WHERE GREAT MINDS MEETWHICHISTHEBEST WindowsvsApple:SMARTPHONE? Which is the Best?APPLE OR SAMSUNG? 51
E N G IWN EOEMRE CNH I C K Photo Source: VagabombShe’s 22 and dtottwawotwbWibnohhhguffueaaifgeaaelthiSitrssihttrclhieiawtlenaealwtievbed.vahsbbig ertieiiioomWoslhinfststlnfiuufh,hicnolCocattheMeraagsuueuattotGtleyoordldIebstaoowToifhaderebmhfurnnolmeneailyeunzeeua-lngrcsigabAntylvimodhldtanwedgeemouraehirssipheklnrrmedarrtPaapsldroevoovnlababioseanbecbsdtkyefntathliueteahetodtnethesmhrhapusejyotscokteheaerhksuauipwolonai‘dtmigElrwepntaoahneilpgmsyrnnteenhku--ye-es P bshwySfFsaegPhigThttof wWhe qsda emoahatthvnnvsoelcuuoaoeeeewhhuuahnilceeneeiucthrrrromusttaepyDyedfeiuirrrshkinufsnet,ossnsttaoonoena,uyi.stp.oheitnas et’cgfgdndewrfgsecscoRsuIhsiohsyiht,rhsSedee,sbadnsnyesnham.eFeouoiMGm.gcated lo:eeniFaoHpeoaioauacsinIrngiouvicelonttccaianinefifcm’rAMC“oldco’rtsenafon’sekynuseMralrPwheehtswsm.ltiubslfoceenwndnrinheahshithaiaBmPnhescolFlIeeneoesdaonteneteydoeosuT.haanoevirooprer nntsadesorrclHH.tnscawPeimtltrukreeib tekdt’aleoyft,tsaWnrcvudiisatrs,fndeaetou,a.,iouykuodhsoifo,egislaeIrrrsotdeyieconeesitrsnoyuetsosfhri.vltanwecossa ehrtedupksolshsinTtaasi.stbNhrettlutnehsittiatuusrsaehishdaadnwouaa9paaodgechaeiklrydfdnelaavgosugfl-fsoretnsuli.eiobkrfittowoteyldtiritti’ineBein,oopspifuhoriasninnmwososognwremgoHabn-dylhmunaonteneaYprir5eiegbwwueahaysvg’xntaeltnegsbt,atrhadmtlshetaocrlireahassanasiahtllent!tpiearyciicshnnutezonrsitkdslsiinnedccaodn-h.e”e,hhyg-,ge.She Could Be theNext Einstein rgast hetlrerneaeidtnawlu’ydooaywrtflemodtdoraSokdfdhfrianoeePy’mgs’ahsnhyngMoseeairwnmcIswTe2e.ra2aSafytnhoaitreodnonhadigs?lerhercestauaeshdrl-feyrin Photo Source: Slideroom Blogby Alice Hernandez 52Miss Pasterski was waitlistedsLibnouuricMslkdfiIirlnTyogmfwoahrMpehlnIaeTnrs,ehss.aeowmaphepeprlirevodifde.es-o
?!“So What If I’m the Only Woman in the Construction Site?”ur 2Hm hostfssioeutp3nnaerucorelituldydr-gvyaercMueeereedt2tragiywietp0arroeaomnsarcotnrwocigao.welyrjiowlenlenaiedorITsctabBaeneim,thysfreorasgi:shirirrentstidlsomaenirhf,kigorlgosescGeewonrc.MyahulHaS-osyaaolsnthaaaerfsiwiotnkntdacnseeenkrepggorjwtsgraozohfs.gsisehitkwKTe9enssaoimi0thoeheslsntulrdtniisisweensagtatgtittnughoehnr-hSwlted-Zalhfeoc.esiiheonndnlrunedieta-dsr-,, tpteTw at tapisohhhnmsrrhosaeaaootfaometnloimjdstnercuuoeaiacdiotsnnamnthnctsttaioieelqoioafeltnnatuotndpaneesearredhrASHtfknoghc.epogateferKaretrrrewyesroasdl$yseieeasdosbe2.oeatitrulpmWoo0rtusekranta,mnph0a,atorf.igbac0ekotro,Tttmre0kiuwshinnhioiernaewnogeanbdntgcmmnaoej,gateotsdcoe,eohcfbamstqin–lgnevhuhousoeotesemteoshiooersetcynue.tdaueolsblyearfeeiairsgtssy.y ew ieeshkactcshhoxnnadeonherepelvjgw’lueatpeioicitrnsemsoasosotvmegefamnanueeudhswarmsrceet,etmthrnaostioreues,ntmatOinr.tcalthdrsehthtsaeta...iehsenoltWWHqhomen?wdunereohiiosgrsrtptmoiohtmetgeayeagerrwis.etnaefniSsnovinaihlstheartldhcieemsrqenaaseduainitgtnsssu,isdn’t–tpttasteoahortuotpmyuatethlsrniargduwtanoekegoatuoeltlaierildhsnyn,kadt 53
G A M WE ODME VE ENL O P M E N T toioMldngesagehmatipmNeeasexindpbdaveaeeFrssinereigetnudnecroemeenrssa,whnaehe,nxoradhhid2sloaee5trsx-aryiegtleiinflnaaegsr-.Hot Game Designer creates Photo Source: News FisherGames about her Sex Life by Cielo Panda For around five years, Nina has been working with teams of programmers and graphic artists to be able to create excep- tionally personal games about relation- ships and sex. She came into the limelight with a game called “How Do You Do It”. The game is all about a little girl who plays with her Barbie dolls while her mom is out, trying to find out how do grown-ups “do it”, the player will be controlling this event of course. Nina also created a game called “Ladylike”, where you try to control a conversation between a teenage girl and her mom, during a drive to a mall. Any- thing you say about boyfriends, school, sex and clothes, the mom would always disapprove—clearly a different game to play, even in real life. According to Nina, these games were all based on her true to life stories. How To Do It and Ladylike were games that had been inspired by her childhood experiences. For her, gaming is like poetry. “When I started making games, my main inspirations were poets. Elizabeth Bishop’s poem “In the Waiting Room” was my main inspiration for making Ladylike and How Do You Do It?, which are games about my childhood. Once I started making games, though, I discovered other game designers who were also interested in these vignette-style games. Games like Dys4ia and Gone Home are two of these games that really inspired me to make more vignette games about very human, honest characters.” Nina said, when asked on an interview who she was inspired by when she says gaming is like poetry. In November 2015, Nina released a new game named “Cibele”. It’s an intimately personal, multilayered narrative game that has caught the intrigue of many. It is a game based on a true story about love, sex, and the internet. The player will be playing a role of a 19-year old girl who became close to a young man whom she met through an online game. The two becomes closer and their relationship heats up with each phone call and private chat. This game, of course, was based on one of Nina’s experiences. It all started when she was 16. She met an older guy named Blake through Final Fantasy—a popular online game—gaming community. After numerous phone calls, flirty chats, and sexy selfies, Blake flew across the country to turn their online fantasy into a reality in Nina’s New York dorm room. Nina is very passionate about incorpo- rating her personal experiences into her game design. She wants to be able to create and add a more feminine touch to her video games. By sharing stories about her sex life, she hopes to be able to define her sexuality, career and inspire other women 54to be able to be the hero of their own life stories.Photo Source: Meld Magazine
Photo Source: Change Imagine falling in love with some- one. You become intimate with that person, engage in activities normal couples do, sending nude selfies of each other, frequently fight and eventually broke up. One day, a friend tells you the most terrifying news – the nude selfies you sent to your ex are all over the inter- net. The angry ex either posted those photos or someone else hacked into your account. Isn’t that the most embar- rassing thing one has to face in the world of social media? So many people (famous or not) fell vic- tims to the “revenge porn”. Now, Google wants to help these victims remove these images that degrades them in the public eye. Revenge Porn,I N F O R M AT I O N T E C H N O L O G Y Google Will Protect You Rejoice, victims of “revenge porn”. Help is on the way. by Alice Hernandez Google Search results.” Victims can fill up a web form G oogle, known to be very and submit it to Google as soon as it be- resistant in making changes in comes available. Even though the company their search engine, will allow admits that it will not entirely solve these its users to remove “revenge problems, this action is a small step towards porn” from its search results. making changes and protecting its victims Amit Singhal, the company’s senior vice – who are mostly women. These images are president of search, informed everyone in often uploaded in websites where anyone his blog post about Google’s stand in pro- can post anything. Victims are required to tecting victims of this malicious act: “Our pay lots of money in order to remove these philosophy has always been that Search photos from these websites. Other compa- should reflect the whole web. But revenge nies such as Facebook, Reddit and Twitter porn images are intensely personal and have already created policies where nude emotionally damaging, and serve only to de- photos can’t be posted without the consent grade the victims—predominantly women. of the person involved. So going forward, we’ll honor requests from people to remove nude or sexually explicit images shared without their consent from 55
FEinvMFgeeioGandrteseeearrotnifnesgt We normally take them for granted and just enjoy the easy life that is spoon-fed to us. So, let’s take some time to get to know some of these structures that have been created and designed by engineers for us, and marvel in the greatness of their masterpieces. Magnificent structures are seen everywhere thanks to the improvement of different machineries and continuously developing technology. These are only five of the many engineering marvels we should appreciate. I’m sure there are younger teams of researchers and engineers who want to surpass all these amazing engineering achievements, and be part of technological history. Danyang Kunshan Grand Bridge The Bridge was opened to the public in the year 2011. The length of this bridge encompasses a length of 260 feet. 2000 sturdy pillars are built to support its weight. Around ten thousand workers were involved in the construction of this bridge. The bridge was built over the Yang Cheeng Lake which is about 6 miles in length.Photo Source: Wikipedia 56
Millau Viaduct Bridge The bridge, located in Southern France, has an exclusive design. The bridge was built over the river Tarn that cre- ates a driveway from Paris to Barcelona. This bridge runs in between two plateaus. The bridge also has cable stayed columns that are transparent and intricately designed. They were constructed using minimum materials. Photo Source: Wikipedia Photo Source: WikipediaThree Gorges Dam This dam has been the dream of the hy-dro-engineers of China. The construction ofthe dam started in the year 1992. More than 15 metric tons of concrete were used to fill the massive barrier located across YangtzeRiver to create a reservoir. The length of this reservoir is almost as long as Britain. It hasa total of 26 turbines. It boasts of generating 18200 Megawatts of power. The Hadron Collider The Large Hadron Collider is one of the most awe- some and complex creations of modern technology. This is a scientific instrument that was built near the city Geneva. This instrument spans between France and Switzerland. It was created to augment the study of the tiniest particles that exist in our world today. Photo Source: Wikipedia Pan STARRS Photo Source: Pan-STARRS This was developed in the University of Hawaii.This has been designed for an extensive imaging facility. The Institute of Astronomy has devel-oped this so that the entire span of the sky could be seen. There are several small mirrors and a digital camera installed inside the device. It is used for the observation of the solar system. 57
WCDoohnry’ptEoFnrigtaiItnneesersby Farrel Pinto I don’t know about you, but this I think the act is hilar- sure is a funny scenario of an iously a hyperbole, (‘cause you engineer in a corporate world. know, we have MBA engineers!) Basically, dealing with but what it tries to say is just this situation at first hand is not an exactly what it is. easy thing for an engineer. It’s just Technicality! that “engineering culture” we have Well, the challenge here that these corporate people don’t for us, engineers, is the mobility to appreciate, you know? express our ideas and plans in any Engineers tend to have aspect and setting. We must know this default mindset of practicality what kind of solutions to relay and and being so technical wherein be able to adapt with the situation they are experts. we’re in. Then that’s how engineers The engineer in the vid- become the real experts. Just don’t eo thinks things geometrically get bullied like this guy though. even if the lines discussed in the Yes, we are “the expert”, and we meeting is merely just a repre- can show them. sentation of a marketing plan. So So, I guess, we do not he argues and tries to be logical conclude that ALL engineers do in which these corporate people not fit in the corporate world. We don’t understand. can be corporate managers too! Yes, he is logical and Now, that seems logical reasonable but his idea may seem eh? out of place. Photo Source: SmilesumoThis short comedy clip shows how anengineer tries to fit in a corporate meetingand how he became “The Expert”. 58
Trainspotters Bother The Girl From The Viral Train Story After the story became popular, people are visiting the Kamishirataki Station in Hokkaido for the lone train passenger to come out of the train latelyA remote Kami-Shirataki station closed. Every day only two trains stop in the far north of Japan has at the Kami-Shirataki station with a somehow given us some lit- unique timetable depending on when tle faith back to humanity: for the girl needs to go to school and back.” three years, the same train in As soon as story got out about the station loads and unloads this feel-good story, people have been an-a single passenger on her way to school. noying and bothering the girl in the story.The ride is but a lonely one; but it’s far Trainspotters are very com-better than driving all the way to school mon in Japan – with attempts to takeby her parents and waking up early for it. photos and share videos of trains in the Remember this popular sto- country. However, trainspotters have beenry? When China’s CCTV News pub- targeting the female high school student aslished that story, it got around 90,000 their subject for their hobby. They wait forshares online. In its story, it shared: her and as soon as they see her, they harass “For years now trains have her with instructions to pose for them.stopped at the station just for her. Ja- It seems like the girlpan Railway will keep the train sta- has to deal with these pesky train-tion open until she leaves school. The spotters until her graduation.girl is expected to graduate on March26, 2016, when the station will then be Photo Source: Blasting News59
GGAAMME ES D E V E L O P M E N T7 Video Games Photo Source: Bethesda Softworksthat boostyour Brain Action RPGby Cielo Panda If you fancy roaming a world while killing dragons, this gameResearch shows that video games is just for you. Not only does ithave an effect that raises yourbrain activity in a good way. quench your thirst for dragon blood, it offers you the chance Though a lot of us enjoy video games on a regular basis, to challenge your inductive some people scrutinize games as the reasoning skills, which is the reasons why their children are mis- ability to think scientifically by behaving. But a lot of the “gamers” out there are defending their ground hypothesis testing. by saying that “Video Games don’t cause Violence”. First Person Shooter It is true that some kids nowadays who enjoy playing games often show signs of misbehaving, but we can’t really be sure that those games are the cause. Research shows that video games have an effect that raises your brain activity in a good way. Ever wondered what games help your brain become more active? Here’s a list of games and their positive effect on your mind. Photo Source: Call of DutySPORTS This first person shooter fran- chise is sure to get your adren- aline pumping. From covert missions to frontal assaults, this game enhances your hand-eye coordination and quick decision making while you play.Photo Source: EA Sports This franchise has been alive since the mid 90’s and is still taking the world by storm. Not only do you get to play as your favorite basketball stars, you also get to put your quick decision skills to the test. 60
ACTION ADVENTURE Photo Source: Keen Gamer Tickle your mind with this exciting For those building enthusiasts out puzzle platformer. It offers a there, this game allows you to cre- ate whatever your mind imagines. variety of puzzles that require you From houses, farms, to castles! to think carefully what you need to Boost your creativity and decision do next. The game is really simple, making with Minecraft. Video games are not beat the game with only one tool. all that bad if you don’t play too much. It can even help your brainSTRATEGY function more make it able to organize thoughts easier. It’s fun to take a break and play a game, but remember that too much gaming can also hurt your health. PUZZLE Photo Source: Portal 2 Official Website Fans of this franchise can say that not anyone can play this game and be good at it. But you don’t need to be good at it to get its benefits. This game given to us by Blizzard Entertainment entices us to make very fast decisions on a fast-chang- ing environment.Photo Source: Blizzard Entertainment SIMULATION Soar the skies in the comfort of 61your own home. Microsoft Flight Simulator offers you a chance tobecome a pilot while giving your brain some exercises. This flight simulator enables your brain to calculate possible outcomes andanalyze those calculations so you can have a smooth flight. Photo Source: Steam
RCEATRATISL his has to be a shopahol- ic’s godsend. The worldsPhoto Source: J News 163 biggest shopping cart, Humungous Motorized T standing over thirteen feet Shopping Trolleys: high and eight feet across, was originally conceived Ideal Carts for Engineers by Robert Unnerstal, Sr. and built by the National Cart Company for the opening of a market in St Louis Missouri. The cart can carry more than 360 grocery bags and up to four adults in the baby seat at the back. Designed with busy lifestyles in mind, it is powered by a 460HP Chevy Big Block that propel its wiry frame up to 60 MPH! The concept was successful that National Cart built seven more that tour America! But eccentricities being what they are, the dimensions and practicality of the cart was not enough for Frederick Reifsteck, who thought the scale all wrong for the true devotee of the super- market isle. Frederick set to work on a few improvements and built a gargantuan twenty seven foot long, fourteen feet wide shopping cart that could easily swallow up National Carts pride and joy. It’s so big that its huge big block engine can only motivate it to fairly moderate speeds. Frederick’s achievement won him a Guinness World record and possibly the adoration of every super market chain on the face of the Earth. What a fascination of carts into “trucks”!Kartum:Your Grocery Shopping Assistant Say goodbye to the the store’s database to identifyconventional push and pull location of the products.shopping cart as Kartum by This ‘smart shoppingCharles Bombardier has revolu- cart’ also eliminates the need totionized your weekly shopping stop at the counter as you canexperience. pay by using your digital print. Kartum is an electric Once you unload the itemsautonoumous shopping cart from the cart, it will proceedthat is also a virtual gro- with the next customer in sight.cery-shopping assistant. It has There is no need tofeatures that will pick up the plug Kartum in as it rechargesitems in your shopping list that itself with wireless electricity. Ityou can create via an online walks along with you based onapplication, monitor your items the user’s preferences, may it bethat will be over your budget behind or just ahead of you.and even calculate the calo- Bet that this willries in your items. It can even make you want to visit theplan the best itinerary in the grocery stores even more.store which can link up with Photo Source: Imaginactive 62
Photo Source: Imaginactive CRL E NA NE WEANBELREGS YGlobal Investments On Clean Energy Totaled To $329 Billion In 2015A ccording to Bloomberg New En- China was said to remain the largest oping geothermal in Turkey. The plan consists of ergy Finance (BNEF), the total clean energy investor amounting to $111 billion constructing five geothermal power plants. investment on clean energy hit with solar energy as its largest funding. China In Japan, the Development Bank of $329 billion in 2015 accounting is likely to propel towards less pollution actions Japan and Japan Wind Development implement- 50 percent of investment from and less coal powered energy sources as a part ed the creation of the country’s first wind power the Asia-Pacific Region. of its 13th five year plan (2016-2020) to be im- funding at $423 million. BNEF Chairman of Adviso- plemented in March 2016. It’s National Carbon Meanwhile in South Korea, LG Elec-ry Board Michael Liebreich said that the figures Emission Trading Program, the world’s largest tronics plans to invest $435 million in buildingare a stunning riposte to all those who expected carbon emission control project, will cover solar manufacturing plants.clean energy investment to stall on failing oil 10,000 companies emitting 3-4 billion tons of From a well invested 2015, may 2016and gas prices. He even added that they high- CO2. be a better year for all nations.light the improving cost-competitiveness of solar The European Investment Bank alsoand wind power, driven in part by the move by allowed lending all over €100 billion for climate Photo Source: Gov Techmany countries to reverse-auction new capacity action for the next five years.rather than providing advantageous tariffs, a China National Building Materialsshift that has put producers under continuing recently signed a €1.6 billion agreement withprice pressure. Hong Kong-based Welink Global in the United Kingdom for solar power proj- ects and energy saving hous- ing in the United Kingdom. The European Bank for Reconstruction and Develop- ment and the Clean Technolo- gy Fund formed a programme to lend $125 million in devel-Photo Source: Gov Tech 63
BIKES BofiWbcsI pgBaim“saHootithD otthodc oba ct1oAacfbmmakftrdhI“ stseccwatyeTcwAwpeuiogtnnnooootrrhhhhhnpmMaoiWpooerraadrnnmvyleii8iirffffffffnrieesaaihsigeooanmilveeatkeerarmrdooaheeeeaeserreimiaeeenmpvvssyh5ldttcRsms1ftaAtoteehstnpcnsnuaoaaecsalfbbdoosennanrrttii’hhdudhhhituudeeiHorssdepfrs6atdipweggynoostltetgoosfeoethlttalytmpNmoousevgostaetecteilleaelpdseneiuzad5tjsoho.cjaoasnnoa,thrreftsrrtogactmwtPaeoeentnnuaiupsnenqouhtprdfiy,siteeier0lccrnhdluhrwsctowlh,emaphteeii.lntnPnllntnvnepbmrrtlsuflrteereswicsaersrsenfncieiyylecrranhaascgiirmtceeaapNeseoctnegg.utdieyOoeetnbiexebttarnmknaAreioo,iccrchwJogniesosTsimsastnoiteonenhrooh.r,iaicrO!!hafrestniigLereariarusmlliirephygrfaeernctiauicWtmeasmcsuchfetDHABJAuMdnwhteeftahognevaloemaoadlinNnenttfefctssehorsnt.nephdhooehemdnnrtr”glotoysa.uriclteTtowtinlJnAidvsea,gbrosyt.eyvcyygdnshaMptpeatancM?andtheopnhcrdaic?eaeosnEmoedoeTptertfJjg.aiNottrcdtciT$tpriasboffitabihadumo”areookvrsmcamfswobgmtibomeeahtioJblumh.taoohtRdteaNtloAayro3clCtsahstntabalifn.utbsioowesceetaeserssnrnhftbiierauTeTsleihblkornkdhwbeoaryo5tfefmsFoutkkemmaihiaebobth.tegsddsoeumdepbunbitoontgau!ttidsihttts.ieiihhstareruhjuse.f0rbLgwhdteevpUAsclsyihdbeehellkvtewaiyhulniuesutuoaufMapdiiNisnyieoenatealaaeseTibmn,iee.egttiehllemeiscpblseynsreeionnwt0ecTebistslihplctar.rmatelhLhisnvnasdarartsaYr.iihwlgeedaqamgeataynqhbteupltocgaVaeigc0abducrinCtviIlth3leeasnietuseeeycsaiseawTahcaerdo.astrouszlpuovthectunniLumhitoihorelsny0ioernorh0uhibttbootsrdkogybt4enlktetcrbsrciTawhnuomresannstfielrsoencrhhiaaruetcnydhgaa!ohicsglu0duyoaids?enirdaomiee.tiretysJyo,ootenesddhudehrfglgbspspk.tdtfNebtsaaiaeutx’aiieefaHdthtseasoieoTrtcstt-otstjleAattrtronmhhaisiitgWaeaiiisnpllnechuorrtnebe.eahbhrhmt,h.tihwoeesnlnrintskfevthltarrtnhdraogoaPaeoayoyinnrcntllgTaduahrhdpeeheesnieomeenkgg!yellitevat.nimorisneendstsbysit-eishyiethettr.ey-eoeed.dne cs-ldht-hy,d.yitreuoes-? Photo Source: WellhousBienville Legacy:The American SuperbikePhoto Source: Asphalt and Rubber 64
Denny, the Bike of the Future Denny is a bicycle that comes with a range of features that easily makes it the best bike for commuters in the city. Photo Source: Denny BikeO ne of the common factors to the ambient conditions. At the Photo Source: Denny Bike about most cities is the same time, it will take care of the unpredictable safety for the functional and visibility require- average cyclist. That makes ments of the biker such as brake cycling a rather dangerous signals, halo lights and turn signals activity. Apart from the among others. There is automaticomnipresent cars, a cyclist will have assistance system called e-assistto go up against buses, distracted which is capable of shifting gearspedestrians and the bane of other automatically. As they are activatedvehicles. In fact, these are enough automatically, it becomes easier todangers to make one give up on ride up on slopes and so on.cycling forever. We aren’t joking. It’s However, one of the coolestscary sometimes. features is certainly its handlebar.However, a nonprofit organization Apart from being comfortable, thecalled Oregon Manifest wants to handlebar can also be transformedmake cycling in the city a safer into a bike lock. There are even twoactivity by creating a safer and locking mechanisms. Depending onbetter bike. They held a competition the time you will be away from thewhere companies were invited to bike, you can set either a quick lockdesign the ultimate bike. Fuji Bikes or a long stay lock.won with its concept called Denny. There are other nifty little featuresOregon Manifest is now working present in the bike such as a remov-with Fuji bikes to bring Denny to able battery and a flexible storagethe masses. solution that adapts to the itemsThe bike is certainly an awesome kept inside. Its features certainlyone. For starters, it features a smart made biking convenient and surely,lighting system which can adapt Denny will be a hit in the market. 65
MINING The Biggest DiamondLibthoioummsdaehmeaadnd Just Unearthed As renewables and technology in Angola advances, the need for portable rfedLD m d pbubtgirpo 1dT(w S2aAatohaeesrrtr27frrauepiiihaneencrtooccaaauaioolctdleisscpmoooemmmgbhmuuocmvkuLiAenneouhvaphyanniudombdoooisnnretaulgelmrnddc3aldontinnniretchnoaeysghabane2yuvteotdddnUtd2recgmphie,ur%hW.inmon0ssSdoeoaratwriStsInefd0oIABNTdnthso.sedilt,ueDo2ifaiDsetatU7nwWchesieatiwnsoUr0ruAtattsadh.mou$dcn.eihesh4ocSwdr1rsema2oviaiSnenIctoe0eDirt5cdaiiptmm,dureh1sDfocghgdllc4moom.iaa2drlwr$4iasehvoohaiie.omEiona$el1oseo2.nd81nepmmllorraasmdnj8d,aa7vndr0.uevospainct’yat.ecdese.nioTc0s1iinhsfoha4wanddroxhfdnnrtengL,horonyeCnioe0pumie.ocgtd1aeudsc’rteuAyfcdsrs0rcaoluthcv0agnaroi’enfdtso:r0ssrslwnmolelr,eeohur.asamdelde3hdmo!arCvgscgisrtoTteeav7poaatleeeeooecrp8slrErpeghj2rnalsradcesveNolsckpa0aneeatOaeintrocwehcssirnshaamnhudsoonysrtga,ss.yeio?wyoetorergrestsl)twos’ddwfasrAseetfttyehnsn,det Photo Source: Forbes storage grows strongly says Lithium Australia. The diamond’s weight alone could cost around tzfrtpLgLmDpcp p1tbwo$letwL he2mpmhTpcbisliinouhhhpaorxaar103nttyyrrrraloohiiiaieeetttgoaahhoneearroooiopnt.01lddtrepeihhhscc3talbtlnrtwhdsiiddddtta5,xeyrramedereeuukiiis%tobaaoumoon.e.0uuuiuuuo.rdhprisumeetmmbDnfeinnelfiixx5Fsjmmmcccdoantedeaiohlelagatifagiib4tttinoneeowshoccoaddcr-niiiichtthc0e$wriwdooogJerttAAcoaetnreseeaietvnyieuare6nathnnnhiHTItgbniavecuuadivminwofnaairwt.hntrastleheseos5husoeresstrsnibooaruesst$bierotrthaba5attrlomrtee.acsWaets,iffodahy2$rreserastdyanebeogAxanmirreaaiccnmlbss91iclpnnrl$eedentitienalguysttxsloolfdaataade4rhaaeiis-opc1uco.midfihfmpittmwpaaatstdir,ttdgnerloiaeknc0eerttne3T’teelhiridesgeanteu,diereimekiuca,pabd6mrhcliooeeeea0drsesldhtirneflsnntmy2atisnfdiesinfheto0uedkPpdlteenieon$o.hadnG.hcc0rieiApsleddceosenos1ntyhlctacaeetidosgsomlheitimrupka4li-’vhcynmtitsneofnmmiottadonrhsee,rtdcufetneiht0acgefgtrhferanetodemrrnpaniarbtbroe0cihyarnanearoniuiat8nt ktade.een0esrantepodiiridxltt0maendneeetTcnbraliefoagnttaeipiesstst%ainpdaaytlaphnhIsdeeirdrs-peiliplnratrocilalAwdasilegeetiitsisreesokirpeeaasoiomuanoutnefhpid.eieeDlndueMGaansnhlPirchjrnrtftgnersecvcldmLiiieinuerbabhootcebosittneigauneiicgmxLcrepeo”htiunstahgdmrlemoljbnerw,godttithaeknnpggsreeipeelnedfhremthiiubaAaetnsinaifaafioctugergcspaietlithnhwaoariestutiutlwlbecsntnhadtchtblrrdmnntmuieyiifagniraiciioamtstepevoeatyuguaaslidntckar,tmieueriedise’ucrrbp,ehttunooinrnyalnmeescfidoimsao.emiolniorwthogeadieegannrmnrsrsa-siny-.k.f-gs.-t Photo Sources: USD$800,000. Top: Earth Physics Teaching Bottom: Market-Analyst “gdswMemfdva—iyWxreeiinheaaosrtcidinthmmieyensaeliepetdlmhsnfooshrtupwaognnifeaworevieddteBtcckneiihlssoticclidaaa.hoe”monrlellrceanwttaxnbkicnhetlnpaoeaslivdeunylurtvio6ulsdovutieirnhrittaereeaaeehgeinnmtslmdeisocdtogrropoefiteen8unh1htmcoahr0iapiaodfncses0strvvteigyohLezfLcaerogretuaanuoahyfrdtrlclrm…aeoaot—ethmst,ah-deoewlpAeoisuttaeloneonur--eds 66
Photo Source: ForbesFA S H I O N E E R I N G These man-made diamonds are synthesized from cremated ash-MTuarnn-iMngatdheeDDieaamdoinndtos:Gems es in memorial homes. Would you wear it?by Farrel Pinto“The diamond’s evolution has did you know that we can now make more ethical than the blood dia-ended” says the successful company diamonds in the lab that are as pure monds made out of child labor andbehind the man-made diamonds as the natural ones? exploitation.now trending in the market. In the Yes! You will need a carbon seed Although creating diamonds fromForbes interview of the company’s and blast them with hydrogen and our loved ones is a sensitive market,leader, Harry Burl, he detailed how methane gas to grow the crystal. Burl said that they have a specialhe have come up with the business Voila! Diamonds produced will be approach that us both intellectuallyidea and shared a quick overview of just like long lost twin of the mined and emotionally appealing whenthe company. ones! These synthetic diamonds can it comes to their customers. They In 2010, while looking for be grown in the laboratory for about are cautious in the process with thedomains to purchase and engage eight to twelve weeks. Some say that customer’s peace of mind as thelucrative ventures, he came across these diamonds also cost 30 percent uppermost priority.to a not yet registered domain – less than that of the natural ones. Diamonds should be asman-madediamonds.com. From But what if we say that they pure as their own content, the com-there, he researched a lot about it get these diamonds from the dead? pany says.and figured out to keep the do- Would you wear it? They are also producingmain for himself. After six years, Harry Burl says that the diamonds for wedding and engage-he is running the most successful company gets its feed from the ment rings. You can also order abusiness in the diamond making cremated ashes from the funeral conflict free ring with no personalindustry in the country. homes. Basically, we can extract carbon ashes. Designs and orders As we all know, diamonds carbon from our hairs and dead of these diamonds are available onare purely carbon based crystals and ashes. In fact, it is more economical their website. And I can say thatwe can get it naturally from dia- and environment friendly especially they really protrude adamantinemond mines mostly in Africa. But to anti-mining movements. It is also luster. Photo Source: Forbes 67
IS BEING “LIMITLESS” JUST A PILL AWAY?f dWowl‘owtrr s opf ilysrhoaaiftto,oiimtyhhbentlotsimlshieeoheasuriirrlittlemtibrolbhtechef9htlfrbuavepser0eaettrslenurhlif1.ap’dhosnfoctei0a,hevutnrsTTTtcs%irb.eomosoauihhtcOsrmn?eaceetbapabthnrhstriehnimrihenealtnfelasapetomiiaydtctsssroorooktehsgnachsacntlaiTtscnhumstbllodnhahullllsihpoeihmyoyompaemeteb,apwaeoralslnawtdulaiaeubiktaepepceisccghb’osyrscrpeh.neuvioaetptuaoeteSwowlabsoettlsyolisou1maechtsfneeunihiftwoer0iit,tdietmh.e’nsahdfnyv,ttr1meWnpeih9ntbeoieews0iyrtoatte0rnaaeiufuhyoinptibtraytp%plsatdnttyriouclnitheshpeol-ale?uoesom,icltrgrmrilnnsnwntlyNforshoctoaothsgeohtnuei-iomaegvh.omtabainsnaoopvrt.oniTitdtretdgeefcteow,oaeahdysueheinteidtee-nre-. by Dion Greg Reyes eNtycegy m pehotvvoelipailaareeguclmiotcrnnorcreyumalti,wuuootiscmniistsnevocgi.eetceerooha,skamdtamftilnlIWrstaeaenbooftsxdliihouomhinstwobihwnhaiacpieltated,clolridatetecltohnhroyooxydvied;sofurdomeedMuNbheslstios,ee,hnvwZopwyrlieegldmaTeoir-swnrtatu-bdhrpaof4ciaoieitarlec8nilBldsosok,fiatekrvlln:hhtnau?enhdpeoidsetWneiheroscnwevfeesoP’ocefseanoiptylrclnmailyroohn,uakdlpdPapeesnTisa;ra.nhi–d-irnapgean-nscd-- bpvbbtt udiherueoisvrealeeuboesnifwnlncpufi,utcdelaylbnydlslcouilcokouusattmnewsismaoesBpearaundoerdurbmsortbtnreteocyohapor.efitTotstcntlihhsolhohhdierannnoaaenitngbs.gpteeIw:rgbaotartewieohfiir1mnftuiieoh0dtn,lhrpp%odrifenourisd.lmoterguliomvsisceaseeiseanansabolntdlsgtmeisehoiyonsnneneofoolgt.ucihyttkBodoifaengyoeurn-greri- tflpioukrnoetrcdaatuincocsonefcdoiknratmgapinlinelolouftnrhso-mannteasculaflorpmorsnuboalrlielazcgienuldilaretleshpceteahlpilarso.tiIwcntaetinsor m baIbw1r crfeaos0reelcyeanc%teemoihjaasnu?uuiesodsoHecstfsareeaitrohymrdpheiiuateinaimvnwsrmcgONeeikbimnftwlaofrtiryloeonyiab.ihncrysidonsmtnageetsdtoot,httahytiatfwoetllanbd,ehmiprvhdetraiweihsueliswnwklgiagttt’bhothla.hrittetriibhi,etsttideypnhhdukeolgesneinituntotapth.obifdsrRilhiejdegtseoaihsudcdgccfueierthokecmsenhtnno.dt’unahtmtiobmoes–butliwyrsaotn. at4aH ptrifA Ampitebnneohhexnn8rrasflugdoeoaopztyt,tptseimeiuhvshtalobseanbnaareiiecerntrpeid-gareieaianwetadoenoomerhlsinepinlafneinwsn,aetdwtehovtbhighdfeesfrsesaofiibulr’atATeotuslnabinarfyohnvacblshrulroecobleprtBcgaGeuebiirlsecgrtmtniecnrrrcainaefopoyraaiogoaooodilsefnyimdlnintanrltgsyhnnstrlglto,snthtaeaufetsisriPwrduCsiyuteiilholidatinleliencnmhlihfaoCspibnlvdescnoobtitweiuseleonachthlrltgnaieliiph.etodeeeotnlre,SrTtdoreinfpevnveaghltrdoaroehraheemeltsenhrrbtsashter.naeuwateusdr-traaiunranprsagesymitiUatiidrcnticleamkathnaiheaeoinaimtlrnisneaoosr,nvnritae.dditvmanhpewmevsdaTa.anedreoratamtihenryyodictoirsNoheplsdhtftiaaosnto-ttroeZbyeorfyo,urer.lT-aeyats-.t All Photos Source: YouTube Screencaps 68
WirelessElectricityNow a RealityPhoto Source: Authorstream 69voe ekohentTm Suhhnnxeteffusaohaierpetvoerewgtettytureenuhileiepogetrnbsegebda.irynfmrlnehmemoHipgtmre.aircoayeneooonnToltsanglweufrhdhlo.TTrateladnaeTyeeiubhhsromsnicvthotrlmbreeteithecoheueeseaereIe.afctaerdp,nnapnositcnprtpnetioefhlehvesocsfilrtrwsiukierioaeowtgta.tntehngleymdnyTaeleareaeaslrirchctcltscno.iisesiioertsstottTtlpcaeineahelgtnsnehniaasrpthuekeagctrecooeeneecoelriefontndfceeSleaattiuenetrnposnshrithsartysehgaeesngtebeswoercceeiytoolergtfeeadeeawftaypcitwctmbswhrtlraotaalahoatranee.brirnhniertllgclsdhkdeseo-. egt pttpTtaogtmPerhhhaleenrrohiocaeaarootncwihntttttsijjtepthhteenoegiwerypotcc.irooarstoittiwtthSllnwhiefwolhiyooiestxrbglahsenrlooctgseytraoJbiueqfeAottbbwpmeoeugtdfteXarldhsiiiaeasea.smtltvAvonlenneatTtaehthldtteshsaainilhomewooolroekiaaaunmnpcfeipbmisagltoatllitoatsebhhemrhleitowlneys.yhedeeamoeSgeeceolodsnSllarctnefaprsaiprtiiboorwteyhastngahii.nlncpeeoctmanies.cneorsrotopDeekisweefaSwmayirawntoosecn.asonueneerltTetgaderen’rsnptihrgmesoleloeiyaamlg.centhhcoett- Jwtuta pbm ihgesooaeaeelwntottndtenseiAcrsmrgpysgaaeaotghaiithewhnmpnbcoufenaaprlaleaemeptscootnoTTryshyfwugisbtiiehhuesfconyne(swraeirlttJJeeostvdosrfaAiihinonmneeawsnwipasXsrncggJaacattaiasftmhnAbeostviohtmpotnleovet)reAaeaihsteiannsnhatit.tsere:shtoelkeotaretmeaaeafsvosiudglinrreeenrsporhegdspcwfcsersnseatutceaotwutvtiretticthd1ciebiureihecmnscaa.unyrb8oettptEectteeefhusi.kwhtoixsesifetrsAiwtepfontihlcusuylohlnnelaaeco-lw-eitdrblhfororylihtepavffh-oee
Photo Source: The Discovery Education 3M Young ENGINEER CHICKScientist Challenge This GirlPhoto Source: Business Insider Invented Something Awesome For Her Pen Pal Hannah Herbst won a science competi- tion by inventing something, which was inspired by her Ethiopian pen pal. While most of us engaged in challenges: yielding new solutions activities that were appropriate for by using different 3M technologies young teenagers, Hannah Herbst got and building new technology while inspiration from her 9-year-old pen applying science and technology pal in Ethiopa and designed a probe concepts. that generates power and fresh water Eighth grader Raghav from ocean currents. Now that’s Ganesh won second place in the something we normally don’t expect competition. His invention was for a 15-year-old would do. people with Autism Spectrum Dis- In this year’s Discovery order and how it can monitor phys- Education 3M Young Scientist iological and environmental factors Challenge, this young girl from Boca that may trigger their meltdown. Raton won the title of “America’s Third place went to Young Top Scientist” and received seventh grader Amulya Garimella, $25,000 USD. The competition was who invented a system that monitors held at 3M Innovation Center in St. EEG brainwaves and alerts users Paul, Minnesota. when he or she is distracted. For three months, Herbst As for Hannah Herbst, and other competitors worked with aside from saving some of it for 3M scientists to develop their own her college funds, she plans to give inventions and showcase it during part of the money she won to her the competition itself. Herbst was Ethiopian pen pal and the other part paired with one of the compa- of her money will be donated to her ny’s corporate scientists, Jeffrey school. Emslander. All the finalists presented Isn’t it amazing how these their inventions in front of judges young kids are making a difference such as Science Channel’s Outra- in science and technology? Hopeful- geous Acts of Science star, Hakeem ly, more kids would follow in their Oluseyi. Aside from their presen- footsteps. tation, the finalists also had two 70
The #ILookLikeAnEngineerCampaign Wants To End GenderDiscrimination in EngineeringSo, what does an engineer look like to you?by Alice Hernandez be ettipdwt cattbtiertnnneoyihhhetinnriiiieoaatcpllcsfeerggeefllphTnfylphotbbseeelrmiifuuawyeounn.morootbcwvrtoeHngpeeribaaioyeitannuhmeehsnrrtistmwelslstdderrpeooeglrphwsosrbcsspmsoubl,efoalrochoiaoaifoafGTAtnwrtikwtarelcaonlnihwhtsoShog.lmdasierhiuibivoarciwietndtsetesinndulosenhlehocsdosgebwdtnteidarahee,dovootFiefertglnhnaliueSoththnddrrlleestkoodebeoriasnoaahspn-lsredapwtontwiskdehrereieiscittmatcnaenontircaaeoyhlspwrnoicaaim.vdoagtsnduSkeeeditgeecortaneiisoceg#erioVlr–raaad”phneiepgniw.dicrwllacoto–ngcrllotoobsoeleaoslthsadelouenwtruynmpethurwnoaeeakenpyzerdihprrVugrdmlrhez’nsedgsiliiismdaaekyo.toneentwarue$lediDhefstelenngsewtn5eaesagefpceeo,neoddse0yniuotrrutsu.rmtos,hsicehoryp0etmTtntornkroafses,a0iahehotwt.pfgsroi0ltfeeaiueneeehoieotnt-sthg-aerenihenh-d-e Really now? Can’t #iLookLikeAnEngineer a girl look exactlytWoodfiscamrhparftiodhtaprhhaimetetcegneuartlnreeohdrtehectiiasInsnosehsemgigwmxesaiinapnaaWwpfltweeseeearcmeetranoetrhnnrnytsateeegeo’lgstneetcoii.rrrnenoeSeeshamenccMsoegegremilprruiipnesevnadie’eetnhteaiidehuenyeatcrtar’mtgshe.lvoocnSace,datbtotastmqiiomehmevoufcmeepnpoeebra.ispasmaneiStiigtcxitsgoeoykntppn,on:lpiria,ireennassedsrhhdsateehnder the way she wantst thheesb a lnitweieybkeeoq-?rloseucidse?ueusa”vatttn“DIitenfohdDeynoderehosonleumyiIplngpyaoiinnoiocnuuvnsrslugiwdteenreeeae”sforydeprseooetesderufflifey“ntitpwaesteoeshdact“hhthwhsooeaasleuhpatwidanol“sptidyapcnvaerroonealeeofooart-pdesokillk-y-e to look and still be an engineer? News flash: It’s 2016. Female en- gineers exist and we don’t have to look like Mark Zuckerberg.Photo Source: Goodnet 71
72
10 Yummies to boostthe Engineer’s Brainby Cielo Panda 3 Peanuts and 7 Sunflower seeds/ Peanut Butter PThuesme twpokcoinntaiSneaedsDo you have a deadline at the office 4by 5pm? Did you study for all 7 5 Who doesn’t love to snack healthy mix of omega fattyexaminations tomorrow? What about 6 on peanuts and the classic acids, proteins and B vita-your post-graduate report? Whether PB and J sandwich? Yes, mins, which aid in givingyou are an engineer at the office, a peanuts and peanut butter you additional energy.post-grad student, or a still a strug- are high in fat, but they tend Depressed? Though small,gling student-slash-engineer-to-be, to be a source of healthy fats, these seeds are loaded withyou will need all the brain power you and they are packed with Trytophan, which the braincan get to perform well throughout vitamin E. converts into Serotonin tothe day and finish all your tasks with Both foods may help keep boost you mood and com-flying colors. the heart and brain healthy bat anxiety and depression. As engineers or engineers and functioning properly. A handful of these seedsto be, we should be aware of how to Other good choices are will give your daily recom-take extra care of our best buddy who almonds and hazelnuts. So mended amount of Zinc,analyzes, crunches inhumane num- don’t be guilty and bring on -a suppkement that aids inbers, and solves our daily engineering the munchies! enhancing memory andproblems everyday—the Brain. Keep your brain healthy Dark Chocolate thinking skills.and sharp everyday by snacking onthese 10 healthy yummies. Ohhhh— the temptation, Vitamins the creamy bittersweet1 Beans and flavor, the chocolatey good- 8 Certain B-Vitamins such Legumes ness! Studies have shown as B6, B12 and folic acid that flavanols in chocolate are known for reducing Fart Alert! Beans and improves blood vessel levels of homocysteine in Legumes are top sources function which in turn im- the blood. Elevated levels of complex carbohydrates. proves our brain’s cognitive of homocysteine can cause These complex carbohy- function and memory. Dark higher risks of stroke, drates are also mixed with chocolate is also known to cognitive impairment and fiber, that’s slows absorp- improve mood, can ease tion, giving us a steady pain, and is full of antioxi- Alzheimer’s disease. supply of glucose for the dants. So indulge! Fish brain w/o spiking our sugar levels. They are also rich in TToomamytoae—totomaahtoe… 9 Tuna, Milkfish, Salmon, folate a B vitamin critical to 10 Mackerel and other fish brain function and omega These red fruits—yes, are very rich in heart fatty acids. they’re fruits—have healthy omega 3- fatty lycopene, one of the most acids. This also includes2 Coconut Oil powerful anti-oxidants that Docosahexaenoic acid give numerous benefits (DHA), which has a vital Even our body needs to be to our body, especially role for the optimum “oiled” once in a while. Low the brain. This could help function of neurons in levels of fats in our blood protect against the kind your brain. So grab some can contribute to depres- of free radical damage to fish and go for some sion, Alzheimer’s and cells which occurs in the sushi!!!! Dementia. Coconut Oil can development of dementia, help raise good Cholester- particularly Alzheimer’s. Dark Green ol levels, weight loss and Leafy Veggies combat Dementia. It acts as Red Wine an anti-inflammatory and Veggies like Spinach, has been linked in helping Studies show that people broccoli, and kale are prevent the onset of these who moderately—take very good sources of vi- brain disorders. note *coughs*— moderate- tamin E and folate. Green ly drink red wine and other leafy vegetables lowers types of alcohol may be at levels of homocysteine a reduced risk of Alzhei- in the blood. High levels mer’s. So sit back, relax, of homocysteine in the and have a drink once in a blood may trigger death while, but remember, even of nerve cells in the brain. too much of a good thing is So let’s be green and eat bad. *winks* greens! 73Photo Sources: Beans: Suhanijain; Coconut: Paleogrubs; Peanut Butter: Marianne Gutierrez; Dark Choco: Britannica; Tomatos: Zikoko; Red Wine: Paulnoll; Sunflower Seeds: File Magazine; Vitamins: Celiac; Fish: Bali Indian Restaurant; Vegetables: Ways to Go Green Blog
O IOLI LI NADNUDS TGRAISE S Benefits of Cheap Oil won’t be felt anytime soon Petroleum In- tatfbddam hPbs lmiebenrhhidrgiraroaenaagegaieeeoorvtwdcdbkrrar,pewdUbitok-ieieknnwupnni2egloellntf,.roeing0gohhtftnntiiuehw1,etnnherfpdrgemoeafo4ngeeeeie.d$inr,utnrtrWITRmdhst3tdIrbgSifchchno0hnoaoethletaoeitaviavwclegfhthassneyufcehtee:carpuneeaykonbnswWhottsagrmtefrsattbgemmiileairtatrhscltinayohoryrnrleeetyeptel,lgece1hc7isshxddnwAtlkfh8a0oispw.e.ortospteen%miTmaTomfraocllch$u?ohumrehrcarte1aasotellvorismlirioerpi1dsesuneecrnigkrg0dp’c,rimsd.mtociesiahtesscaeettihnaenasnehaioetdse-slge-niel tptAma sBcIo naHoq dwoineoblirueoovucrhelnisnoceceemstsctytpilhaiotuscaoioiwitrsttdnieddmrnitruoricveensddooeyocstcefaepteneil.neieofyurAnlafdyelse.fafolodcgpoees.moetortfB““eeralrdwtoiOIiiitdrtoeneltcIfsnihssrhnmcegapn’wiAo“ieannasttctrfimei?aiuetnaUaiettnmtrc,hsnsttgIlniengeShtstoemeesweeesa,atemol,etrtPfiisteaihkUedmwcidso”baesao,eoeemnteaoyabUelnppnec’ntsdrilsreajoelfodbiliueoisoswoltsmnmibegeo,sdriEpid,ietteactnnloeyiltchaoo-lbvehia..”roentwnbeebeaaw-.eoltnrae.o”e- vestment are going down, the manag- ing sector is sinking, and the stock market is dropping. Photo Source: Eugene-orGet Gas From Plastic WasteA plant situated in Hong recycling of plastic since the Ecotech Produces Usable OilKong has invented some- year 2007. They have found from Waste Plastic Bottlesthing very cool. They have out that more than 5% ofcreated a way to recycle the oil production in a year Photo Source: WSJwaste plastic bottles into is used up in the manufac-usable fuel. This is part of turing process of plastic. Thethe Plastic Waste-to-fuel impact in the environmentSystem of the Hong Kong of the carbon residue ofPlant. The workers in the plastic is also very danger-plant imports some plastic ous. This is the reason theybottles from Australia. The looked for different ways torecyclable plastic waste will recycle the different types ofthen be segregated from plastics materials. This com-non-recyclable plastics. pany has joined hands withThen a prototype machine is many other organizations toused for condensation and fulfill this purpose. They alsopurification. import plastic from different The Fuel oil is countries in order to recyclecollected from the plastic them.before the process of puri- Through this process offication and sedimentation. producing oil from plastic,The Director of the company the company is setting anEcotech, Mr. Cheung, is the example for others. Thisman who suggested this pro- company is contributingcess. When the oil is refined, to the sustenance of theit is found that it is suitable environment. They use theirfor using it as oil for engines power to help purify thethat runs on diesel. environment. Thus, they are The company doing something that willEcotech, based in Hong help mankind in generationsKong, is famous for the to come. 74
Photo Source: missopenPhoto Source: CBC Photo Source: E15initiativeLeonardo DiCaprio Attacks On“Corporate Greed” Of Coal,Oil And Gas IndustriesThe Oscars Best Actor front linernominee, Leonardo DiCaprio,criticized coal, oil and gas indus-tries on his speech in the WorldEconomic Forum held in Davos,Switzerland.As a recipient of the World Economic Forum’s blame for this devastation squarely at their feet”,Crystal Award on environmentalism, The Rev- DiCaprio said. The audience applauded after hisenant actor, Leonardo DiCaprio, 41, criticized convictional speech.energy companies on corporate greed and He also praised Amazon CEO, Jeffdemands leaders to support clean energy during Bezos, Facebook founder, Mark Zuckerberg andhis acceptance speech. philanthropist and co-founder of Microsoft, He said that corporate greed shall Bill Gates, also a staple of Davos for pledgingnot be allowed to continue as they control and support in building a zero-emission future.determine the future of humanity. These entities The Golden Globes Best Actor alsowith financial interest cater destructive system announced that his foundation, Leonardoand cover up the changing climate according to DiCaprio Foundation, will donate another $15the DiCaprio. million to support environmental projects and “Enough is enough. You know better. asked business front-runners to help battleThe world knows better. History will place the climate change. 75
Photo Source: Science News Astronauts’ Pee Turned to Energy and Drinking Water bfhToeoarcspotdrrmaeenvvineeslfngootprawmepdaritnoaegbrtlruseehmraiotnrmietnaeigsnnpettsoapcfwrreoo,acmNteeAsr.sSAWhen we think about space more useful than simply ejecting component will be pee. As for theexploration, we usually end up the waste into space. Their aim is scientist, they used wastewaterthinking something along the to develop a technique that can from the shower and urine andlines of Star Trek. The immense convert the pee of astronauts into processed it with forward osmosisexpanse of space filled with drinkable water and even fuel. Be- to separate urea and water fromundiscovered planets and solar fore you get all disgusted, remind the contaminants. With the helpsystems is certainly a breathtaking yourself that this technique can of the new Urea Bioreactor Elec-idea. Few consider to imagine the be potentially lifesaving when you trochemical system developedless glamorous side of it all, such are wandering around in space. by them, the urea was convertedas waste. However, for the guys at After all, there are no water tanks into ammonia which is furtherNASA, it is a crucial point when in space where you can refill your transformed to energy.it comes to making space explora- water supplies. This tech does have po-tion livable. For this purpose, the tential applications in space. After According to scien- scientists used a specific wastewa- all, it will enable astronauts to gettists, the human waste generated ter treatment process known as an additional source of water ifduring any space journey is half forward osmosis. When com- the supplies they have onboardof their total waste generated. This bined with a fuel cell, this process prove to be insufficient. However,includes trash, used food cartons, can be used for generating power. it can also be used back here onetc… Therefore, they are trying That is actually cool once you Earth for processing wastewaterto come with a solution that is get over the fact that the major into something more useful. 76
EnergyTHE SEARCH Industry NeedsFOR AN ENERGY MIRACLE! To Be Photo Source: The AtlanticTransformed Quickly Says Bill GatesPhoto Source: Wikimedia Bill Gates is on a crusade. stuff stank and was highly flam-Photo Source: Business Insider He believes we must mable. If it slicked on the surface accelerate the world’s of a river, hot coals from a transitionfrom carbon paddle steamer could ignite it. based energy to a much The unsightly byproduct was more natural and eco-friendly ba- gasoline, and when automobiles sedenergy, and fast. This is, if we and airplanes were invented, a want to avoid the worst outcome consumer market emerged for- of a worldwarming by up to 2 de- Rockefeller. grees, every 10 years. To make this In an interview with possible, he believesby 2050 the The Atlantic, Bill Gates believes wealthy nations of China, USA the best way to stimulate inno- and Europe should not be adding vation is to fund it. With this in any more carbon to the environ- mind, he has pledged two billion ment. A very noble sentiment but dollars to assist in researchand how will you change an industry development toward a number that accounts for about 30 trillion of causes, mostly for environ- dollars a year? mentalcauses. But will this be Bill Gates believes the enough? My suspicion is probably rate of technological innovation is not. Thankfully, there are more slowed down by simple eco- efficient technology that con- nomics; there is simply no profit sumes less are already available in in innovation. It’s simply better the market. This may be a good to follow the “tried and tested” start. In recent years we have seen methods that everyone thinks will the development of LED lighting, result in the ultimate aim, and more efficient cars and planes that is profit. Perhaps in order to and of course the commercializa- seek an answer we should look tion of electric cars by one Elon back on how the problem was cre- Musk. Bill Gates may serve as an ated in the first place. Back in the inspiration to everyone, especial- late 19th century,John D Rocke- ly innovators to help our world feller was looking for a use for an through creating technological unsightly byproduct of kerosene advances that are environmentally production, which was usually friendly. discarded in rivers and pits. The 77
CAMERASPhoto Source: PetapixelUITNHSETEHSLEA3RW.2GOGERISGLTDACPAIXMEELRSAADntowipO ombtntLltegtctLCmtonueihhhhoniffueuSiaohilgepcystnoeeeemcleerSUcbmniptaialtvggoorsoTlrholcylitpabnpeagciiecoubmnainepaepcri.sooeyaiaifmaemxsvSsstvethsTrenpalrrmtuCeeyarehitmahrreyAeelasthcnsr2oocsurbsarenehiotsersf0aafe.ihosanvTHitneciototendtjon2Ytppei.ietchrfottcsrivto,cinw2oooonBtrfaeshaeorpyoeaswoisi.rsumsnniocoiftamstDnverfltbudtLrlozoihrethoaaofrrllauDEecrSeetrebSroefhcvrlrayamvetsGovoleudcr-npSeearebSeycne6uiomitaepwainS’nrdTnaryaeushacus0nRnknfbyod,vootgwnriiarieioreilsgitauoenosfnsteeypghtluarmdnviifhitnietsmstycwnitnatnyrleaottle.oggloyepCerldtginhiilttsagaynTaimehmicefas.aheegsvnecbaeklottbneatardNbelTisnohoce3reiprhedeeyrcanltletteiyanhetrnendneil.prhoreeprrcajoyoctorblpsakTeeurewseneLespiskihuacAnfieionsttnsPuhkssnwoxmiapo,apaogstEic.tmvssyaptaoenhertfnprsaiiosThApanahiegpcsnplopfededtoifNas-pltlehrehteeche.rrvus!wosecitwacha9breorof3taaTtoaaelcHnrSroipemrgef.e0hiyittmd6namnaltohticyoystrrirTyseoattiuipbockmetfoibnini.ismLlith.asbohwsne3.ohinclednceoAostaanTmSwpyereTiif.nsaefeaseip2wnn-soSdohtlossthvl!ieoi-rg-Thlsrena-ee-lereyerae, Photo Source: Daily Mail 78
Photo Source: Simplebotics TOYS Each block is enabled to do different Photo Source: Scenester stuff. There are sensors for humidity Photo Source: EEDesignitW e’re used to build and proximity. robot stuff with The bricks can be connect- Lego, way, way ed by placing them on top of each back to our other. Wheels are provided with a set childhood. Now, that can be used to make the robot a smarter one move. The Lego adapters enhance thecomes anew. A Lego-like thing is looks and functions of the robot. Youhere is to help you construct a robot just don’t have to bother about anyand understanding how it works, it’s wires or magnets at all. Building acalled Robo Wunderkind. A start-up robot has never been so easy.has devised programmable bricks that You can even connect itlook like a Lego so that it can teach to your Android or iOS device withyour kids how the codes and the Bluetooth. After this, all that youalgorithms work. have to do is to drag and drop the Different electronics have block in the app to generate simplebeen embedded in the cube. Then, algorithms.you can very easily program the The thing that sets Wun-device by using your smartphones derKind different from all otherand your tablets. The CEO and the programmable modular robots is thefounder Rustern Akishbekov points simplicity of it. The cubes are in dif-it out that they have made very easy ferent colors and patterns which givesprogramming language that will be them an exclusive look extremelyunderstood by the children very con- attractive for the kids. The basic costveniently. They will not use all those of the kit is $149 which will give youcomplicated and tough program, they nine cubes.can just drag the blocks and drop it. Now, you can surely say What are the things that that building a robot is child’s play.you can create with your Robo Kits?Well, you can build a lot of things. 79
SMolaasrsJPaivopewaFnelroBPautlRiEailNEntWnABgaLtES Japan’s electrtohneicwsomrladk’selraKrgyeosctefrlaoaCtoinrpgosroaltairopnohwaesrrestvaetaiolend. Photo Source: wccftechThe Japanese are seemingly megawatt hours (MWh) every floating these panels on water working hard towards year. The station measures 333 come in the form of energy innovation. They are being meters in length and 77 meters efficiency. The cooling effect of highly conscious towards in width at an area of 25,000 sq. the water beneath the solar cellsenvironment after the Fukushima meters. The electricity produced makes them 11 percent morenuclear disaster in 2011. In fact, at the plants are planned to be efficient than those on land, andthe country is now more exem- sold to Kansai Electric Power Co. with the shade that these giantplary than ever. The country’s in Osaka for about ¥96 million panels provide, they also preventelectronics maker Kyocera Cor- ($780,000) annually. evaporation and excessive algaeporation has revealed the world’s The company said that growth, making them environ-largest floating solar power sta- the product is not just ty- mentally friendlier still.”tion, claiming 11,250 solar panels phoon-proof (due to their sturdy, Another advantage with thesethat are fully waterproof atop the high-density polyethylene and systems is that they are remark-water’s surface. array design) floating solar plants ably hard and can withstand The latest “mega-plants” but are also superior to their winds of up to 118 miles perat Nishihira and Higashihira land-based equivalents because hour. They are even earthquakePonds in Kato City are the works of the cooling effect of the water proof.of electronics giant Kyocera which allows them to function If Japan really aims atCorporation and Century Tokyo more efficiently. switching entirely to renewableLeasing Corporation. The work According to the report energy sources by 2040, thesehas been completed in seven shared by Korea Water Resourc- floating solar panels could be amonths and can generate 3,300 es Corporation, “the benefits of large step in the right direction. 80
India Photo Source: The Higher LearningBthueildsLargest Indian economy is all set to lead the worldPSFlooowlaaterirng with the world’s largest floating solar pow-Plant er station ready to be installed at Loktak Lake, the largest fresh water lake in North East India, inThe world’s largest Manipur. A 10-Megawatt (MW) plant was installed infloating solar power December 2014 at a waterbody in Rajarhat New Town bystation is now installed the city-based Arka Ignou Community College of Renewableat Loktak Lake, the Energy. It generates about 10 KWP solar power each day. The newlargest fresh water lake plant at Loktak Lake in Manipur is a 100-kilowatt (KW) facility and isin North East India, inManipur. already yielding encouraging results. The floating solar power plant at Loktak Lake in Manipur is all set to become the country’s largest and only second floating solar panel installation. It is installed at the lake near the Sendra tourist resort of Loktak Lake and will be implemented under the program for off-grid and decentralized solar applications of the Ministry of New and Renewable Energy. Aside from helping the Manipur Renewable Energy Development Agency (MANIREDA) in the finalization of work orders, the col- lege will be providing the requisite technical assistance such as fixing the detail design parameters, drawings and specifi- cations for the project. With only two other countries, Japan and Australia, having floating solar plants, these are a rarity across the globe. India is now all set to be in the league! 81
Photo Source: PocketnowHow To Disappear fromthe World Wide Web NWoetllr,eyaoluly.can’t.A few years ago, my credit card still protect ourselves from trolls whocompany charged me a huge bill for would want us to become victims ofsomething I never bought over the doxxing.internet. When my mother called me One way to protect our-to confirm the huge purchase, I was selves from doxxing is to improveshocked. As soon as I checked where our social media privacy settings tothe money went, I discovered I just ensure that only our friends know‘subscribed’ myself in a porn site I what we’re up to in our lives lately.never even go to. I had to go through Also, using strong passwords anda long process of clearing out my using multiple usernames and emailname out of the mess and ever since addresses increase our chances fromthen, I was very careful in using very getting doxxed. As much as possible,personal details on the internet. I we should avoid putting a lot of verywas a victim of getting hacked and personal information in the sites thatI’m sure there are millions of people we use. Make sure that all the sitesout there who had to go through you visit are safe and not shady.the same ordeal. Some even went Wanting to disappear fromthrough worse. the internet is never the best solution Anyone can become a to stop doxxing. It’s not even possi-victim of doxxing. It doesn’t mean ble. No matter how many accountswe have to hide ourselves from the you delete, there will still be traces ofinternet. Even if we try, it’ll be hard. you found somewhere in the worldWe can’t easily disappear from social wide web. So, it’s best to limit whatmedia. We don’t have to purge all of you post and protect yourself fromour online history. That would be a malicious attacks from hackers.very difficult task to do but we can 82
It’s ‘Her’ in Finding someone and having that instant Photo Source: Futuristech InfoReal Life: spark is hard enough these days. Most peo-XiaoIce, ple really have a difficult time finding “The lose jobs, break up with someone or wheneverYour Digital One” for them. For some cases in China, they need to rant about having a bad day. WhatGirlfriend some people decided that it’s better to fall makes Xiaoice interesting to people is how she’s in love with a smartphone program. You a good ‘conversationalist’. She can crack jokes,Csthmhisainratarpthhifaoicsnifaealllplyeroningitrnealmlliogv.eenwt ith heard that right. It’s ‘Her’ in real life. tell different stories, recite poems, update people ‘Her’ is a sci-fi movie about an intro- about recent events such as the winning lotteryby Alice Hernandez vert guy named Theodore (Joaquin Phoenix) and even uses emojis in her messages. who falls in love with Samantha, his friendly op- Concerns about privacy have beenPhoto Source: Shanghai Business Review erating system. Just like in the movie, thousands raised about Xiaoice’s ability to remember things. of people have decided to make Xiaoice their However, Microsoft was quick to respond that girlfriend. Xiaoice is a mandarin-speaking chat this smart chat box only remembers information bot developed by Microsoft with more than 20 about its users that can be used for future refer- million downloads. Microsoft even reported that ence. It has a company policy where unnecessary its users talk to it around 60 times a month. Talk details can be deleted right away. How about the about clingy people. intimate details of each individual? Do they count She has a sympathetic ear, a sense of as unnecessary? humor and can even remember details about Xiaoice is not the only smart chat box you. Xiaoice is even available to her partners all that’s talking to a lot of people these days. Less- the time. She might even get ‘intimate’ with her er-known apps are also around. Some of them are users. People can even add her on Weibo, China’s even therapeutic for vets suffering from PTSD. version of Twitter. Others are just humans pretending to be bots. A lot of people run to her when they With people using apps such as Xiaoice to experience ‘love’, does this mean it’s harder to find real love with humans now? 83
MechanicalEngineerturned Chef:Dave Smartby Robert BagatsingFor David Smart, Photo Source: Devourfestswapping a lucra-tive Engineering Hcmk mtAwmareadwSrFati stttofw“tnooorhhheeOoxfusmpnriwtieahtsauluooeaaoupesefmgWeeolnsttdattriahgnosslnnneranmhiwn,etettwryvlIhyreruutdodiiemmattekoaiwsnmdlrm,h&tlsdohe‘cntedfEfiofagyaaiopanaeafnvsueactatmhtevyksCrnsoyillcpemiupghnpu,newel”eiasieiullnmepiaeenularphetnoIStcelta,esoaorelnstaoyvrglt,mvetyatn,IcatysvamfpleithttNhyeioiahiitssdwsiretorndnrlnoaiatin,aamrsaseae.mteoSnnrtennoethcoltlndwOesomctmfvtkwg,caoyauoy.htmroexiiaidaerksaatsttonacmlsyhcewa8eehiidyydrueoaycIiSmcczeharouhotyyapc-d,ooleep.tlraeoectttl5iasoaoodbwoiraeniauov,frFjhehsndolhoabnnteeouuuvoeueewnf“jeuvnoheytankeo,ootagtgmebsnphlrrtitetaaagrvenoeiaIka,abphf.uetltkoifwlacbllleiydhtri.eaietAsairlykltfenmenojwtsnfdtukfueoanviaemotiomioetsccteearssisanatcusnmethyd”abraoonhehhpnitevlibktrcge?diygeaanormjoxilidteiiteeddepheoutxosnaetnhrniiFescfk“ha,tomnmcaaautaistsvetctguDascsgirirntarihuayirttyhistntensahonvehdnetrntaeeetegpstil,fnaoih,tenitmmogeonyadshgotdnohvlnIoute..naeougreeoiehotgdcssidsslrteeheycareer for a riskierculinary adventureis all worth it. SlscAwn tStoni atihaommneoonnhtieoectdnhgedaarkedernurrtoiofatittdhnafrhfhsufwdoiaggyietdegtcemho.,o,hr”ute“yeecuehInlsohhSShtstmlihwjydtuemmsnaio,,senooowsystsaaa2naagtoitresrratr0ylkedesttkasltussseyohnwia’,.ti”peadtnnhdeI“shmbaeTgiybaemoyrtconhnuionsapouottmiedtauositcnentfsyIegsrihotycE,eaktrphmroemawhdnamsehrushfaagaeaoaaettretkisihdsslfsanttmbefehoaebtare3“oh.nai”nwioaef0wsedeukrutBfsInaeyohirl,ijtsnunldanore”.gtcgybgn-..i.- fA&m wtSrymdsaac hrgsattwoooheetetoncoooiaarhhssftoooeoaclCCuis,dftn-ttlnaataekdnishaaabrlmcoedttlphghabuuteIauanliroshhmttaneinoorrcbdeelfftnnslioaatkseirdmrdwfasaonttnnainal,cucoDkyiannahotaaletttiSketsetirut,eelunrcSCIevmetBthajclssw-naetthhryocmrtelruomoeehldrsh.syeaebeash,Jdtmetm,,emirabrusfaaoctiimveedftauetrecnhrnuoeesnsect.ObtDoihhlteulprannnlitbWpfleaai-adanfhstaeaentbtkurtndtotsnnmfuaaImdc raa“gwtsiauattSiesrevciehgaeonnieaahcostmcBmi2twrnlllodmtyolniisnnoemrwwnacollaeripiklusaiesueoaa0soAu“nfsmfts-odiantanlha2iwntSteiteslepntualvdimfeqaey,aolidwtlt,hgomeyitstp,suc0itmsayrersyirt2ncko.uehholftaseisttCwr.lfteg,pevt1odeltvefvorhgAon0lsheetuooeenaw,p’eoial”oMssarIneiena2oto”ehnou.iiuhe1nrvtgoertou’dartntvthwsic:thtdsnis,Dtitolaydol4eehghtitvmryamihtnw.egedthui4iHhmghin’Tteiecefihnnsournoo,hesnoaiixIepathamt0iecareemcitnhheepamfurdeatsresraFtsuolytntssrrcs,iDvuhadumek,afayrgtapedqsterpos.eihtrmeoehsptetlrpecheae,ldmylltayttsootiuvaWeaaasgneiilsoiwipeottthamtrdiahsteoktn-pwvnsrpsentteitaotyhaeorevetho.-nelderiiteenwenenaesrlgiatitiln-eveeeoetstefefds-sl-wm-th.shl’.teesrfy.reeo tonb atets“yrhpIxrnocat.”eoiitovfswtykHftethiyeneoawlei,nn”sccsibicriasnssudeerahtdi,perycoeoetun,”e“dnhanSAgtStteematghopfmhltohlbaaeemeefoaprersnyttrudeamhwj.thorrs“ow,sreeayyIabisrtdiaayetmetuwgnhhsdtgme,edaaouai“rstblnatIyrilfrhhdfiiesedeesaeieltwabsesgttlkwcoeeposyhi-ffooldaweoouetrdrerehpalfs–edsmies.iee.n”cotspbhtgfy-se Photo Source: Nova News Now 84
Meet the Guy Photo Source: Twitterwho Designed Photo Source: Mirroran AirplaneWhile Drunkby Ems GolenthaShwoisimesfsrgeoiutmehyniedngcosga.tmdreuonukt wafittehrw e’ve heard of stories roommate’s drunken state of bril- Aside from Keith, about students acing liance, He tweeted about the things Mark’s drinking buddies that night their exams while they that happened that night. witnessed him design his airplane, are drunk. They can According to Keith, Mark asking for a pen and paper and be amusing tales at got drunk over vodka and rum, working on the ground. Later on, he times, but this story then reached out for his textbooks grabbed his aerospace mathematicswill amaze you. This US college as soon as he arrived in their room. book and left the room to go backstudent was able to design an entire He then tweeted a photo of his his place. All of Mark’s designs wereplane while he was very drunk. roommate’s work with the caption: written on a notepad, a whiteboardWhile most engineering students “So my roommate came back last and a graphic paper.have a hard time passing their night and doesnt remember design- When asked if his designmajors, this guy easily designed a ing an entire f****** airplane.” would work, Mark said that it mayhigh-speed plane in one night. Alcohol does have a way work and clarified that what he Keith and Mark were of making people popular. Keith’s designed was an ekranoplan, a highjust average students studying at tweet went viral afterwards. With speed aircraft that can float aboveMichigan Tech college until one over 64,000 retweets and 110,000 water.night, Mark went home to his dorm favorites, Mark became popular Mark just proved that somethingroom very drunk, designed a plane with his stint. Mark even made productive and very amusing canbut woke up with no idea what plans to pursue his new project by come out from getting drunk. Thishappened the other night. Luckily working on his design further and definitely classifies as #drunkgoals.for him, Keith had proof of his creating a remote-control model. 85
MATERIALS ENGINEERINGA Self-Assembling Material Developed By MITOttut Mtacpiiaem dwtdghsmwe ttmsmoeeihhhhrxarserpeiomairm,emeaateeauoioattvptwpisrnSehttaskphasrmeeidhipyeroekotmsfeeeaplsleetrinoiaienueoysmslenhwnreiiaollsouramaplsraemt3po-ieggsaiauperiielntnlcwmbDwol.rtsiemowopsrplttcwtnaocStudcliWntnooootowewnefrabbcerefobehirepFTTIhecse,rrosdinlumltajoerTnatlcaehnelrnkfohieeaeoyehhlprayottr-nuchlniei3tc.citrstotdauaroi,anlnorAeergfhchoecshttelathtTDnnutsievlateetthtsed.htosifenspaihsmeooacehhh.tnseehr.otTtosw4ttnsmrlgonaerpfehTmhbiadveeeTeoydeemsiol,ahnDneyostntgmrurej,nyaehomhttaeSrhectTlegaigbl.eoveghtieaw.mwiitnmcnohacceesttpepiornssrbeeentlbTnehesoentaltgtaeayraoirlrsnfgelsoce..ireateonyhnanssnyyigy-mntiamrtihord3TcnralwthinA.nteadhlc.slgotscmhLba(toDeedl.thWaseaflgaeeIoaessaiMsftinsstoaeWpaeaenncpvnian,eaopsunrtwsstibvrphbtiaeesthbgaaebhmngipItlcniomshdhecunshinmrieepint.TiiioeheslantonaslimlteeopiriiNdeantpsihneeaf)thoscnmntbmetorettustnpfsclorbheytatfaaoerodhmahpcilibsesiehoiutayroetetltgynreattwnropsiorhasteji,mshnddeifrrvnedoemtooistmpLgeapasfrs,tieothnthnecvaefnesoehnMoaechiltteoiaceoafahmatttsmiedtnophmnirleucscbetritsrsttayritbmeacncaioleaaaosiercnm,noefsweoleltiosrbausetonosagbhnnt4onshnixadepgansnnehmtlihfbtafireaDigmmneaattithaetssosatle.saiaaeashS.hcaittcbenorwdutebetssnceMrehvrleaetkehbpebthbmessdirlcaoideatnaepnsiaeysewtoeauaratniehhsmopopnehxtdhrvtlicseldardopmstbah.ni,rerctlarsptheeedhytehniena!anaeosreHstesiesritcraltasteunthesscscpgienoiorsetayThtlesesntwsntwcsmohhmsstntieorputrpheurlateeaisigpgowtvtnecaceyIirbbtemsseethbedsihcoaenaertoh.mterhntoinbecel4crojuseelirsisbsesdewebteivllenhmiiDoeorcttvoifthitmctat,ae-tyetndiilgifsmuihoegotcl-entistustrp,eteeuspesheeaiyhdylisae.ordltnislye.-eefPhotos Source:Top: Technology ReviewRightUpper: Technology ReviewRight Lower: 3D Print 86
Photo Source: Arcaspace TOYS Photo Source: Arcaspace Photo Source: The Baum ListTravel Like A BossWith ArcaboardThe hoverboard that actuallyhovers and does not spontaneouslycombust is out in the market.B y definition, hover means remaining in one place in the air. With that, we can realize that the hoverboards before in the market aren’t really hover- boards. The dream is not yet over as thelegit hoverboard is finally upon us withthe birth of ArcaBoard. Unlike the boards whichfamously combusts in itself and whichbatteries are faulty, ArcaBoard is the realdeal. It can let you fly anytime, anywhereabove the ground. It features 272 horse-power and 430 pounds of thrust. It has36 high-power electric-ducted fans thatwill levitate you for around six minutesmaximum, which could travel a little overa mile at a maximum speed of 12.5 milesper hour. If you want to hover more thansix minutes, no need to fret as replace-ment battery parks are now in the works,apart from the previous charging time of35-minutes to a dead battery. More reason to be excitedabout the real hoverboard is the cutprice of $14,900, a $5,000 deficit from itspre-order price at Christmas at $19,900. 87
Your Fridays will neverbe the same again. GineersNow presents theworld’s first teen engineer robot,GN Bot, which welcomes ques-tions of all sorts from engineersand engineering students fromaround the world. Catch GN Bot every Fri-day on Facebook at these times: 1:00 PM Dubai 2:30 PM Delhi 5:00 PM Manila 6:00 PM Tokyo 8:00 PM Sydney GineersNow Meanwhile, here are GNBot’s best responses to date. Itis oftentimes witty, helpful, andhilarious! What a robot! 88
89
AUTOMOTIVEThe Fastest Garden Shed Photo Source: Oxford Mail KntcNwsas(TAscgtGam tgMfm bbgacrTaweacCaaybwoIcooehnhthaatttoroouidloaanyrnoehijwahoeaoruliorpcdoiuilerrresnnnataurllacxohecnlnglndaun.yaeeihddowpfdthrtollrrkvvtnomuoyrn.mbim-dNrksgewwlNgerneeeelrs.pvteesondtYmshHnurnlneissialnnesherreaoiteohcwepnwmlpdidotixencm,cotdhttcpufsstelpraoirowtoiwogserisoeotklehn,iokmarerehaornsnuhwatksdrdsecshOgstemtrmepsaeyteo,eustghrahhneerhhhegtt7.gceiivceWrncreeiehaAGwbrtn.dcoclihiiecssxihssadWaeot0eeheeooidosharancerssiduahTaehohneoafnyetndahoie.nstottroVErnretVltomds7lbvhbdirevhryiewnedidddoiunoeardnorMthpshNelhaddgrae7sdlniWolwooehvldrmapy.asWeu,bntdtotnh,etncadhuthMlatterhleusoiiwuelaNflirrothleokwdeforvwsgycnoe1rqft!tlrnooi.eheratfgoatRenhasorlPneepeksibhtwPp9ogueSodhrolNihgsnawaateealfldslrwabrdideapseeedslai7htlprwnHbaafftprarlaimayndevofstiGgsptcaadelodvtclt.’eansdflsirtyiscttameiteaepn8shheoigysnrrnahfieoptneshgihhyoktesfm?daemakupfEWo8gfaetraaetrevrhgyreaimolnetoeenmeartdastiaadfindpeeahnmenn-eteanowleneii,Moyoucsttotis.itsrddecchhelrddtcg?assaoglmtrtairforyntbrgseTampeoneogR,hwrrooenfwkgiaioilwnlrtPThouattoieszdaantioshrbrrcnescotefraiieahliovaehdsfoiHxthrieodnoocionnlmmaelgiwuydirfslagmwdohergteseizdsoktyu5dseucersakdds)cgherteets!yenteooeh.bt,8eissatsllhpsy.e,ahdOa-oooddcoedenntsMec.e.niiset4eaisfns!nnkdrxdto.l1ory,e--f.Photo Source: Perigord Vacance 90
DESIGN ENGINEERINGTiny House with Panoramic ViewT he Escape Vista by Escape homes boasts of an efficient tiny living with essentially cedar, metal, and glass components. It measures 160 square feet, with the home essentials such as bed, pop-up TV, kitchen with open-shelving and under- counter fridge/freezer, and bathroom with shower and toilet. It also has full- height cabinets and built-in cubbies and drawers for all of your storage needs. Apart from the interiors are its windows which are panoramic, it gives the outdoor-indoor connection. This home is for sale at an introductory price of $39,900, an already amount compared to larger models which prices range from $65,400 to $72,800. Your brand-new home will be delivered in 30 to 60 days upon ordering. This home is substantially smaller than the Escape Travele and XL Models from the same company. All Photos Source: Escape vista 91
ROBOTICS Photo Source: IB Times To BEeXgOinSKIrEoLnETMOaNnS Age Photo Source: Discovery ActiveLink, a Japanese effortlessly, six to seven times in tech company and a row. The device is composedJapan develops Exoskeletons, robotic subsidiary of Panaso- of two disks on the front part ofassist suits, to aid the elderly and to nic, released its first thighs and distributed over thesupport its work force. commercially available shoulders. It is powered by lith- assist suit AWN-03, an ium-ion battery with an electric exoskeleton that detects and engine according to ActiveLink assists body movements. It Engineer, Yasunori Nishi. The has been showcased in Tokyo’s exoskeleton costs $10,000 each. International Robot Exhibition, Also, Japan is not the world’s largest robotics the only one developing the show, a few weeks ago where it exoskeletons. In Europe and garnered a huge interest from the United States, a number of the audience. projects were soon be unveiled This is to address under the sectors of defense the aging population of Japan and rehabilitation industries. and supporting its shrinking Exoskeletons ranging from workforce focusing on health modular arms, limbs and chairs care, physical assistance and are now being developed for maintaining the country’s commercialization.In this tech- level of production. Using the nological age of robotics, from exoskeleton, which weighs a few parts to overalls, these “Iron pounds (6kg), the user would Man suits” are now a reality. be able to lift up crates or things 92
RAILWAY Hyper SpeedHow About Riding a Train From the Sky? Vertical Train Hub by Hina Sapra T he space that the train stations occupy has always been a big is- also remove them from the subterranean sue. Two London-based design- infrastructure. The idea is really helpful ers, Christopher Christophi and for older cities with weaker roads and Lucas Mazarrasa, finally thought building foundations, as well as cities of a solution to this big-time built near the water, with a limited ability trouble. The two have proposed the cre- to move deeper underground. There ation of the ‘Hyper Speed Vertical Train would also be an additional room for Hub’, a towering skyscraper that could parks, shops, or homes. dock trains vertically around the circum- The vertical design supports ference of the building. However, the idea the idea of having travelers enter the has been shared for eVolo magazine’s building and ascend directly to their car- 2014 skyscraper design competition. This riage on elevators that only stop at their could be highly functional though. destination floor, and board through The two designers aim at re- the platform. This design reduces the ducing CO2 emissions, increasing energy heavy passenger load, which otherwise is security and replacing the existing key crowded at train doors and station entry major train stations in cities around the points. world, including London, New York and The trains would work via Madrid. The vertical design, as suggested, ‘maglev’, or ‘magnetic levitation’. The can greatly reduce the volume needed to method is already popular in high-speed store trains when not in transit, and will transits. The method uses magnetic force to power trains as well as floats them slightly off of the track. It also increas- es the velocity at the same time as it decreases friction. It has been estimated that the train could cover 300 miles in 30 minutes, an average speed of 600 miles per hour. What an escalating idea, isn’t it?Photo Source: The Longest Stay 93
R E N E WA B L E S Photo Source: MITYWep,aIt’tsPeosrsibPle!urification using Solar energyThe availability of clean potable the help of the villagers, the system water is a global concern. The was configured for the community. lack of potable water is felt The materials and techniques used mostly by the remote commu- for the technology have enabled the Photo Source: Treehugger nities scattered across the de- veloping and underdeveloped villages to operate as well as maintaincountries. Fortunately, there seems to the system on their own. In fact, thisbe new hope for these communities awesome community has been doing itthanks to a new water purification themselves for almost 2 years.technology. This technology is not that The process used by thisdifficult to maintain as well since it is badass technology is known as “Pho-powered by solar energy. tovoltaic-powered Reverse Osmosis”. Residents of La Manchalona, One of the most crucial components ofa remote village in the Yucatan pen- the system are the solar panels, whichinsula, are using a water purification absorb light and generate electricity.system developed by the Massachu- The electricity powers up the pumps,setts Institute of Technology. Together, which pushes water through filters. Atthey have developed the system to be La Mancalona, two solar panels areself-sustaining for the long run. used. The system is capable of produc- There are nearly 450 ing 1,000 liters of pure drinking waterindigenous residents in the village each day from collected rainwater andof La Mancalona. The researchers salty well water.from MIT developed economic and If more technologies liketechnical models which could be used these would be shared and implement-for transforming the technology from ed throughout the world, especiallyuse in the lab, to use in the field. With places with scarce potable water, it will be a great help for humankind. 94
Underwater bot An underwater robot made by Toshibathat will save was built to scour the radioactive waters ofFukushima Fukushima’s worst-hit reactor and remove fuel rods. After an earthquake and tsunamiAn underwater robot made by demolished Japan’s Fukushima DaichiiToshiba was built toscour the Nuclear Power Plant in 2011, which causedradioactive waters of Fukushi- a dangerous radiation leak, the countryma’s worst-hit reactor and immediately planned to set robots to fix theremove fuel rods. needed repairs. Unfortunately, the environ- ment was too unstable for any normal robot to venture into. Since the incident, countless efforts were made by different companies to develop a robot that can do this complex job. This inspired a national robot competi- tion called the DARPA Robotics challenge, which was designed to simulate rescue efforts. This led to the development of some robots that are capable of working in unstructured or complex environments. According to Japan Times, Toshiba manufactured the worst-hit reactor and is currently helping with the clean-up. They created a two-armed submersible robot that will float into reactor 3 and try to remove debris and retrieve the reactor’s fuel rods. The simplicity of the robot shows that, sometimes the simplest robots are the best for the job. This underwater robot is expected to embark on its mission sometime in 2018. Though this may not be enough to make the place safe for humans to go into, it is certainly a major step in cleaning the site.Photo Source: Tech Insider 95
INTERNET OF THINGS Glance Tech The Household clock with home connectivity Glance Tech, an Internet of Things startup, uses their own cloud platform to innovate a “glance clock” to display various infor- mation. This is a smart wall clock that displays data from con- nected wearables, smartphones, smart home devices and other third party applications and web services. This cool new innovation platform will display information only when the user needs it. The glance clock gives the user a fresher way to interact with a smart house- hold. The glance clock, unlike other smart home integrations, is able to analyze water consumption, energy and more. This Internet of Things device is also able to analyze the us- er’s daily activities and schedule. By integrat- ing data from your connected fitness trackers, the glance clock is able to display the user’s sleep cycles, work out schedules, and also blood pressure. The device is also useful as it can also display the users upcoming meetings and activities. All Photos Source: Designboom 96
STETHEE Revolutionizing the StethoscopePhoto Source: Bilgi VersinA lmost three of every 10 deaths around the world are Photo Source: 36krcnd attributed to cardiovascular diseases, and they remain to be among the top killers year after year. Heart diseases are With every use, a person’s cardiovascular health silent killers, because they do not usually show symptoms information is anonymously sent to Stethee’s cloud servers for that would prompt one to see a specialist. Most of the early processing. With the help of a sophisticated algorithm created signs of heart problems are dismissed by the sufferer, so based on medical databases and public health guidelines, Stethee they escalate to the point that when they strike, it is usually can analyze heartbeats based on the age, family health historydebilitating if not fatal. and other qualities of the user. For years, regular medical consultation has been the onlykey to prevent any impending cardiac condition. People invest timeand money to undergo annual physical examinations to act on na-scent or escalating cardiovascular cases that put their life in danger.Today, a groundbreaking invention may change the way we deal withpotentially deadly heart conditions – presenting Stethee. Photo Source: KickstarterPhoto Source: Kickstarter Stethee is a device that takes the role of a “cardiologist”in your pocket. It goes far beyond what conventional fitness bandsavailable in the market do – it monitors a person’s actual heart-beat, rather than their pulse. Stethee has an easy-to-understandreporting system, and can be connected to a Bluetooth headset ora mobile app. It gives off a haptic feedback that allows the user to According its developers, Stethee can also prove to“feel” his heartbeat, and emits color-coded light to inform the user be vital for pregnant women, in that it can see and listen to theof their heart’s health – green means good and orange means they heartbeat of their unborn babies. Stethee can also be valuablehave to seek for further medical help. to asthmatics in tracking changes in the sounds of their lungs to help detect the onset of an asthma attack. While still in the 97prototype stage, Stethee’s creators are aggressively looking for funding to push the device to production.
KITCHENEERINGPhoto Source: Refrigerators ReviewedSamsung Fridge Lets YouOrder Groceries From Its21-Inch TouchscreenTcipeosactayFbcdy nocoooxnroounahorgypmnmmuudtpooeaivryawrtoerhlmmio.e2odenlask iaynsa1tutvtAuaiv,,ilhvti.aHrnoone5cessshphag tenhnhhcdanhgituroruteiccnaoraeanoTFhacot brcdbaetoSorrnrhtercvceheetma eneacioteohroiiidneostferosemdeermtaferueetfsrryfnFecioeoanesnhfeuliesyood–salrsnreudmsuttsoaylo,iunm,solegaogsaniuatut,tusrnnnoHruhhphelonicgsttrlepretlgrroolheeeudryDeewyatsecFdohhecitrrusmtidtsHaaeh-kfdioadotocsdLttprtmtfaecouirilhkaeroufeifoCpgidckedig’mranssnibicwaicetedrteiDe.mlttcimhdtnpyearneraidseIineofsseli’ahngilnrHrdyegetnoaltawoiojetaietnnipoigaluunnewulmnstnslnaoydtrrhsoasrokedbrsg.ioer,tclauwtwetsclemsk.uoededrRtfftv,tleaos.saahsctirtuaioaxteois,iAmnshgoayoo-nncoltftpnpauttdneodreftldaniaklnislirt,–ulosaagngs,iyieityrolok-ezhea-tenerrep,ed-rs- iwmaycdfiRiRgHgtoof pycfnmforrhranooarngoeeaiiioyeruoentdeuursdysofdaghdomwescrn,pgrcgareieicteuilietaedeechneetgtaveFachrr’ntnarsssekacedilncaysiraesnkottrntnaetaamaepeacsresegs3rapngyneraehpteouprdat6iotyodsaWhlswoomsusepo0typuatrp.mieihpfaifrrehnlgoYmpalHiaiyekneptetitsiadhctromhinhnhekei,pautletospuneereenehgqttnuybintiseuho,gdlnuahehacro,lytrntisreflvrenoaasew.olmfoufrei,eiefueinonlISdmikdrkacpiitcdeahpartatgaietstieltnsnyhogggeamtahdlhttylSwceyjevedfyyoohceaotifoahars.eonheaenensoeyftarumuTyeurmluonhveaektdlnnoSsramhorteriresaastauecgrgoaersorurhsefhisumircmyrerrdpeugndFtocatoeesmitorhBthgotdasgsm’siaposivtticusahmt’omlorgadmosifpiuntenntnntnietoaioipneei,hcomhnes.ntggaslwtnhahsyitmrooEiggotmdofSonogateonbhsnoveHoeemsnalhcudenuoeelrirtjrkistugtnehotirneay,thalhebrscrtoeie-.-tinu- ftpositrbfffTFai R2FFn mnloaorhein0uaueleerivFevefogneimnxr1dtklpere2poxltfgi6ioewleztboo8rZlbgdyiDhf.eeeuliBrrKaeiiieytorIpedttltmtelaerltsiha9nslaipettHianhiniwnftoy5ggacestdtyedogoukiynta8h™nialoemgmFTlmroeb0pc,M.nf.ltSunavhoue0ShpleFbetdsreemaieeoStaeal.crsaehdyaaStiatReodtiYrnF.ianiaocaannelymonto)adlyvevflmnerdoenermulCsweaaneHrueustpsnidagsttsocsihilnururhuosllashoyaolpedyomnffsbben-aneoplboreigsSgHilnr’neiarrRsneetoare,andmemitgSauvvdwglmegiacspommniebfaSvhinisnassnadrnusacyet.naCsniirgfugeomirsgdsreretlerneeotofretaaaniwteerfeiagurgmbsooTsonjmanga-whonlnoitinaVteeemtmuytto,mfindxo,estriinrtorciyhsnduvirapoeifsednlo(roaposrsuDheisSmrigute,trnetttsdaopiusesetsuhroritnosrh-rvgpihnetn-,iydoeieotne-shregl, 98
KITCHENEERINGPhoto Source: InstructablesBMCoraookkleeerYnofFruorrimdOgwaenImdbhs oeoaamvwtkeheneett.hahnmr njwpYueeieceeonsccaeotltrayukglodfITossceetmotcelihltcoetamlyaoissaytrbosn.dkoiisplwugcnAeopeuurorhhoeslmysthostoneejhoooelanbwadmieutcvstehirntretefseweheroofgytacoiaehenfoaaomrsrerirbllueioenyskayeruelfgegdorsierrzcdnoeeouriefhog.g,qodr.utnemegru,hstroitiipeyavirohstgrotaeefioehlhcusnsiireaetitmstdvytaoaaheonsinngauoddtht tygc opwrchhoiaoonraorepsyunocott-eufddeocdbrrlyiapaiaaesdsnnr,risocgfds2rssfpey”eaaueiuoYYwnswtyrxt.puoorde,sao4auu,shblhc”uarclawoeannawstvmluoioaddteolsclrolemk,obdtcrlnsaibyd,orenenicoor,reilgdadlcxfPsd/,u.eibdVwsnl.lpieorkqgCiaivmilvuln/lteleobireecgdrarto,ysasggnmcpo,suehasru1seniaorfl¼a,yiisptnnna,tp”nsedinaaediwgdns,st,; 99
TGHivEe‘sOYUSSTPEoRw’ TeHrAT I n a world where people are looking P for a better and cleaner alternative toPhoto Source: City University of Hongkong coal as our source of energy, engineers and scientists have engaged in different researches to find a new source of power that would be good for us and for the environment as well. Knowing that the world’s surface is made up of 70% water, they found a way to use ocean waves as a new source of clean energy. Who would have thought that using wave turbines can lead “exceptional results” in generating power? Aquamarine Power, a Scottish wave power company, spent months testing its Oyster 800 wave machine in Orkney. This is the largest working hydroelectric machine that uses wave energy to produce power in the world. It works by pumping high-pressure water into its hydro- electric turbine, which then powers the electric grid that is used around its neighborhood for electric consumption. This device can be used even at shallow depths and it’s easy to maintain. The company expects that it can power 9,000 houses using 20 of its Oysters. The company is currently finding ways to refine and improve its wave turbine’s design. It is also using its research and development team to upgrade its technologies for its intellectual property portfolio. Aside from producing clean energy, the Oyster is designed to rely on water for hydraulics only. This means it won’t disturb marine life. The device runs silently so you don’t have to worry about any annoying sounds near the shore. This turbine is still in its early stages of development so it is still limited to one location. However, the company aims to establish the Oyster in other countries such as Spain, Portugal, Ireland, South Africa, Australia, US, Chile and UK. If each wave turbine can save about 500 tons of carbon dioxide every year, we’re hoping this technology will be used in a lot of countries in the near future. This could definitely help in solving our problems in today’s climate change.Photo Source: Inhabitat 100
Search
Read the Text Version
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
