalways provide you owfitohutrhecobmepstantoyo‘slscfuFoolrturbrmee:sotrWereetshujaulntsst.1lE0o0vxecyteoearlmsle,awkneectcehoinngisntsanbetelytnteimdr. opErsoxvcceodepellnyed.onCsccuoeripoysiinttoyis an essential partnetwork-based, intWOegueErraccExtoeuxcdmstceobOmeilRnleleelmrentsraaneckdrevceitsiiceoeyniEonJsaiuotnxlrriacncetwreeaeongofdutlyrsglkrmueiiswsncanmsonaeicrmasldteehrptwoDiieorplfreiii,dsi:nnwenecsIxt.giio’tmnschv.eqEepoethwlluuxlWieregrorcathnerjhoake-lctbneikeelotndclt!yfsoeohmpd.wmnimiosrcaLittrahtieeknenesegsusubyefiaiocecnscusuahttrrubeeshrdwl.ieeneasEeag,yxasxptimotelceotror.hetturesEelrnnlaxcsbenucnardnareeeriwncselqsuel.ui:epdapOenlioaiuntrysrmmneoatwrnesohrthkipaonwf id1thiE0sW0thxiniegcygLkheueen-asitsolresslhwce,echdatwnhmbeeeclaEexbecnspexo,uesnrcifmtatsnswectoataarluenenlyErteidlnEnbytxongrdsxcaieumctiocneonpepsespsltruu:looclerrirOlvenntoeenutqndhpnrucieenneaywcenmelt.ietdtiewydeCiodenuopgsiainrrrccikrosooaca-dsplbiinuuitynapttcyiosrsotntoseoitgsgdnoiorras,aee.vlmansitwnoatsOaet.pemeutsygrEirssoarorecadxkpnunteurcertseciodt.atehtvoslleiOamWl.dpmlREeateeeirroxoytmncsuooconcearufmserkeosveewbilul.csvl&iirneeiteJhnycessonoo.ttitumhrnrEceaareptexdodewabiugctuoneiriyoersynckwnit‘sslaaotlseolecsrmtlocuidnimnlralowsatgurpcftinftredlioseeere.r::, owfitohutrhecobmepstantoyo‘slscfuFoolrturbrmee:sotrWereetshujaulntsst.1lE0o0vxecyteoearlmsle,awkneectcehoinngisntsanbetelytnteimdr. opErsoxvcceodepellnyed.onCsccuoeripoysiinttoyalways provide youis an essential partnetwork-based, intWOegueErraccxtoeucdmsteobOmilRnleeemrntsraaeckdreveitsiicoeyniEonsautxlrraccetwreaengoftlyrsglkmeiissnanmsneicmaseehrptierplrei,i:nwnsItgii’tmaPsh.qnapohdyluuWiegrrduahejoisa-lstbnikecatndcotyoohvvm.wiemsmoriaLttraheeekanesvesutsebyefSanocectcusuaamttrrubnesrowl.dieenrasEeag3,y!sxGtimotec3oro.0etureEelrnnlxsbeucnrnareeeiwnclqselui:edaOenliaiuntysr Excellence in education. Excellence in health care.Join our worldwide nRDiuecbhtaawirdInoWterroknlfaatioot nAfaraldbCiHosnetvaielntnhtgi–onu26&is-Eh2xh9eibJdiatinouenaxCryepn2te0re1rt5s and supporFor more than 100 years, we constantly improved endoscopy to always provide you with the best www.richard-wolf.com 47 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSortho Clinical diagnosticsthe Vitros® 5600 integratedsystemIn developing the VITROS® 5600 IntegratedSystem, Ortho Clinical Diagnostics (OCD)took an ‘integration by design’ approach. Wepartnered with laboratories worldwide tostudy their unique needs and processes. Thisresulting integrated system is the irst of its kind,with innovative sample-centred processingwhich optimises turnaround time. Togetherwith patented enabling technologies toconsolidate and simplify testing, the VITROS®5600 Integrated System ofers more of whatcustomers demand: quality, productivity andease of use.www.orthoclinical.comortho Clinical diagnosticsthe Vitros® 350 Chemistrysystem is designed to be eicient,dependable, and above all, easy to use. Thiscompact system is simple to learn, operate,and maintain. Whether you use it as aprimary, STAT, or backup system, the VITROS®350 Chemistry System will get the job doneright the irst time and help your laboratorydeliver quality results that patients cancount on.www.orthoclinical.com 48 ARAB HEALTH PRODUCT DIRECTORY 2015

pointe scientiic Cenzymatic Creatinine reagent set 49Presenting another addition to the Pointe ARAB HEALTH PRODUCT DIRECTORY 2015Scientiic diversiied portfolio of chemistryreagents. The new enzymatic Creatinine assayfor automated chemistry analyzers is a two-partliquid stable reagent that eliminates interferenceby endogenous creatine and ascorbic acid. Nointerference was observed with: ascorbic acidup to 200 mg/dL, hemoglobin up to 500 mg/dL,bilirubin-conjugate up to 32 mg/dL, bilirubin-freeup to 40 mg/dL. The assay also shows excellentcorrelation to other creatinine assays. Precisionstudies conducted according to NCCLS: EP 5protocol yielded excellent precision with CVsbelow 2%www.pointescientiic.compointe scientiicHomocysteine reagent set -Two-Part Liquid StableAnother unique and innovative oferingfrom global manufacturer PointeScientiic. The new Homocysteine assayfor automated chemistry analyzers is atwo-part liquid reagent, incorporatingan enzyme cycling sequence that ofersa 24 month shelf life. The calibrator isstandardized to NIST SRM 1955. Theassay shows excellent correlation withHPLC and immunoassay methods.An accuracy study between PointeScientiic Homocysteine and Catch,Inc. 2-Part Homocysteine, showeda correlation coeicient of 0.991.Precision studies conducted using theCLSI: EP5-A2 protocol yielded excellentprecision with CVs at 2.6% and below.www.pointescientiic.com

A-Z PRODUCT CATEGORY LISTINGSpointe scientiictorCH immunoassay KitsIntroducing a new line of TORCHImmunoassay kits exclusivelyfrom Pointe Scientiic. These kitsare made in the USA, and employElisa methodology. The Elisamethodology provides excellentsensitivity, speciicity, accuracyand precision. The assay kitsofered will determine IgG and IgMantibodies to Toxoplasma, IgG andIgM antibodies to Rubella, IgG andIgM antibodies to CMV and IgGantibody to HSV. These assays havebeen shown to yield comparableresults to other TORCH methods onthe market.www.pointescientiic.comassociate of Cape Codthe Fungitell® kit is a highlysensitive, rapid diagnostic test thatdetects (1-3)-ß-D-glucan in serum inas little as one hour. The Fungitell®assay›s ability to detect picogramlevels of (1-3)-ß-D-glucan in serumassists clinicians in identifying InvasiveFungal Disease (IFD) early in the diseaseprocess. 50 ARAB HEALTH PRODUCT DIRECTORY 2015

C-Ddr. Frigz intldentistry instrumentsA complete range of dental instruments usedduring all kinds of procedures including extraction,impression, general checkup, and dental implantsurgeries are available on OEM basis. All instrumentsare CE certiied and avaialble with quality guarantee.www.frigzinternational.com 51 ARAB HEALTH PRODUCT DIRECTORY 2015

A-Z PRODUCT CATEGORY LISTINGSmir medical international researchFlowmirSimple, accurate, hygienicSpirometry requires accuracy and hygiene. FlowMir® changes the game!Each turbine is computer calibrated individually packed with papermouthpiece.100% cross contamination free. After testing turbine and mouthpieceare thrown away.A full spirometry session can be performed, including a bronchialchallenge or POST BD test.www.spirometry.commir medical internationalresearchspirobank iiAccurate and easy to use spirometer with oximetryoptionSpirobank II® deines a new standard for portablespirometry and the ideal solution for primary care.Best solution for integration with third party andtelemedicine platforms with wireless communicationand spirometer + oximeter combination.Icon based function keys directly on display forintuitive and quick coniguration.Large memory with a capacity of 10.000 tests.FVC, VC, IVC, MVV tests with real time spirometry curvefor immediate assessment of results.Oximetry option, post BT, Bluetooth® and batterycharger available on the advanced version.www.spirometry.com 52 ARAB HEALTH PRODUCT DIRECTORY 2015