CLAIM UP TO % OF YOUR VET LEVY CONTRIBUTION As per Government Notice No. 5 4 of 27 January 2014, Employer Training Grant applications are DAYS LEFT to be submitted to the Namibia Training Authority within 31 days, after the end of the financial year. NEWS BUSINESS SPORT SUBMISSION Deadline: 1 May 2017 YOUNG MAN RETAIL DIRK CLAIMS DARES TO WORKERS ARCHERY (For levies paid to the NTA from 1 April 2016 to 31 March 2017) DREAM BIG UNDERPAID BRONZE For more information, P 03 P 08 P20 contact us at: Tel: 061-2078 504 [email protected] www.nta.com.nawww.informante.web.na • 061-275 4700 Find us on Your Community NEWSPAPER • 27 April - 04 May 2017 • Edition # 578 Local ship ran aground on notorious Skeleton CoastCriminal mugshotsgrey area CASTAWAYS SAVEDAiliIilongaPolice stations across Windhoek, and beyond, The desolate Namibian coastline could have claimed the lives of nine men after their vessel ran aground andare bypassing unchecked a criminal proce- they had to battle the elements for more than two days ashore.dure Act to take photographs of suspects. RESCUED: The stranded Lucille Way. Photo Armand Basson This came to light following an investigationinto whether or not police officers profile every Niel Terblanche metres south of the famous Eduard person immediately organised a grab. He said their water wasperson who is arrested and/or charged for espe- Bohlen wreck close to Conception rescue mission from Walvis Bay,” starting to run out and that the mencially serious offenses. Against the odds, a group of Bay. said Basson. only had a few biscuits between tourists passing on the beach them for food. Earlier this month, Informanté reported on how where the castaways were stranded “They told me that their vessel, He said he used the grid refer-Oshana police station officers have been failing spotted and rescued the men who the Lucille Way, ran aground on a ence on his Global Positioning “We gave them some water andto take mugshots of criminals as far back as were running low on water and sandbank. The captain told me that System device to guide rescuers to cold drinks as well as some sosa-2013, making it virtually impossible to release food after just two days. he did make a mayday call on his the right spot in order for the cast- ties that we had left over from thethe photographs of criminals for public aware- radio but that he was not sure if aways to be picked up. He added tour. The men were very thankfulness and caution after a prison break. According to Armand Basson, the distress signal was received by that a salvage operation was also for our help,” he recalls a tour guide for I Dream Africa the relevant authorities. I took my launched to pull the Lucille Way One of the largest police stations in the north, Adventure Tours, when he drove satellite phone from my vehicle back into the water and re-float it. The Lucille Way is a Namibianat the time cited a lack of functioning cameras up to the men on the beach they and called some people in Walvis flagged snoek vessel which regis-as the reason for its failure to have mugshots of were very happy to see other Bay to ask if anybody knew any- Basson said the men abandoned tered Lüderitz as its home port.repeated offenders on hand. living souls. thing about the castaway crew and their vessel while it was still in their vessel. Nobody knew but the shallow water and used the life raft The incident is currently under Police officers who spoke to Informanté He said the snoek-catching and what provisions they could investigation by the Directorate ofadmitted that taking mugshots is not viewed vessel ran aground about 25 kilo- Maritime Affairs.as mandatory. “We only profile when we want.Sometimes we do, sometimes we don’t. Eventhe forms we fill in when charging a suspectonly make provision for fingerprints and not amugshot,” said one officer. Another police officer admitted that emphasisis not placed on taking mugshots. “Personally, I only do it when l want to famil-iarise myself with potential criminals like gangmembers, but it is not compulsory and not manypolice officers do that,” said the officer of 12years in service. Informanté investigations found that somepolice officers did not even know that takinga mugshot was procedural. Nampol’s DeputyCommissioner, Edwin Kanguatjivi, counteredthat it is mandatory for police officers to takemugshots of suspects along with fingerprints. Kanguatjivi, however, denied that it wasn’tbeing done. “Yes, the police stations in Namibiado have functioning cameras and besides thereare provisions in the Criminal Procedure Act,Act 51 of 1977 as amended, for police officersto take photographs of suspect or to cause one tobe taken in the absence of functioning cameras,”he said. Inspector General of the police, SebastianNdeitunga also pleaded ignorance to the fact thatpolice officers were failing to take mugshots ofsuspects. “If it is an administration problem, itshould be addressed by the regional command-ers. If it is a financial issue, then we shall lookinto it but so far am not aware of that,” he said.WINNING 6 1871900 45 2 1877704 45 9 1882868 45 6 1856523 45 11 1883496 45 REMINDERNUMBERS THESE 5 NUMBERS APPEARED IN LAST WEEK’S INFORMANTÉ. IF YOU HAVE ONE OF THE NUMBERS, THEN YOU ARE A WINNER. Rhodes Peaches Rhodes Squish Assorted 410g Assorted 110ml 9.N$ 99 6.N$ 99 each each 28/04/2017 - 30/04/2017 9.N$ 99 Rhodes Braai Relish each Assorted 410g Bull Brand Viennas 275g Rhodes Mixed and 7.Your CommunityNN$EWS9P9AeacPhERCAN SPECIALS! 13.www.informante.web.na • 061-N2$75 41029/94363 FiCnurdrieud4sV1e0oggentables Valid at all SHOPRITE outlets, while stocks last. WE RESERVE THE RIGHT TO LIMIT QUANTITIES
CLAIM UP TO % OF YOUR VET LEVY CONTRIBUTION As per Government Notice No. 5 4 of 27 January 2014, Employer Training Grant applications are DAYS LEFT to be submitted to the Namibia Training Authority within 31 days, after the end of the financial year. NEWS BUSINESS SPORT SUBMISSION Deadline: 1 May 2017 YOUNG MAN RÖSSING DIRK CLAIMS DARES TO PROFITS DESPITE ARCHERY (For levies paid to the NTA from 1 April 2016 to 31 March 2017) DREAM BIG DOWNTURN BRONZE For more information, P 03 P 08 P20 contact us at: Tel: 061-2078 504 [email protected] www.nta.com.nawww.informante.web.na • 061-275 4700 Find us on Your Community NEWSPAPER • 27 April - 04 May 2017 • Edition # 578 Local ship ran aground on notorious Skeleton CoastCriminal mugshotsgrey area CASTAWAYS SAVEDAiliIilongaPolice stations across Windhoek, and beyond, The desolate Namibian coastline could have claimed the lives of nine men after their vessel ran aground andare bypassing unchecked a criminal proce- they had to battle the elements for more than two days ashore.dure Act to take photographs of suspects. RESCUED: The stranded Lucille Way. Photo Armand Basson This came to light following an investigationinto whether or not police officers profile every Niel Terblanche metres south of the famous Eduard person immediately organised a grab. He said their water wasperson who is arrested and/or charged for espe- Bohlen wreck close to Conception rescue mission from Walvis Bay,” starting to run out and that the mencially serious offenses. Against the odds, a group of Bay. said Basson. only had a few biscuits between tourists passing on the beach them for food. Earlier this month, Informanté reported on how where the castaways were stranded “They told me that their vessel, He said he used the grid refer-Oshana police station officers have been failing spotted and rescued the men who the Lucille Way, ran aground on a ence on his Global Positioning “We gave them some water andto take mugshots of criminals as far back as were running low on water and sandbank. The captain told me that System device to guide rescuers to cold drinks as well as some sosa-2013, making it virtually impossible to release food after just two days. he did make a mayday call on his the right spot in order for the cast- ties that we had left over from thethe photographs of criminals for public aware- radio but that he was not sure if aways to be picked up. He added tour. The men were very thankfulness and caution after a prison break. According to Armand Basson, the distress signal was received by that a salvage operation was also for our help,” he recalls a tour guide for I Dream Africa the relevant authorities. I took my launched to pull the Lucille Way One of the largest police stations in the north, Adventure Tours, when he drove satellite phone from my vehicle back into the water and re-float it. The Lucille Way is a Namibianat the time cited a lack of functioning cameras up to the men on the beach they and called some people in Walvis flagged snoek vessel which regis-as the reason for its failure to have mugshots of were very happy to see other Bay to ask if anybody knew any- Basson said the men abandoned tered Lüderitz as its home port.repeated offenders on hand. living souls. thing about the castaway crew and their vessel while it was still in their vessel. Nobody knew but the shallow water and used the life raft The incident is currently under Police officers who spoke to Informanté He said the snoek-catching and what provisions they could investigation by the Directorate ofadmitted that taking mugshots is not viewed vessel ran aground about 25 kilo- Maritime Affairs.as mandatory. “We only profile when we want.Sometimes we do, sometimes we don’t. Eventhe forms we fill in when charging a suspectonly make provision for fingerprints and not amugshot,” said one officer. Another police officer admitted that emphasisis not placed on taking mugshots. “Personally, I only do it when l want to famil-iarise myself with potential criminals like gangmembers, but it is not compulsory and not manypolice officers do that,” said the officer of 12years in service. Informanté investigations found that somepolice officers did not even know that takinga mugshot was procedural. Nampol’s DeputyCommissioner, Edwin Kanguatjivi, counteredthat it is mandatory for police officers to takemugshots of suspects along with fingerprints. Kanguatjivi, however, denied that it wasn’tbeing done. “Yes, the police stations in Namibiado have functioning cameras and besides thereare provisions in the Criminal Procedure Act,Act 51 of 1977 as amended, for police officersto take photographs of suspect or to cause one tobe taken in the absence of functioning cameras,”he said. Inspector General of the police, SebastianNdeitunga also pleaded ignorance to the fact thatpolice officers were failing to take mugshots ofsuspects. “If it is an administration problem, itshould be addressed by the regional command-ers. If it is a financial issue, then we shall lookinto it but so far am not aware of that,” he said.WINNING 6 1871900 45 2 1877704 45 9 1882868 45 6 1856523 45 11 1883496 45 REMINDERNUMBERS THESE 5 NUMBERS APPEARED IN LAST WEEK’S INFORMANTÉ. IF YOU HAVE ONE OF THE NUMBERS, THEN YOU ARE A WINNER. Rhodes Peaches Rhodes Squish Assorted 410g Assorted 110ml 9.N$ 99 6.N$ 99 each each 28/04/2017 - 30/04/2017 9.N$ 99 Rhodes Braai Relish each Assorted 410g Bull Brand Viennas 275g Rhodes Mixed and 7.Your CommunityNN$EWS9P9AeacPhERCAN SPECIALS! 13.www.informante.web.na • 061-N2$75 41029/94363 FiCnurdrieud4sV1e0oggentables Valid at all SHOPRITE outlets, while stocks last. WE RESERVE THE RIGHT TO LIMIT QUANTITIES
2 NEWS 27 April - 04 May 2017 Seas placed on suicide watch Former prosecutor remains in jailFILICIDE MOTHERDENIED BAIL WRONG SIDE OF THE LAW: Ivan Tjizu.The woman accused of killing her daughter on an isolated beach north of Henties Bay did not succeed in apply- Photo: Eba Kandovazuing for bail in the Swakopmund Magistrate’s Court. Eba Kandovazu Niel Terblanche terrupted by members of the police The State further argued that the mine what motivated her to kill her and neighbourhood watch. accused person might abscond or own child. A former prosecutor of the WindhoekThe 32-year-old Zenobia Seas commit suicide and that she might Magistrate’s Court who stands accused of stands accused of murder after Seas sent a text message to the interfere with state witnesses. In her application, Seas argued defrauding the government of N$280 000she allegedly killed her daughter, father of the toddler informing him that she will enlist the help of a in fake claims has approached the HighAva Owoses, two days before she that she was responsible for her Ever since she was arrested last psychologist and that she would be Court to appeal a ruling that denies himwould have turned three by stuffing death. The phone was tracked to year, Seas has been on suicide able to pay N$5 000 in bail money. bail.a cloth in her mouth and smoth- the scene of the crime and enabled watch while in custody.ering her at the end of September first responders to intervene and The magistrate in the case found Ivan Tjizu, 29, was arrested in Decemberlast year. arrest Seas. During the formal bail applica- that the State had a strong case and last year and charged with corruptly using tion, a report by a psychologist that it would indeed not be in the his office or position for gratification, cor- Seas also attempted to commit During the formal bail applica- stated that Seas is not a threat to public interest to free the accused ruptly using a false document, conspiracysuicide after killing her child by tion, the State argued that freeing herself or any other person and that person on bail. to commit offences under the Anti-corrup-setting fire to wood underneath her the accused person on bail would she is fit to stand trial. tion Act and contravening sections of thecar. The attempted suicide was in- not be in the public interest and The fact that the accused person Prevention of Organized Crime Act. that it might interfere with the The report, however, stated that might commit suicide also weighed administration of justice. another psychological evaluation heavily against her in this applica- It is alleged that Tjizu misrepresented needs to be undertaken to deter- tion. to the magistrate that witnesses travelled from outside Windhoek to testify.Alleged American murderer wants new judge He would then reportedly arrange for Eba Kandovazu HITMEN: Kevan Townsend (left) and Marcus Thomas (right). a package with a firearm silencer individuals to pose as witnesses in court. Photo contributed to Namibia and falsely labelled itAmerican murder accused, Marcus “Furniture spare.” Magistrate Eduard Kesslau, who presidedThomas, wants the judge presiding argued earlier this week that Judge hearing is set to be heard on 5 June. over the suspected fraudster’s bail appli-over the case in which he and a Liebenberg had already made up his Thomas and Townsend further This, according to the indictment, cation in December, found that there wascompatriot are accused of having mind about his involvement in the was done in preparation for their direct evidence linking Tjizu to the peoplemurdered a young Namibian in charges against him and Townsend stand accused of robbery, importing plan to travel to Namibia and kill alleged to have falsely claimed the witnessWindhoek in 2011 to stand down. and that he had prejudged him. firearms into Namibia without a Heckmair. The suspects then report- fees. permit, possessing a firearm without edly got hold of Heckmair’s number Thomas and his co-accused, Judge Liebenberg has since a license, possession of ammunition and disguised their identities before The magistrate declared Tjizu unfit forKevan Donnell Townsend, are ordered that Thomas file an affidavit and defeating the course of justice. they finally lured him into meeting bail after the accused allegedly admitted toaccused of having murdered the in which he states the reasons of the with them. The state is alleging having made late-night calls to his lawyer25-year-old André Heckmair in recusal by 15 May. The application The two travelled from the States that the accused further robbed friends and police officers to ask them forWindhoek on 7 January 2011. to Finland where they forwarded Heckmair of his cellphone and loans. wallet containing at least 100 Swiss The latest development in the Francs. They are further accused of According to Kesslau, Tjizu displayedmurder case follows a judgement removing a notebook from police unethical conduct and opened doors forthat was delivered last year by custody when they entered the in- potential corruption.Judge Christie Liebenberg that vestigating officer’s office to collectThomas was fit to stand trial and their toiletries after their arrest in In his arguments before Judge Christiecould appreciate the wrongfulness an attempt to defeat the course of Liebenberg, Tjizu maintained that he wasof his actions and understand court justice. unhappy with the magistrate’s decision,proceedings based on the findings of adding that he is not a flight risk.two State Psychiatrists who declared Deputy Prosecutor GeneralAn-him mentally fit. Thomas, through tonia Verhoef is prosecuting and Tjizu also maintained that he would nothis new Lawyer Kadhila Amoomo, Townsend is represented by Mbanga interfere with investigations or with state Siyomuinji. witnesses.Court dismisses SME urgent application Tjizu informed Judge Liebenberg that the magistrate who denied him bail had Eba Kandovazu approached the court to be reinstat- and a South African bank, VBS in that their reputational careers and fully relied on contradictory evidence, as ed. It follows an internal inspection Mutual Bank, of which N$196 mil- dignity have been compromised and he claims the investigating officer testifiedAn application that was filed by the by Bank of Namibia (BoN) and a lion is said to still be with the two the likelihood of ever securing jobs that the five dockets filed by Tjizu wereformer bosses of SME Bank in the discovery that SME bank had invest- South African financial institutions. in the banking industry is reason missing, whereas only two were missing.High Court to have the court handle ed about N$200 million with two Only N$37 million was returned enough to have the matter heard ontheir case on an urgent basis was South African companies, and the to the bank. The applicants further urgency. “The magistrate wasn’t aware of theyesterday dismissed and struck from funds could not be accounted for. challenge BoN’s decision to take contradiction in the investigating officer’sthe court roll by Judge Shafimana over the SME bank as they claim the This claim was disputed by Judge testimony. He failed to have knowledge ofUeitele as it was not deemed urgent. Court records indicate that BoN is central bank’s actions were unlaw- Shafimana , who ruled that the fact the number of the alleged missing dockets of the view that SME bank is likely ful. They requested the court to set that irreparable damage has been and that has prejudiced me. This is a mis- The applicants will now have to to become insolvent and is conduct- aside BoN’s decision to take over done does not necessary make up for construing of facts,” Tjizu remarked.follow the normal judiciary course. ing its business in contravention of SME bank and declare it unlawful urgency. BoN has since taken con-Tawanda Mumvuma, Joseph Banda, the Banking Institutions Act of 1998 and invalid. The dismissed former trol of the SME Bank and appointed Judge Liebenberg reserved his judgementEnock Kamushinda, Alec Gore, and in a manner that is detrimental SME bosses, though their lawyers, an interim board which consists of for 8 May.Ozias Bvute and George Simataa to its customers. Vincent Maleka, Sisa Namandje and Advocate Dennis Khama, Melaniewere removed from office with Mbushandje Ntinda, argued that they Tjijenda, Ali Ipinge and Fanuel The state is represented by Prosecutorimmediate effect in early March and It is reported that SME invest- have suffered irreparable damage, Kisting to carry out the fiduciary Dominic Lisulu and Tjizu represents him- ed N$231.8 million with a South responsibilities. self in this matter. African company, Mamepe Capital, LamFbRMEixSedHC! hops Big Value Meal 86.N$ 99 1x Chicken Piece, Mini Loaf & per kg 24Coleslaw OR Mash N$ 9028/04/2017 - 30/04/2017 4N$ .99 Coleslaw YOU CHOOSE 29N$ 90SNACK SPECIALS! Coke, Fanta, Sprite OR Mash Smart Value Meal cans 330ml 2 Full Wings & Dixie Burger Ts&Cs apply. While stocks last. Valid at all SHOPRITE outlets, while stocks last. WE RESERVE THE RIGHT TO LIMIT QUANTITIES
27 April - 04 May 2017 NEWS 3 At times walked to varsity due to lack of fundsSTATUS DOESN’T DEFINESUCCESSEducation is the key and one must obtain it by any meansnecessary, regardless of the circumstances that one mayfind themselves in. Marthina K. Mutanga graduate with a Bachelor degree. BEATING THE ODDS: Elifas Helao Nghitomoka. Photo contributed “If you want to prosper in life,These were the words of a recent Namibia University of Science the best is to keep your vision andand Technology (NUST) graduate focus on your goals. Never divertwho is a prime example that circum- from them because of others. Yes,stances should not determine one’s life becomes difficult as we go on,success. but nobody promise that life will be easy,” said Nghitomaka. To the strangers who witnessed Eli-fas Helao Nghitomoka graduate last Nghitomoka further noted thatweek, the 24-year-old is just another with the current economic situation,student who successfully managed obtaining a degree and being intel-to obtain a Bachelor of Human Re- ligent is simply not good enough,sources Management. especially when you are poor and the odds are stacked against you. To those who know him, however,the young man defeated the odds as “We are challenged to think criti-he in fact lives in the outskirts of the cally and to become innovative,” saidHavana informal settlement. Nghitomoka. In fact, his graduation picture taken Apart from the obvious chal-against the backdrop of the shack- lenges that comes from living in anriddled informal settlement went informal settlement, such as a lack ofviral on social media, with many electricity, Nghitomoka also recallscongratulating him on his achieve- sometimes walk long distances toment. university because he did not have money to pay the taxi fare. He maintains that hard-work, com-mitment, self-discipline, dedication, “I had the chance to give up sodevotion and determination are key many times, but I didn’t because Iingredients to achieving anything in realised that I’ve already come a longlife. way and giving up means that every effort that I’ve already put in will go Nghitomoka added that despite to waste. So before you think of giv-failing several times, he managed to ing up, think about the reasons why you are here,” he stated.
4 NEWS 27 April - 04 May 2017 Surviving a freak accident to kick-starting his permaculture projectHOPE TO ERADICATE HUNGERBefore a motor vehicle accident which caused damage to the motor region of his brain, making him lose the ability to walk and control body move-ments, Corne Thalwitzer worked as a building contractor. Zorena Jantze He explained that he was from rubble, discarded plants rity and an environment that is Corne Thalwitzer born in Mariental but resided in and hormone powder. family friendly.Today, he has regained most Tsumeb for many years and that of his motor movements but after the accident, he couldn’t This was the start of his According to Thalwitzer, thedoes not practice in construc- get any more construction con- permaculture project assisted by homeless and those in need oftion industry anymore. tracts as many clients judged Donovan Wagner, who worked food will tend to the sustenance him for limping. on a permaculture project him- of these gardens, whilst creat- Despite this, within minutes self, with the technicalities of ing a safe place for ordinaryof meeting the 38-year- old, one “I had a lot of free time on my permaculture. citizens.notices the passion he has when hands and would venture outspeaking on his permaculture into Kuvikiland, an informal Unfortunately during the same “We can feed the hungry.project named the Joel Parks settlement in Tsumeb. I would period, Thalwitzer was struck Namibia has a relatively largeProject, that is aimed at feeding go to the location and see so by another tragic accident, the working force, if everyone con-the hungry. Permaculture is a many hungry children, some death by suffocation of his tributed N$50, we could growsystem of agricultural and so- homeless while others came 1-year-old son, Joel, whose vegetable gardens all aroundcial design principles centered from poor households and were head got stuck in between a our towns, whilst creating a safeon simulating or directly utiliz- in need of food,” he said. fence during daycare. space for our children,” he said.ing the patterns and features With regard to funding, he ex-observed in natural ecosystems. He explained that he would “I remember strolling around plained that he wishes to engage engage these children to pick parks with him a lot, this is with foreign embassies. Thalwitzer recounts his up non-biodegradable waste, why I named my permaculturejourney and what permaculture and teach them how to plant project Joel Parks,” he said. “My goal is to create an en-is, as well as what he hopes gardens, and preparing meals vironment, where we all moveto achieve with his Joel Parks for them with produce from The permaculture project forward because nothing mat-Project. his own garden which he grew proposes the development of ters much in this world when parks, with self-sustaining food one is hungry,” he said. gardens through intellect, secu- Rössing profits increase despite downturn Zorena Jantze and wages was recorded. tions for the year 2017 include Additionally, an amount of a fatality-free Rössing Uranium DESPITE the negative global mine with an engaged and em- performance of uranium in spot N$2,4 billion was spend on powered workforce. prices, Rössing Uranium had a goods and services for opera- turnover of N$3 billion up from tional cost. The Rössing Uranium mine N$1,8 billion in 2015. is located close to the town of Comparatively, on the global Arandis, some 70 kilometres These figures were revealed by outlook, he explained that the inland from Swakopmund in the managing director of the Namib- uranium market suffered a major Erongo Region. ian Rössing Uranium Limited collapse in 2016, following a mine, Werner Duvenhage. relatively stable market in 2015. It is partly owned by RioTinto group, an international metal Duvenhage said as a major “This was due to the emergence mining corporation that owns employer and purchaser of goods of additional secondary sup- 69% of its shares. and services, Rössing Uranium plies and large volumes of newYoung lady to invest and splurge makes a significant contribu- production in 2016, as well as tion to economic development the very slow rate of progress Aili Iilonga Windhoek and couldn’t hand, she also wants to and the creation of prosperity of with reactor re-start in Japan, POSITIVE: Werner Duvenhage, believe her good fortune have fun. communities. combined to cause the market to MD of the Rössing UraniumA 25-year-old single lady when she realised that she fall 50% between January and mine. Photo Zorena Jantzeand creditor at a building won a huge sum of money. “I plan to invest some of With regard to their contribu- November 2016, before stabalis-supplies company, now has According to La-Toya, “I the money, and the rest, tion to fiscal authorities, he ing at year end around US$20the opportunity to shop till actually tried two times well I want to spend it on added that Rössing Uranium paid per pound,” Duvenhage stated.she drops after getting the before with the winning clothes,” she added. the government N$80,4 millionopportunity of a lifetime number and I wasn’t lucky, in royalty tax, N$50,8 million in With regard to future businessas a winner of a whopping so I tried again and I won. La-Toya encouraged dividends and N$107,2 mil- prospects, the managing directorN$10 000 in the Inform- I feel so great about it, like Namibians to read books lion in PAYE tax on behalf of said Rössing Uranium maintainsanté/Legal Shield Unique I am over the moon right and newspapers to educate employees. a good supply of uranium oreNumber competition. now. Wow! I can’t believe themselves on local and from its open pit. Duvenhage that I actually won so much international affairs and Payments to public enterprises added that the mine has a 10-year A resident of Dorado money.” thanked Legal Shield for such as NamWater and Nam- framework closure plan annualPark, Roxette La-Toya La-Toya intends to do the opportunities that her Power amounted to N$392,7 fund project.regularly gets her Inform- the right thing by investing prize money has opened million, which includes theanté newspaper from a some of the money for a up for her. She would have training levy paid to the National About the possibility of valuevendor at a stand near rainy day, but on the other doubled her prize money to Training Authority (NTA) that addition, he stated that valueHidas Complex in Klein N$20 000 if she was a paid amounted to N$ 5,6 million. addition in uranium is a prospect up Legal Shield member. mostly under the jurisdiction of Furthermore, an amount of governments. N$506,7 million in net salaries He added that the mines aspira-
4 NEWS 27 April - 04 May 2017 Surviving a freak accident to kick-starting his permaculture projectHOPE TO ERADICATE HUNGERBefore a motor vehicle accident which caused damage to the motor region of his brain, making him lose the ability to walk and control body move-ments, Corne Thalwitzer worked as a building contractor. Zorena Jantze He explained that he was from rubble, discarded plants rity and an environment that is Corne Thalwitzer born in Mariental but resided in and hormone powder. family friendly.Today, he has regained most Tsumeb for many years and that of his motor movements but after the accident, he couldn’t This was the start of his According to Thalwitzer, thedoes not practice in construc- get any more construction con- permaculture project assisted by homeless and those in need oftion industry anymore. tracts as many clients judged Donovan Wagner, who worked food will tend to the sustenance him for limping. on a permaculture project him- of these gardens, whilst creat- Despite this, within minutes self, with the technicalities of ing a safe place for ordinaryof meeting the 38-year- old, one “I had a lot of free time on my permaculture. citizens.notices the passion he has when hands and would venture outspeaking on his permaculture into Kuvikiland, an informal Unfortunately during the same “We can feed the hungry.project named the Joel Parks settlement in Tsumeb. I would period, Thalwitzer was struck Namibia has a relatively largeProject, that is aimed at feeding go to the location and see so by another tragic accident, the working force, if everyone con-the hungry. Permaculture is a many hungry children, some death by suffocation of his tributed N$50, we could growsystem of agricultural and so- homeless while others came 1-year-old son, Joel, whose vegetable gardens all aroundcial design principles centered from poor households and were head got stuck in between a our towns, whilst creating a safeon simulating or directly utiliz- in need of food,” he said. fence during daycare. space for our children,” he said.ing the patterns and features With regard to funding, he ex-observed in natural ecosystems. He explained that he would “I remember strolling around plained that he wishes to engage engage these children to pick parks with him a lot, this is with foreign embassies. Thalwitzer recounts his up non-biodegradable waste, why I named my permaculturejourney and what permaculture and teach them how to plant project Joel Parks,” he said. “My goal is to create an en-is, as well as what he hopes gardens, and preparing meals vironment, where we all moveto achieve with his Joel Parks for them with produce from The permaculture project forward because nothing mat-Project. his own garden which he grew proposes the development of ters much in this world when parks, with self-sustaining food one is hungry,” he said. gardens through intellect, secu- MATTER OF FACT In a story headlined, ‘Pilot error cited in air-crash’ pub- lished in the Informanté newspaper’s edition of the 20th – 26 April 2017, it was reported that Uwe Herbert, was the pilot flying the Cessna 425 V5-MJW that crashed near the Hosea Kutako International Airport (HKI), killing all three pilots on board on 29 January 2016. According to Civil Aircraft Accident Report issued by the Directorate of Aircraft Investigation the late Herbert was not the pilot of the Cessna on that fateful day, but was seated at the back of the aircraft. Informanté regrets the error and forthwith apologises to the family of the late Herbert for the incon- venience the report might have caused.Young lady to invest and splurge Aili Iilonga in Klein Windhoek and couldn’t fun. For advertising call believe her good fortune when she “I plan to invest some of the +264 61 275 4700A 25-year-old single lady and realised that she won a huge sum ofcreditor at a building supplies com- money. According to La-Toya, “I money, and the rest, well I want topany, now has the opportunity to actually tried two times before with spend it on clothes,” she added.shop till she drops after getting the the winning number and I wasn’topportunity of a lifetime as a win- lucky, so I tried again and I won. I La-Toya encouraged Namibiansner of a whopping N$10 000 in the feel so great about it, like I am over to read books and newspapers toInformanté/Legal Shield Unique the moon right now. Wow! I can’t educate themselves on local andNumber competition. believe that I actually won so much international affairs and thanked money.” Legal Shield for the opportunities A resident of Dorado Park, that her prize money has opened upRoxette La-Toya regularly gets her La-Toya intends to do the right for her.Informanté newspaper from a ven- thing by investing some of thedor at a stand near Hidas Complex money for a rainy day, but on the She would have doubled her prize other hand, she also wants to have money to N$20 000 if she was a paid up Legal Shield member.
27 April - 04 May 2017 ADVERT 5 Check Out Who’s Cashed In Weekly - N$5000PT1734 Week 1: Week 2: Helena Ashikoto - Usakos Lazelle Engelbrecht - Walvis Bay Sakalia Ashipala - Windhoek Jafet Iipinge - Ongwediva Romanus Gomaxab - Windhoek Nangolo Job - Windhoek Ipinge Johannes - Okahao Haidula Jesaya - Endola Fabian H Kapolo - Otjiwarongo Gavid Lugambo - Ondangwa Joseph Manase - Windhoek Nankabe Karti - Outapi Gisla Njunozambu - Otjiwarongo Minna Kayiwa - Keetmanshoop William Swartz - Sossusvlei Lazarus Tsuseb - Windhoek Linea Muneguni - Gobabis Armas Uupindi - Windhoek Lazarus Sheelongo - Swakopmund Mweuhanga Shiteni - Windhoek
6 EDITORIAL 27 April - 04 May 2017 RETRO SPECTIVE NGHIDIPO NANGOLO May Day May Day! PIC OF THE DAYThe labour movement seems to have lost the univer- RARE SIGHT: A vehicle crossing the Hoarusib River was almost overcome by the flood while crossing. It is the second time this year that sal strategy to advocate for the workers’ rights andbetter working conditions, hence the distress call, May this river that has its catchment area in one of the driest places in Namibia reached the Atlantic Ocean. Photo: Danie van ElleweeDay May Day, in the wake of the celebrations of theInternational Workers’ Day on Monday, 1 May. THEORY OF INTEREST DESMOND P VAN HEERDEN The fragmentation within the workers’ organisations as THE GRAND FINALEa whole and the daily mushrooming of new unions is a On 26 April 2017, at 2 am Pacific Daylightclear indication of how disorganised the labour industry Time, the Grand Finale began. The 24 December 2004, Huygens was released, the rings of Saturn, piled in bumps of almosthas become. For too long now, the biggest federation spacecraft Cassini started its first dive into and began its decent to Titan. On 14 Janu- 3km high. It captured the first complete viewhas not only been used as a stepping stone for political the space between Saturn and its magnifi- ary 2005, it entered Titan’s atmosphere and of the odd hexagon at Saturn’s North Pole,ambitions, but the practice has consequently enforced cent rings – the first of 22 such dives it will after a two and a half hour descent, landed and discovered giant hurricanes at both poles.a brain drain within the federation, rendering it almost perform before finally crashing into that on solid ground, the first landing ever in the These are but the tip of the iceberg of itsinoperable to carry out its mandate. It has been acting as remote planet. For 13 years, Cassini has been outer solar system. remarkable discoveries.a fifth columnist in favour of some companies and the sending back its remarkable readings andState, against its own members. photographs of Saturn and its moons – the Cassini, now on its own, continued its But all good things come to an end. By latest just two weeks ago, with data that mission of exploration. During the next four 2016, Cassini had started to run out of fuel. To underscore the fact, droves of its affiliated members indicated that Enceladus, the sixth-largest years of its prime mission, it encountered Due to the discoveries made by Cassini abouthave resigned to join other new unions. Nowadays, the moon of Saturn, contains an ocean of liquid Titan 45 times, explored 10 icy satellites the potential existence of life on Saturn’sfederation has been rocked by cases of infighting for water underneath its icy surface, which may and orbited Saturn 76 times. On 15 April moons, it could not be allowed to driftpositions and accusation of exacerbating unemployment. be capable of supporting life. 2008, its mission was extended for another indefinitely and potentially crashing on themThe movement has apportioned itself as the yardstick 27 months, called the Equinox mission. This – it was imperative to protect them from anyto impede the peaceful and beneficial co-existence of Cassini started on its journey almost 20 involved 64 more orbits, 28 Titan encounters, potential biological contamination.employers and employees, and instigating illegal strikes. years ago, launched on 15 October 1997 eight Enceladus encounters, three with other from Cape Canaveral Space Launch Com- smaller icy satellites and an equinox crossing Thus, it now embarks on its final mission, While government has taken a stand against the ex- plex 40 in a Titan IV/Centaur rocket, as the in August 2009. Still, its job was not done, and its most daring one. Climbing high aboveploitation and mistreatment of workers, the federation Cassini-Huygens Mission. A joint project of for in February 2010 it received another mis- Saturn’s poles before diving between theare not linking productivity and performance to salary NASA, the European Space Agency and the sions extension, called the Solstice Mission. rings to plunge close to the planet, beforeincrements. At the same time, political leaders who are Italian Space Agency, it cost about US$3,2 With its mission extended by seven years, climbing up again and repeating it 22 times.also part-time farmers and business owners, have joined billion. Cassini itself was designed and con- it involved another 155 orbits, 54 Titan en- As it does this, it will collect rich and valu-tenderpreneurs as some of the worse employers, exploit- counters, 11 Enceladus encounters, five other able information about the planet’s magneticing their staff while claiming to contribute to employ- structed by NASA, with the ASI providing its icy moon encounters, and the opportunity and gravitational fields, revealing how it isment and economic growth. to observe spring–early summer in northern composed on the inside, and possibly solv- high-gain radio antenna for communication hemisphere of Saturn. ing the mystery of just how fast the interior While several minimum wage agreements in some of is rotating. It will improve our knowledgethe problematic sectors are implemented, it is surpris- with Earth, as well as its radar and its radio The wealth of data Cassini sent back was of the materials in the rings, and help us toing when unions are the first on the bandwagon to shoot enormous. The spacecraft had sent back more understand its origins. All this, while takingsuch declared minimum wages down, claiming it will science subsystem. The ESA constructed the than 500 gigabytes of data, that enabled the ultra-close images of the planets rings andlower wages without taking the majority of the workers publication of more than 3 000 scientific clouds, before finally, on 15 September 2017,into consideration. The labour fraternity lacks serious Huygens probe and lander, destined for Titan, papers, and in its time there had discovered crashing into the planet in a blaze of glory.retrospection to map out a concrete plan of action on seven more moons of Saturn – Methone, Pal- To quote NASA: “It’s inspiring, adventuroushow to maintain sound labour relations in all sectors of Saturn’s largest moon (which is in fact larger lene, Polydeuces, Daphnis, Anthe, Aegaeon and romantic — a fitting end to this thrillingthe economy and assist the country to grow the national and the as yet unnamed S/2009 S 1. story of discovery.”economy in a mutual and beneficial win-win situation than the planet Mercury). Desmond P van Heerden, HonsBCommbetween employers and employees. Besides the discovery of water via plumes (Stell) is the Chief Analytics Officer of Trust- Fitting for a mission to Saturn, these two on Enceladus as mentioned, it also uncovered co Group Holdings Ltd. Previous articles In this endeavour, the ruling party should bring its that Titan has rain, rivers, seas and lakes and available online at http://toi.hopto.org/. Heaffiliated unions to order and not just hoodwink them, were named after those who had made is covered in a nitrogen-rich atmosphere. It can be contacted at [email protected] they are playing on the same side against the discovered that there are vertical structures inworkers they are expected to represent without fear or discoveries about Saturn first. Giovannifavour. Domenico Cassini had discovered the divi- EDITORIAL DISCLAIMER sions between Saturn’s rings, and four of • The newspaper’s views are not necessarily those of its moons, while Christiaan Huygens had our advertisers and the views aired in letters are not discovered its moon Titan. Cassini-Huygens, necessarily those of the newspaper. though, had to travel a bit further than they • Informanté publishes all advertisements in good did to get a closer look, and utilised some faith and cannot be held liable for any misrepresen- quirks of physics to do so. tation, losses or injury to any reader making use of First it dropped into the Sun’s gravity the products or services advertised. well, and approached Venus. On 26 April Newspaper registration: 06/01/119 1998 it did a close fly-by of Venus to get a • Printed by Word Press, Windhoek, gravitational-assist, or gravity slingshot, to Office +264 83 100 1000 place it into orbit around the sun. This was • 260 000 copies distributed monthly to all major not enough, however, and it made a second Namibian towns fly-by of Venus to slingshot it out to the • Headquarters: Trustco House, 2 Keller Street, asteroid belt on 24 June 1999. With the sun’s Windhoek, Namibia gravity pulling it back once more, it was • Contact: Tel. 061 275 4102/8 Fax. 061 275 4090 time for a final slingshot manoeuvre around Email. [email protected] Earth on 18 August 1999 before it finally had • Electronic: www.informante.web.na enough momentum to propel it into the outer solar system. By 30 December 2000, Cassini-Huygens made its closest approach to the planet Jupiter, sending back over 26 000 images, which contributed to major findings about Jupiter’s atmospheric circulation. On its way to Saturn, it further participated in a test of the General Theory of Relativity on 10 October 2003, when its radio waves passed close to the sun, and its frequency shift could be measured as predicted by Einstein. On 11 June 2004, Cassini-Huygens flew by Saturn’s moon Phoebe, returning the first images of that moon. Finally, on 1 July 2004, Cassini-Huygens became the first spacecraft to ever orbit Saturn, after a seven-year jour- ney. Now its work would really begin. On
27 April - 04 May 2017 EDITORIAL 7MSATNOARGEERM: AFINNAXN2CE AREA: Windhoek FlipsideINDUSTRY: Mining and Construction/ OEM CHRIS JACOBIEAINPDPLUICSATTRIOYN: DMEiAnDinLgINaE:n1d7CFoebnrsutaruryc2ti0o1n7/ OEM AREA: HusCaObNTRACT TYPE: Permanent A Change is a HolidaySAAPLPARLYIC: ANTegIOoNtiaDblEe ADLINE: 28 April 2017 CONTRACTJOTBYLPEVEE:LP: erUmpapnereTnatctical NAMIBIA is entering a season of holidays and extended long weekendsSALARY: Negotiable JOB LEVEL: Lower Practical Procedural which were national days when proclaimed, but, as time progressed, theseJOB SUMMARY: holidays in May became events losing their original meaning and thereby JOBTNhSaimsUiTbMaiacMticaAl RLeYv:el Leadership position in the Mining and Construction/OEM Industry manages the Finance Department for Komatsu some of their significance.QUsTAthLaIiFnsBIdC.PCaAroTramdIOciHsNtieocSnda:slww/itoPhrCrkoAcaesdaurSatloLreemvealnpofosritKioonminattshueSMoiuntinhgAafrnicdaC. onstruction/OEM Industry executes This is partly because of the politicising of nearly everything in the Namibian society and partly because the world that Namibians knew isEXPQEURIAENLCIFEI:CATIONS: changing rapidly and has become a different world all together. Grae6dx–epe8r1iye2enacres.at a tactical management level of which 1 – 2 years’ leadership experience and sound management accounting For those Namibians -- who can still afford to go on leave -- the realitySPEECXIFPICERKINEONWCLEE:DGE REQUIREMENTS: and challenges of the nation will remain. But, Namibians cannot afford for common sense to also go on vacation. CA with membership as ACPA or FCPA with the BICA, SAP, J-SOX, IFRS, Komatsu Policies and guidelines relating to Finance, The Workers’ Day was understandably of great significance and there 1 yeCaomr meexrpciealrLieanw,cCeo,mEpxanpyelariwe,nTacxeLainw,aBawnkainreg hLaowu, sAedmeinnisvtriarotivnem/ Peunblti.c law, Intellectual Property Law, CPD with BICA is no denial that organised labour played a monumental role towards Independence and the ideals of justice and an end to human exploitation,COSMPPEENCTeEIgFNoICtCiaIEtKioSNnR, OECQhWaUnLIgREeEDDLe:GadEeRrsEhiQp,UStIrRatEeMgicEPNlaTnSni:ng, New Product/Service Development, Risk Management, Corporate Governance, but Namibia now demands more. ISOC9o0nt0ra1c/ts20M0an8ag(eRmeenmt, aStna)n,daOrdcs cFuorpmautlaiotionnal Health & Safety Act, SEIFSA, High literacy, Computer Equally, Cassinga Day deserves a special day in the Namibian history as itSUMlitMerAaRtYe,DESSACRPIPcTIoOnNfiOrmF aRtOioLEn:s for picking and binning, Search for items – bin history, Printing & tells of the highest sacrifices that were made and more importantly, it also• capHtuorriiznogn Polafnsnitnogc, kHucmoaunnCtapsihtael Meatsna, gMemSenOt, uFitnloanockia,l MSaAnPag-eRmeencte, Civoinntrga,ctVs/aSulipdplDierriMvaenra’gsemliceentn, Csoerp(o0ra8te),GFooverrknalnifcte, , reminds us that Plan fighters were prepared to face even worse and make• OrdILmeiarpislPeomnic-eaknntesdrf,iCnRhaanencigaaelcpMhoalTinciareugsecfmokre,KnCtN, raCamonn. tein.uous Leadership Development even higher sacrifices.• Provides advice/input to management (across legal regimes e.g. tax, Companies Act, transfer pricing, etc.)••• TCeOaMPCMmrooePnnpEdiatuWoTrcarEsttosiNocrponkCama,yIpnrEoldiASallrnfecRocctreEoeivntcQoecaisUfliitnaiInatLRigoniE,ncsbiDtaouelfd:pnmgoieolnitncignitehg,sly&inGRpterheonevesifrsuianiollatnLnssecdegOdeirvrAiiseciocnnotuaannttdisotnhe, Moreover, Cassinga Day is a reminder of the horrors of conflict that organisation Feedback, General Written Namibians should avoid. It buffers peace and stability because memories of war are a great deterrent against violence to achieve any sustainable Receiving goal. It is only those that never fought that always want to fight on• ComPememrpfoluorymnmsiceqanuttaicoloitynnta,rasVcstuesrraabnncadelpbCoylioccioem-somrdiunantiiocnaatinodnre, vWieworokf aPll erimoprliotiyseaettiiomnes,hSeettas,nmdaanradgsemEexntercepuotritoinng., submissions, romantic battlefields and in trenches that are shallow enough so they can•• SUMMMaaMnnaaAggReessYrtheDecoEcnSocrCirleiaRcttiIoPrneTfaleInOcdtiNoancOcoufFrlaetRaevOpea-LyaEmn:denotvsetrotimalel employee benefits providers e.g. medical aid flee when shots are fired in anger.••• MaACMtedho·hern eciitkraoesrlsssatSnoIdOhnpXmrabeocno-dnoudeimtofnilpnridsleniadcn(garrcleecepucaolaenrttdiiionvfngiinnsca,gyndc,celeidabsuliccantoninondnitnrssocglahs,neaddpnuaadlcecscstukaritanuctgoyr)yofadnadtalegislative compliance• As a free nation on the African continent, and with the highest standards• Executes detailed boudgetingAadnhd emroensitotroingwfoarrceahpaocuitysceospt laannd O(pVlCasnography) with regard to the binning of that Namibian leaders set themselves with Independence, Africa Day is a Manages the Accounts Recesitvoabclke, Accounts Payable, Bank Recons and all other roles performed by team members reporting into reminder of Namibia’s continental responsibility as millions of people in this position. refugee camps would want to trade places with Namibians, even for just a• Plans branch visitsowith InteErnxaleAcuuditteasndinliabisoeusnwdithmBraantechrieaslosnhaaudnitdrleipnogrtsactivities day.MANAGER: FINANCE• Whilst the world changes, the Namibian society should adapt as it has so• remarkably done for the past two hundred years and still is today.• AERnsesssiuosrltveienssitmhqeupelperrmieepesanwrtoaaittthiioornnevooeff naamMuunednaoiuattnaucfilitnhthfodionirrnaistgnyscd(iaaaanllslmdtaarnxaedctgyolpiemaeimssae)ensndwdaitphtioaKnpPseMfrrGowminothrthekemtahauandaittgpiesrmomceensitsslestitnerg or does not The Namibia in transformation requires a continuous shift of focus,••AIN PDPULPMISCraeTnApRaaTgYrIae:OtsMioNtnhienDanisEnduAgbsmooDuaoobisLmnsIiNdiosWMnsECioo:oennf1oeCWrttko7ehnalhyflxqyso:Fefturorekcriumrskbecssrctduailoe)naomndrsy/peeaOl2ryygm0Ewee1Mnni7ttcshyt/hbeacakdomridneisrtsratoticokn agaAinRsEtAs: yWsitnedmho(ief k without ever taking the eyes off the target. Namibians are reminded by funCcOtiNonTRtoACcTonTtYrPoEl :dPoecrummaennetnat ion history that the workers and fighters, as well as the early young rebels of Swapo’s international lobby, played during the past 57 years. The world isJO•••S BASLUAPLPMRirra·eeYMispp :oaaAnrrNRaaaYtteiinoo:gdnnOomooufftaitaqanbnuabonaoogruluooeteaemnlrlefdyinnQAaat(nunnPonadcfEUauriiKatcaaenxpnPllkrdnselfMdyiitunnacaGadatguulntafi,ftctinionetnitaraagaryslna;nfacmscionniicayaaauslclsnnptqpacutbuaoeigaraocermalrkumttssceitnsneraylngytdeatormrneimeftveedptinaeohmtwrrsteteesssprsaitaonyodrlsstdatinenihsngmapuanaldtacluihndi)gts JOB LEVEL: Upper Tactical changing fast and Namibia should not be stuck in bad practices that were activities challenges then and remain challenges now. Workers’ Day remind us ofdPAQolPeUcaPuAsmLeLIeICsFnTBNuAtIabhC.aTtmiCmiAsIoOioTtniTbmyNIafiOooacOurHStNirtcUohnScaniBos:llsmMLyroweplIvleiNSetehtSaelasICdLoooOimeAnaNadpdip:cielbaicrtsaeihtdaW(MLioiipanfinabooprtooinCeorsvksehiqeitistrtoiuins@oircizntsrhwlkeeeionodidnjtsotmhah)besemarblteyorMtyqsaauirwungnfiri.oPneiesctmglhpeoloaea.ornztnwnmhrtadstdi.e.KnCwaIopnogamncinatodsahKempttmrsSpenurulecierAtnNttwgieoaiRspamnoat/perrirOrbpodkasilEaicctiMttiaidesohotidaIoaenncnnutdnsoefuriuqwcmsesutinelralmpyclnoomPotipitsnoaepbsneoneriarnnmtcgutogteonnsisitsyt/ocitidhteorHeeemrndemFpodtolior.nlsoeyPdaelnlstereo.cadensrobesoDceaettutptomadmacrihastaematppnclelanthtphatteclftoyihroreelKnedvoamnat tsu being slaves and workers, while a day of wealth on 1 May will remind all and data accuracy of the system Namibians to aspire to rather become wealth creators. Often NamibiansEXPERIENCE: aim too low and therefore are bound to always hit a lower target. 6 – 8 years at a tacotical manRageepmoernttslesvetol ocfkwhiticehm1s– 2thyaeat ras’rleeacdeornshsipisetxepnertileyncme iasnpdlsaocuenddmanagement accounting experience. Workers can contribute to additional job creation through more productivity and difference of opinion without being bombed orSPESCtIFoICckKNcOoWuLnEDtsGE(pREeQrUpIeREtuMaENl,TrSe: gular and ad hoc) persecuted. When tolerance goes, we know that reason is the first to CA·w ith mePmabretrischiippaatsinACgPiAno/er FxCePcAuwtiinthgthpeeBrIpCAe,tuSAaPl,sJt-oSOckX,cIFoRuSn, tKso,moatshueProclicyiecslicanadl gsutiodecliknecsoreulantitnsg otorFaindanhcoe,c follow. It might not be proper and might be misunderstood, but while the CommerciasltLoacwk, Ccoomupnantsy laaws, rTeaxqLuaiwre, Bdanking Law, Administrative / Public law, Intellectual Property Law, CPD with BICA judiciary is an important foundation of the Namibian Constitution andCOMPET·EN CIESFRiEliQnUgIRoEfDa: ll stock count sheets for financial audit review sustainable democracy, it is not the only foundation where supreme power Ne·g otiationW, CohraknsgecLloeasdeelryshwip,itShtrathteegicaPdlamnnininigs,tNraewtioPnrodfucnt/cSteiorvnicetoDecvoelnoptrmoelndt,oRcisukmMaennatgaetmioennt,aCnordpodraatetaGovernance, rests. In a democracy, the power of government does not lie in presidential Contracts Maacncaugreamceynt,oSftathndearsdys sFtoermmulation decrees and court verdicts, but in the hands of the voters. To win a battle inSUMMAR·Y DESCCRIaPpTtIOurNinOgFsRtOoLcEk: count results on the system court might lose the war of credibility. • Ho·ri zon PlaCnlneinagr,iHnugmsatnoCcakpictaol Muanntaogenmseynts, tFeinmancaiaftl eMrangaagienminengt, aCuonthtraocrtiss/Sautpioplnier Management, Corporate Governance, Liaison- and Change Management, Continuous Leadership Development The laws that are adopted in parliament, are not laws to restrict, but•• RemIPmropavlenidmeeSsnattsdovfirinceea/nsincpiaul tptoolimcieasnafogreKmNeanmt (.across legal regimes e.g. tax, Companies Act, transfer pricing, etc.) rather to free Namibians to be the best they can be in a free country with a• Mo·n itors coEmxpeliacnucteetso fWinaInPciaSl ptoolriceiesstion cthke cfinoannctreodlivaisniodn asntod cthke ocroganntirsoaltiofon r tools responsive government.• CPro·enp daurcattsiopnWaayonrodrlklrfesocrocenclocaislsitaientigloy,nbwoufdimtgheotnitnthhgley&Gapedronmveirsaiinol nLissetdrgaetrioAcncofuunntsction to control documentation and data• The courts and various other instruments of the supreme law must• Performs qaucalcityuarasscuyranocfetbhyecos-yorsdtienamtion and review of all employee timesheets, management reporting, submissions, additionally protect the citizens against the excesses of power. It must eMMmaa··npn laaoggyeemssertnMRhetececoaconpionncrotirtlreiraaactctsititnosrnesdafalanepndcmdatpiopaaonclegiccorueiefwrsslaeotaeimrvpkea-mayamnendeddnoitasvsetyterostilmatyelel memsploayseepbeernepfirtos cpreodviuderres e.g. medical aid be said, and even the worst pessimist will agree, that Namibian courts• and judges are of the highest international standard and admired by its• citizens for that.• Checks and monitors calculations, deductions and accuracy of data•• TraMAndoshnepitroeorssrtSotOpoXrefc-doItemefipnmleiadnsrcee/paoSnrtditnofginccaykncclei–aslocaonnndltyrsoclhslieacdnuedlensstsateutdorysatnadflefgislative compliance But in the successes of the courts hides a dangerous precedent that• Ex·e cutes dTertaailnedspbuodrgtestinsgtoacndkmitoenmitosrin/gmfoar icl/acpoacuitryiecorsittaenmd OsVtCossites as required (note: not transport of must be guarded against. The unhealthy amount of political, traditional,• MtPhlai·asnn pasogbseristaiontEphnce.hasAvscicssocietorstunswngitttsehrRarInsentc)eserpnivaoalbrAlteu,ddAirtciavcnoedurnlsiatsiwsPehasyowaibtchleoB,lBrleaancnckthReasencodonndasueadnliitdvreeaplrloonrtthseewr roolersupserefodrmmedabcyhteinaemsmteomrbeerlserveaponrtting into governance and tender disputes involving the government and its agencies• to be adjudicated, is not a sign of confidence in the courts, but rather a• Assist in thseitperesp/abrautiioldnionfgasnnouarl wfinoarnkcisahlsoapndsliaises with KPMG in the audit process motion of no-confidence in decisions, leadership or both.• ERne·ss uorlveessimqCupeloermimeespnwtlaeitthtioernesvoefanaluluedthiat uefitnhndoiernitgcyse(aasnllsdtaarxercytyopmpeams)penedrawtioonrskf,rosmutchhe maasnadgeemliveentrlyettneor tes, logs for receipt of• A culture of democracy by litigation undermines public debate and good• Manages tdheoscuubmmisesniotnso, fetatcx .forms and payments governance. Furthermore, and herein lies the biggest danger, it removes• Pr··ep arationRAadenhpdeosooruritbnmvgeisMWtshoiooiecnnepltkeoholyfly:ldicaymaangdep, rinoccieddeunrtes the incentive for elected officials and political appointees to apply their for driving company vehicles minds, double-check the rules and weigh their decisions, because the or problems immediately courts can still correct. o Quarterly In a nation of great wealth, but inequality, another form of inequality is slowly creeping into the social fabric that should not be ignored. Cases are• APPPLreICpaAraTtiIoOn Nof qSuUaorBteMrlyIASannSndIuOaanlNnfiun: aalnfciniaal;nmciaalnpaagcekmsent reports simmering in court where representatives of government are embroiled• PleaPrseepasrautiobnmoiftanynouualrficnaonmciapllsetatetudtoray [email protected]. Incomplete applications will not in legal action against their own authority and where political leaders of• be cLioainsosnidaendremda.naPgleemaesnet oaf KttPaMcGh fainlalntchiael qruealretevrlay nretvidewoscuanmd eannntuaatlioaundiftsor this role as indicated above in the the same party take each other to court, and where losers of traditional disputes seek the intervention of courts in matters that are supposed toAPPjoLbICAreTIqOuNirSeUmBMenIStSsI.OINn: compliance with the Employment Equity Act, 55 of 1998 preference will be be a tradition throughout the ages.Pleagsievseunbmtiot yosuur citoambplleetecdaapnpdliciadtiaontetoshfrr@omkotmhaetsdue.csoig.znaa. tInecdomgprleoteuappspl.ications will not be considered. Please attach all the relevantdocumentation for this role as indicated above in the job requirements.Komatsu Namibia is an equal opportunity employer. At the current rate, Namibia might soon be administered by hit-and-miss decisions and laws and where bad and illegal actions by appointees and Only Namibian Citizens or Permanent Residence Permit Holders to apply representatives stand until these are challenged in court.Fix-4-Nails® In a house people share because they want to and not because they are forced to, threatened or demonised, but in the Namibian House each and IMPORTANT! everyone in the house are responsible to bring food to the table.Fungus or no fungus, loose and/or damaged When Namibians reflect and celebrate national holidays, they should nails need Fix-4-Nails® to recover. reflect not only on the Namibian House, but a place that all can call home, because it is welcoming and safe even if there is not always enough food The ideal conditions created by Fix-4-Nails® under the nail is for all to share equally. the secret of its success in “restoring by regrowth” of loose and fungal damaged nails. The glorious past of the national holidays must remind us of the challenges of transformation, even of transforming holidays towards a Recovery takes time. glorious legacy. For SUMMER PERFECT nails START NOW! www.loosenails.co.za [email protected] Tel: +27 (861) 999 907Available at and participating pharmacies and salons
8 BUSINESS 27 April - 04 May 2017BUSINESSMARKET RECAP WEEKLY market review RETAIL WORKERSRetail workershave no perks 19 April - 25 April 2017 STILL UNDERPAID NSX STOCKS CODE PRICE % VOLUME VALUE NAMIBIA BREWERIES NBS 33.64 0.03% 72 2 430 AGRA LTD AGR 1.46 42 NICTUS HOLDINGS - NAM NHL 2.00 - 29 - ORYX PROPERTIES LTD ORY 20.96 -DOWN UP BIDVEST NAMIBIA - - LIMITED BVN 7.79 - FNB NAMIBIA - - HOLDINGS LTD FNB 47.30 24 BANK WINDHOEK - - HOLDINGS LTD BWH 17.40 246 TRUSTCO GROUP (0.04%) 1 Latest figures from the Namibian Statistics Agency (NSA) have revealed that in HOLDINGS LIMITED TUC/TTO 3.90 1 468 2016, the wholesale and retail trade industry recorded a 3,4% growth, compared (0.46%) 14 to 8,2% in 2015. (2.50%) 367 Aili Iilonga According to Hamunyela, will go back home and where they employers in the retail sector will sleep is none of their business.COMMODITIES PRICE % GLOBAL INDICES PRICE % According to the report, the continue to avoid paying The wage paid is relatively low,” slow growth in the wholesale employees a decent wage, as he said.BRENT CRUDE OIL 52.10 (5.08%) NSX Local 570 (0.07%) and retail trade sector is mainly they in most cases refuse to payGOLD 1 267.20 (2.08%) NSX All Share 1 067 1.71% reflected in the clothing subsec- employees’ housing and transport Hamunyela added that overallPLATINUM 956.95 (2.35%) JSE Top 40 46 945 1.31% tor that has attributed a gradual allowances. there is a need for an intervention S&P 500 2 389 1.98% growth of 5,3%. from the Inspectorate of Labour toFOREIGN EXCHANGE PRICE % UK FTSE 100 7 276 1.79% “They have a tendency of denounce two types of contracts in Euro Stoxx 50 3 584 5.12% The latest figures were, however, needing workers between 8h00 and the employment place, which heN$ PER US$ 13.05 (1.86%) Hang Seng 24 456 2.22% contradicted by the Namibia 17h00, but as to how the workers says is against the law.N$ PER £ 16.76 (1.82%) Wholesale and Retail WorkersN$ PER € 14.26 (0.08%) Union (NWRWU) secretary general, Victor Hamunyela, who Namibia Breweries again sustained country’s credit quality would result in said the union recorded an increase WORK TOGETHER: Victor Hamunyela; secretary general for NWRWU.its lead in the market this week, with a change to Namibia’s rating. in retail workers, particularly the Photo contributed0.03% growth, closing at N$ 33.64 per clothing sectorshare. It also managed to grab the lead The IMF’s World Economic Outlookin volume, with N$ 2.4 million worth of for April 2017 revealed that they “According to the statistics in theshares traded. Trustco Group Holdings expect a modest economic recovery last census, there are more thandropped to second place, with N$ 1.4 for sub-Saharan Africa, with growth 70 000 workers in the wholesalemillion worth of shares traded. expected to rise to 2.7% in 2017, after and retail sector. As a union we are a 1.5% contraction in 2016. Both not convinced that there is a slow Last week, Fitch Ratings has Nigeria and Angola are expected to growth. In fact, the trend prevailingupgraded Namibia’s National Rating return to positive growth, of 0.8% in this economic sector is that theto AAA from AA+. They also upgraded and 1.3% respectively. Growth is, employers are casualising jobs inNamibia’s senior unsecured bonds however, expected to remain subdued, some stores, 60% temporally andfrom AA+ to AAA. This follows the as commodity exporters still need to 40% permanent employees,” hedowngrade of South Africa’s rating structurally adjust to lower commodity said.from BBB- to BB+ on 7 April 2017. prices.However, Namibia’s outlook waskept on negative. They stressed that Market Quote:Namibia’s rating is sensitive to South “In life, you don’t get anywhere or doAfrica’s, and that a change to either anything you hope to without some sort of sacrifice.”—Stephen SaadN$ to stay linked to ZAR GIPF invest 35% off-shore Zorena Jantze tive outlook rating from Fitch transaction costs. Aili Iilonga The Government Institu- markets. In this way, we ful- should serve as a caution. He stated that the fact that tion Pension Fund (GIPF), fil our local investments ob-The Bank of Namibia (BoN) SAFE: GIPF’s Daylight Ekandjo. as key player in the Namib- ligation and being a pensionremains steadfast in its deci- Zemburuka said that govern- about 60% of goods in Namibia Picture contributed ian economy, has actual fund we are subjected to thesion to have the Namibian ment does not intend to change are imported from South Africa invested international assets same regulations as otherDollar pegged one-to-one the current fixed exchange implies that Namibians would in excess of 30%. pension funds in the country,to the South African Rand rate arrangement between the incur sizeable transaction costs irrespective of the fact thatdespite the neighbouring Namibia Dollar and the Rand, in the process of importing GIPF Acting General we cater for governmentcountry’s downgrade by two because the benefits derived these goods in the event of dif- Manager of Marketing and employees, “she said.rating agencies to junk status. from that arrangement out- ferent exchange rate. Stakeholders’ Engage- weigh the costs. ment, Daylight Ekandjo, In addition, a total of over Last week Friday, the Fitch With regard to the mitigating stated that the fund’s inter- N$3 billion was paid out inrating agency upgraded Na- He explained that de-linking factors to avoid junk status rat- national investments are benefits to members duringmibia’s national rating on the would increase the already high ings for Namibia, Zemburuka monitored closely and have the 2016/17 financial year.South African scale to ‘AAA’ inflation rate. said the Namibian government been performing in line with(zaf), from ‘AA+(zaf). The already has a fiscal consolida- the performance of peers, These include close to N$1outlook for Namibia, however, “Inflation in Namibia is gen- tion strategy in place. as well as the international billion in retirement ben-still remains negative. erally lower than the average markets. The fund’s asset efits, over N$1,3 billion in Namibia Dollar to the Rand, “This consolidation and other value currently stands at annuity, an estimated N$600 Kazembire Zemburuka, Dep- Namibia imports low inflation measures aimed at stimulating N$98 billion. million in resignation benefituty Director of Corporate Com- from South Africa. Hence de- and growing the local economy transfer, close to N$300 mil-munications at BoN, said that linking could compromise this should demonstrate to credit “Despite our international lion in death benefits, N$34Namibia is a sovereign country benefit and lead to high infla- rating agencies that Namibia investments, we are also million in ill-health, overand it is rated by credit rating tion,” Zemburuka said. is committed to pursuing cred- heavily invested locally in N$9 million in funeral ben-agencies based on its own mer- ible policies aimed at turning our equity, bond, property efits and over N$1 million init, but maintained that the nega- He added that presently around the economy,” he con- and unlisted investment resignation benefits cash. Namibians who import goods cluded. from South Africa do not incurEXCLUSIVE PLOTS .. newspapers weekly, country-wide 5 km outside of We distribute 65000 OTJIWARONGO With huge open areas Plots 5 Hectares for N$650 000 Plots 10 Hectares for N$950 000 Plots 20 Hectares for N$1700 000• For that weekend get- away.• Older people who want a quiet• Retirement• Excellent InvestmentOPEN AREAS - WILD LIFE Only a few plots still available CALL NOW!!! Call Marietjie Rich t/a Interprop @ 0817340019www.interpropnamibia.com
8 BUSINESS 27 April - 04 May 2017BUSINESSMARKET RECAP WEEKLY market review Uranium prices fell by 50% last year 19 April - 25 April 2017 RÖSSING PROFITS NSX STOCKS CODE PRICE % VOLUME VALUE DESPITE DOWNTURN NAMIBIA BREWERIES NBS 33.64 0.03% 72 2 430 AGRA LTD AGR 1.46 42 NICTUS HOLDINGS - NAM NHL 2.00 - 29 - ORYX PROPERTIES LTD ORY 20.96 -DOWN UP BIDVEST NAMIBIA - - LIMITED BVN 7.79 - FNB NAMIBIA - - HOLDINGS LTD FNB 47.30 24 BANK WINDHOEK - - HOLDINGS LTD BWH 17.40 246 TRUSTCO GROUP (0.04%) 1 Despite the negative global performance of uranium in spot prices, Rössing HOLDINGS LIMITED TUC/TTO 3.90 1 468 Uranium had a turnover of N$3 billion up from N$1,8 billion in 2015. (0.46%) 14 (2.50%) 367 COMMODITIES PRICE % GLOBAL INDICES PRICE % Zorena Jantze N$ 5,6 million. said Rössing Uranium maintains a Furthermore, an amount of good supply of uranium ore fromBRENT CRUDE OIL 52.10 (5.08%) NSX Local 570 (0.07%) These figures were revealed by its open pit.GOLD 1 267.20 (2.08%) NSX All Share 1 067 1.71% managing director of the Na- N$506,7 million in net salaries andPLATINUM 956.95 (2.35%) JSE Top 40 46 945 1.31% mibian Rössing Uranium Limited wages was recorded. Duvenhage added that the mine S&P 500 2 389 1.98% mine, Werner Duvenhage. has a 10-year framework closureFOREIGN EXCHANGE PRICE % UK FTSE 100 7 276 1.79% Additionally, an amount of N$2,4 plan annual fund project. Euro Stoxx 50 3 584 5.12% Duvenhage said as a major em- billion was spend on goods andN$ PER US$ 13.05 (1.86%) Hang Seng 24 456 2.22% ployer and purchaser of goods and services for operational cost. About the possibility of value ad-N$ PER £ 16.76 (1.82%) services, Rössing Uranium makes a dition, he stated that value additionN$ PER € 14.26 (0.08%) significant contribution to econom- Comparatively, on the global out- in uranium is a prospect mostly ic development and the creation of look, he explained that the uranium under the jurisdiction of govern- Namibia Breweries again sustained country’s credit quality would result in prosperity of communities. market suffered a major collapse in ments.its lead in the market this week, with a change to Namibia’s rating. 2016, following a relatively stable0.03% growth, closing at N$ 33.64 per With regard to their contribution market in 2015. He added that the mines aspira-share. It also managed to grab the lead The IMF’s World Economic Outlook to fiscal authorities, he added that tions for the year 2017 include ain volume, with N$ 2.4 million worth of for April 2017 revealed that they Rössing Uranium paid the govern- “This was due to the emergence fatality-free Rössing Uranium mineshares traded. Trustco Group Holdings expect a modest economic recovery ment N$80,4 million in royalty tax, of additional secondary supplies with an engaged and empowereddropped to second place, with N$ 1.4 for sub-Saharan Africa, with growth N$50,8 million in dividends and and large volumes of new produc- workforce.million worth of shares traded. expected to rise to 2.7% in 2017, after N$107,2 million in PAYE tax on tion in 2016, as well as the very a 1.5% contraction in 2016. Both behalf of employees. slow rate of progress with reac- The Rössing Uranium mine is Last week, Fitch Ratings has Nigeria and Angola are expected to tor re-start in Japan, combined located close to the town of Aran-upgraded Namibia’s National Rating return to positive growth, of 0.8% Payments to public enterprises to cause the market to fall 50% dis, some 70 kilometres inlandto AAA from AA+. They also upgraded and 1.3% respectively. Growth is, such as NamWater and NamPower between January and November from Swakopmund in the ErongoNamibia’s senior unsecured bonds however, expected to remain subdued, amounted to N$392,7 million, 2016, before stabalising at year end Region.from AA+ to AAA. This follows the as commodity exporters still need to which includes the training levy around US$20 per pound,” Duven-downgrade of South Africa’s rating structurally adjust to lower commodity paid to the National Training Au- hage stated. It is partly owned by RioTintofrom BBB- to BB+ on 7 April 2017. prices. thority (NTA) that amounted to group, an international metal min-However, Namibia’s outlook was With regard to future business ing corporation that owns 69% ofkept on negative. They stressed that Market Quote: prospects, the managing director its shares.Namibia’s rating is sensitive to South “In life, you don’t get anywhere or doAfrica’s, and that a change to either anything you hope to without some sort of sacrifice.”—Stephen SaadN$ to stay linked to ZAR Retail workers still underpaid Zorena Jantze tained that the negative outlook costs. Aili Iilonga that there is a slow growth. In fact, the rating from Fitch should serve as He stated that the fact that about trend prevailing in this economic sectorThe Bank of Namibia (BoN) a caution. Latest figures from the Namibian Sta- is that the employers are casualisingremains steadfast in its decision 60% of goods in Namibia are tistics Agency (NSA) have revealed jobs in some stores, 60% temporallyto have the Namibian Dollar Zemburuka said that government imported from South Africa im- that in 2016, the wholesale and retail and 40% permanent employees,” hepegged one-to-one to the South does not intend to change the cur- plies that Namibians would incur trade industry recorded a 3,4% growth, said.African Rand despite the neigh- rent fixed exchange rate arrange- sizeable transaction costs in the compared to 8,2% in 2015.bouring country’s downgrade ment between the Namibia Dollar process of importing these goods According to Hamunyela, employersby two rating agencies to junk and the Rand, because the benefits in the event of different exchange According to the report, the slow in the retail sector continue to avoidstatus. derived from that arrangement rate. growth in the wholesale and retail trade paying employees a decent wage, outweigh the costs. sector is mainly reflected in the clothing as they in most cases refuse to pay Last week Friday, the Fitch rat- With regard to the mitigating subsector that has attributed a gradual employees’ housing and transporting agency upgraded Namibia’s He explained that de-linking factors to avoid junk status ratings growth of 5,3%. allowances.national rating on the South would increase the already high for Namibia, Zemburuka said theAfrican scale to ‘AAA’ (zaf), inflation rate. Namibian government already has The latest figures were, however, “They have a tendency of needingfrom ‘AA+(zaf). The outlook for a fiscal consolidation strategy in contradicted by the Namibia Wholesale workers between 8h00 and 17h00, butNamibia, however, still remains “Inflation in Namibia is generally place. and Retail Workers Union (NWRWU) as to how the workers will go backnegative. lower than the average Namibia secretary general, Victor Hamunyela, home and where they will sleep is none Dollar to the Rand, Namibia im- “This consolidation and other who said the union recorded an increase of their business. The wage paid is Kazembire Zemburuka, Deputy ports low inflation from South measures aimed at stimulating and in retail workers, particularly the relatively low,” he said.Director of Corporate Communi- Africa. Hence delinking could growing the local economy should clothing sectorcations at BoN, said that Namibia compromise this benefit and lead demonstrate to credit rating agen- Hamunyela added that overall thereis a sovereign country and it is to high inflation,” Zemburuka said. cies that Namibia is committed to “According to the statistics in the is a need for an intervention from therated by credit rating agencies pursuing credible policies aimed at last census, there are more than 70 000 Inspectorate of Labour to denounce twobased on its own merit, but main- He added that presently Namib- turning around the economy,” he workers in the wholesale and retail types of contracts in the employment ians who import goods from South concluded. sector. As a union we are not convinced place, which he says is against the law. Africa do not incur transactionEXCLUSIVE PLOTS .. newspapers weekly, country-wide 5 km outside of We distribute 65000 OTJIWARONGO With huge open areas Plots 5 Hectares for N$650 000 Plots 10 Hectares for N$950 000 Plots 20 Hectares for N$1700 000• For that weekend get- away.• Older people who want a quiet• Retirement• Excellent InvestmentOPEN AREAS - WILD LIFE Only a few plots still available CALL NOW!!! Call Marietjie Rich t/a Interprop @ 0817340019www.interpropnamibia.com
27 April - 04 May 2017 BUSINESS 9 CoM contradicts NSA statistics on mining TRUTSRTUCSOTBCOANBAKNINK VINEVSETSMTEMNETNTCOCORRNNEERRTOO MANY $e$tettitnigngFFininaanncciiaall&&MINING LICENCES InIvnev$et$mtmeennttGGooaallss T Taking atikmineg toimceontosicdoenrswidherawt hyoatuywouanwtatnot atochaicehvievaesaas arerseuslutltooffyyoouurr investimnveenstmpreonctepsrsocweislsl gwuilildgeuyidoeuyionudinetdeertmerimniinnginsgpsepceifcicficininvveessttmmeenntt goals. gi.oea.lYs.oiu.er.iYnovuersitnmveesntmt geonatlgsofaolsr mfoor mneoyntehyatthaytoyuo'rue'rseasvaivnigngfofor rMinister of Mines and Energy (MME), Obeth Kandjoze, has lashed at out at the high retiremreetnirtemmeanytbmeadyifbfeedreifnfetrfernotmfroyomuyroguoraglosaflosrfomromnoenyetyhtahtayt oyuou'r'erenumber of mining licence applications coming through his office, explaining that the savingsfaovrinaghformaehdomowendopwaynmpaeynmt.eInnt.aIdndaidtidointiotno thoahvainvginignivnevsetsmtmeennttlarge number effects the demand/supply equation and drives up the demand in the goals fgoorailnsdfoivriidnudaivlifdiunaalnfciniaalnncieael dnseeadnsdadnedsdireessir,eyso, yuoaulsaolsommayayhhaavvee overalloivnevraelsltinmvensttmgeonatlsgofoarlsyfoourryoeunrtiernetpiroerptofortlfio.liio..ei..eY.oYuoummigihght ttrtyryttoocountry. set upsyeotuurppyoorutrfoploiortfsoolitohsaottihtaptriotdpurocdeuscaescearctearitnailnevlevleolfoifnicnocmomee. . Aili Iilonga In deteInrmdientienrmg yinoiungr iynovuersitnmveesntmt geonat lgso,atlhse, trheearreeasrevservaelraqluqeusetsiotinonssththaattSpeaking at the 38th Chambers can heclpanyohuelpanyoduyaonudr fyionuarnficniaalnacidavliasdovrisdoervdeeloveploapnaanpappropprorpiaritaetefifninaanncciaiall of Mines Annual Meeting, plan. Fpirlastn,.wFihrsatt, wishyaotuisr ytiomurethimoerizhonri?zoSne?cSoencdo,nwd,hwahtaist iysoyuoruirnivnevsetsmtmeennttKandjoze said that there are currently risk tolreisrkantoclee?raTnhceir?dT, whihrda,twahraetyaorueryloiuqruliidqiutiydinteyendese?dsO?nOcnecyeoyuo'uv'eveaannsswweerreeddabout 507 licences that have been those qthuoessetiqouness,tyioonus,cyaonubceagninbetgoinwteoigwheitghhetthhertehereperipmriamrayriynivnevsetsmtmeennttrecommended for approval out of goals: gGoroalws:tGhr,oIwnctoh,mInec,oamned, SantadbSiltiatbyiolitryporor pterocteioctnioonfopfripnrcinipciapla, lt,otoabout 1 060 that are still pending determdienterhmoiwnethooswelteocsteslpecetcsifpiecciinfivceisntvmesetmntesntthsatthatrearaepapprporporpiaritaetefoforryyoouurrfrom April last year to February this financifainlapnlacina.l plan.year. “The piles that come to me for INVESINTVMEESNTMTEGNOTAGLOSA: LGSR:OGWROTWHT, HIN, CINOCMOEM,ES,TSATABBILILITITYYsignatures are scary. There are justfar too many licences coming to me. Once yOonuc'veeyodue'tveerdmeitneermdiynoeudryfoiunrafninciaanlcgiaolaglosaalsndanhdohwowyoyuorutritmimeehhoorirzizoonn,,At the rate that people are applying risk torleisrkatnocle,raanncde,liaqnudidliiqtuyidnietyednseeadfsfeacftfetchtetmhe,mit,'sitt'simtime teotothtihninkkaabboouuttfor licences, we won’t have mines how yohuorwinyoveusr tinmvesnttms emnitgshmtihgheltphyeolpuyaocuhaiechvieevtehothsoesgeogaolasl.sW. Whheennfor long,” said Kandjoze.At the same meeting, out-going considceorninsgidaerninyginavneysitnmveesntmt,eynotu, 'yllonue'llendeteodtthoitnhkinakbaobuotuwt hwahtatititooffefersrsininChamber of Mines (CoM) President, MINING GURUS:Minister of Mines Obeth Kandjoze and out-going Chamber of terms toefrmthsreoef tkhereyeinkveeysintmveesntmt genotalgso:als:Kombadayedu Kapwanga, said that Mines President Kombadayedu Kapwanga. Photo Aili Iilonga • Grow•tGhr:oIwn tihn:vIensitninvegsteinrgmtse,rmgrso,wgtrohw(tahls(oalksonokwnonwansacsacpaiptaitlaldespite uranium prices experiencing apprecaipaptiroenci)aitsioann) isnacrneianscereiansethine tvhaeluvealoufeaonf ainviensvtemstmenetn;ti;ninotohtheerrits worst performance in 12 years, Namibian Statistic Agency (NSA) “The Chamber of Mines is in words,wyoorudsc,aynousecallnitsefollritmfoorremtohreanthyaonuypoauipdafiodrfoitr. iYt.oYuorucracpaiptiatlailsisththeeNamibia has performed averagely moneymyoonueypuyotuinptuotainntoinavnesintvmesetnmt einittinailtlyia.lly.and expects some increase in the latest report on the mining sector that disagreement with the reported • Incom• Ien:cSoomme:eSionmveesitnmveesntmtsemntaskmeapkeeripoedricodpiacypmayemnetsntosfoifnitnetreersetstoorrnear future. indicates that the sector made a direct preliminary overall contraction“Swakop Uranium’s Husab mine contribution of 11,1% to Namibia’s of mining by 6% and disputes the dividenddivsid. eTnhdoss.eTphoasyempeanytmsernetpsrerespernetseinvteinsvtemstemntenintcinocmome,ew, whihcihchcacannbbeeproduced its first barrel of uranium GDP, but contracted by 6% in real overall GDP contraction of 11,1%.last year December, marking a terms. While the contraction for diamonds spent osprerenitnovrersetinevde.sFtoedr .pFeonrspioenseirosn,einrsc,oinmcoemoebvoibovuiosulysliys ias kaekyeyininvevesstmtmeennttmonumental event on Namibia’s of 9,6% may have been accounted goal, bguotailt, bcaunt ibt ecainmbpeoirmtapnotrtfaonrtoftohreorthreear sreoanssonas awsewlle. lil..ei.eI.nIcnocmomeemining timeline as the world’s This contraction was primarily for correctly, the chamber negates paymepnatysmceanntshecalpnthoelbpatloanbcaelatnhce timhepiamcptaocfttohfethfleufcltuuctautaiotinonofoaf aggrorowwtthhsecond-largest uranium mine came a result of the decline in diamond the contraction of 1,2% posted for orienteodrieinnvtedstinmvensttm. ent.into production,” he explained. output and base metal production, mental ores as this also includes • Stabi•liSttya:bTihlitisy:isThsiosmisestoimetsimkneoswknnoawsncaaspcitaaplitparlepsrersvearvtaiotinonoropr rporoteteccttioionn more specifically for zinc and lead, production of copper and gold of prinocifpparli.nAcinpailn. vAensitnmveesnttmtehnatttfhoactufsoecussoens sotnasbtialibtiylitcyocnocnecnetnrtartaetseslelesss Kapwanga, however, added that which are allocated significantthe CoM is in disagreement with the weightings in the National Accounts. alongside zinc and lead,” he said. on incroenasinincrgeathsiengvathlueevoalfutehoafttihnavteisntvmesetnmteanntdanmdomreoroenotnrytrinyigngtotoeennssuurere that ittdhoaetsitnd'toleossne'tvlaolsueev.aIlfuyeo. Iuf ypolaunptlaonstpoesnpdenadcaerctearitnaianmamouonutntofofmmoonneeyy soon asnodonwanndt wtoamntatkoemsaukreestuhree mthoenmeoyniseythisetrheewrehwehneynoyuonueneedediti,ts, statabbiliiltityy SOUTHERN AFRICAN DEVELOPMENT COMMUNITY (SADmC)ight mbeigyhot1ub2re6pyroimuraprryiminavreysintmveesntmt genotagl.oWal.itWhiethacehacinhdinivdiidvuidaulailnivnevsetsmtmeenntt,,Namibia ranked 81st in protecting investorsDoing Business 2017 Zorena Jantze inefficiency at the municipality, while transferring prop- there itshaerreeliastaiorenlsahtiiopnbsheitpwbeeetnwgeeronwgtrohw, itnhc,oinmcoem, aen, adnsdtastbailbitilyit.yT. hTehemmoorereaann erty was made more expensive for companies. investminveensttmofefnertsoifnfeorsnienoofntehoofstehoasreaasr,etahs,etmheomreoyreouyomu mayahyahvaevetototrtaraddee off in toefrfminstoefrmthseoof therotwheor.tTwhoe. TkheeykteoysteotstientgtiningviensvtemstmenetngtogaolaslsisistotoNamibia has been ranked eighty-first in the world The reasons given for the country’s low performance tailor etaacilhorineavcehstinmvesnttmtoenwt htoatwyhoaut ywoaunwtaitnttoitdtoodforfoyroyuo.u. You mYaoyuchmoaoyscehtooosheatvoehaavseinagsleinignlveeinstvmesetmntegnot aglofaol rfoargaivgeivnenfifninaanncciaialltwioitnhtrheagtarredflteocttshtehpartottheectmioinnoorfitinyviePnsRvteOosrTtsoE,rCasTpiInNostGih-eMINORuwITsieYthoIrNfecgVoaErrSpdoTtrOoaRttehSeaspsreotstefcotriopnerosfoinnavlegsatoinrs, is due to mis- goal, agsoianl,tahseinextahme epxlaemopflme oafkminagksintgabsitlaitbyiliatypariopriotyritfyofrosrhsohrotr-tt-etremrm less securitiescountry lack protection from conflicWtshoefreindteorethstearnedgionr’segeucloatnioonmaiends sctaapnitdaltmodaarkye?ts. Effective regulations define related-party transac-shareholders rights in corporate governance. b2u0s1i6neWssoirnldNHiCnBooamawmenmsciktoubronniGoniatgmy.roaier(usSepAinDivrnCee)s-?tSoorTuphtrehoetgrertnclieotoibqonAaunlfssriiracrpeagarnmnaekinciensiDngtsessteveslel,oyfl-ofr,deppetqmahrlueoeinsnimgerteostehnemacociorntlenoemohraimetoryaylaisd’nusnverdeersrtpeaeolfaglrfsuria,tclsaaipictheieoiicngpnthtassetdrrieiorlsoaanncftfkeleiiodrnnsgtumodsrotaetrehojseonignrpderrimbocataetoecilntantivhoneeanstcytbmaeoo.narfOoalanrmneycoyoe.nuOagmrmsyoatoanyubgpmislrieattayfybe,pirlrnitetcofyoe,crminotcmoeo,cmbaoinmen,debagisnnredeovwgserertovahwel rstianholvsitenohsvattehmtsatyemtonyueotnsumttsmaotxaoaixmcaimhcihziiezieevevyeyeoaouaurr This is according to the prarontkeicntgioseouncogfingesoecsmdoteiaentnsoeaormnnmsitweihnesereso(dtfrnigenugreth7.o1fda).icenWccvheoiissluteionotrhtnpaesrboinoitdlefiicctttyaihotoenfroicndrodoceemxos pmapnpayrnoatyencitdniossniesdtaegdrasei.ntastilseedlf-dsetaalnindgairndtsheoafreasosmuveeiatsrsuarlyelsodoruv.ueeittrrsuafilyrlnnorasuentraucftirnanaalslngeacovtiaealllgooeorvfaegrlliosooakrflgsrtioh.sakaltsth.yaotuy'roeuc'roemcofmorftoarbtaleblwe iwthithananddththaattport on the ease of doing The report explains that thestrength of minority investorby sorting their distance to frontier scores for protecting inCSooGmurtahmpehrunnoAintfryihc(oaSnwADDeecCvoe)lnoroapmnmkeienostnCintohmSemosuutntrheiteynrg(nStAhADofCrf)icirnaanvnkeDsoetnovtrehelporspotrmteenecgn-tht tion index.minority investors. Figure 7.1 How economies oAf idnvdesittoiArodndailtqiouneasltqiouensstitooncsotnosciodnesrider • Ho•w mHouwchmmucohnemyodnoeyydoouyhoauvheatvoeThe extent of conflict of interest regpurloatteicotinonininddeexx, with itnoviensvte?st?ratings from 0 to 10, rated Namibia at 5.7, South Africa • W•hatWarheatyoaurer ysoouurrscoeusrocefsinovfeinsvtmesetmntencat pcaitpailt?alD?oDoyoyuouhhaavveeaaat 8.0, Mauritius at 7.7 and the Democratic Republic of lump sluummp, sourmw,ilolrywoiull byoeuinbveeisntviensgtirneggruelgaurlyaralynadnsdyssytsetmemataitciacalllyly??Congo at 3.7, while the regional average is 5.6. High values indicate stronger regulation of conflicts of • Ho•w mHouwchmpurcohfiptrdoofitydoouynoeuendeaend iannviensvtemstemnetnttotgoegneenrearatete??interest. • W•hatWishyaotuisr ycouurrecnutrriennctoimnceomtaextbarxabcrkaectk?et? Economies with the strongest protections of minorityinvestors from self-dealing require detailed disclosure WHY WINHVYEISNTVWESITTHWTITRHUTSRTUCSOTBCOANBAKN?K?and define clear duties for directors. • Yo•ur CYaopuitraClaipsitGaul aisraGnutaeraendteed They also have well-functioning courts and up-to-date • Co•mpeCtoimtivpeetIintitveereInstteRreastteRsatesprocedural rules that give minority shareholders the • Se•curiStyecuritymeans to prove their case and obtain a judgment within • No• moNnothmlyonfethelsyoferecsoomr mcoimssmioisnsciohnacrgheadrgeda reasonable time. • Ex•clusEivxeclucusisvteocmusetrosmeervrisceervice • Re•putRabepleutBarbalnedBrand According to the report, with regard to the ease of do-ing business, Namibia made transferring property moreexpensive by increasing the transfer and stamp duties. REQUIREQMUEINRETMS ETNOTOSPTEONOAPETNRAUSTRTCUOSTBCAONBKANINKVINESVTEMSTEMNETNATCACCOCUOUNNT:T: The country also made paying taxes more complicated FOR ADFUOLRTASDULTS – ID or V– aIDlidorPVaaslsidpPoartssportfor companies by introducing a new vocational educa-tion and training levy. FOR MIFNOORRMSINORSIn addition, the process of dealing with construction – ID/ Va–liIdD/pVaaslsidpopratsospfopratroefnptaarenndtcahnidldc’hsifldu’lsl fbuilrltbhirCtehrCtiefritciafitcea.te. – Guard–iaGnu’asrIdDia/n’VsaIDlid/ PValsidspPoarsts,pGourta,rGduiaanrdsihainpshLieptLterttaenrdanCdhCilhdi’lsd’FsuFlul lBl iBrtirhthpermits became more time-consuming as a result of CertificCaetert.ificate. MMEAMESEUAARSUESRTEUOTGOREGTEEHTEHRTEROGETHERSource:DoingBusinessdatabase. ACAHCIAECVHHEIEISVEUECVSCUEECSCSESSSUCCESS PARTPNAERRTSNIENRPSEINRSPOERNSAOLN&ALC&OLCLOELCLTEICVTEIVWE WEAELATLHTHCRCREEAATTIOIONN P invesitn@[email protected]|.nTa: +| T2:6 +426(04)(601)6413443848858050| w| wwwww.t.btbnn.n.naa
10 COASTAL 27 April - 04 May 2017COASTALSOLDIER CAUGHT WITHNo end in sight in illegal poaching of rhinosHORNS Save the Rhino TrustA senior officer of the Namibian Defence Force based in Grootfontein will have to gets supportstay behind bars along with two other suspects after recently being caught red-handed with rhino horns in his possession. Staff Reporter Binoculars, valued at N$12 000 each. The binoculars have powerful infrared Niel Terblanche Intervention in the form of sponsorships is always needed to battle the ongoing illumination, digital zoom, camera andThe officer, Lieutenant-Colonel ENDANGERED: Photo for illustrative purpose. Photo contributed scourge of rhino poaching that occurs video recording function, which make it Petrus Damaseb, was arrested in Namibia almost on a daily basis. ideal for monitoring and evaluation ofalong with Steven Omeb at a fuel- initial appearance in the Otjiwaron- those of Damaseb and Omeb. rhino in their natural environment.ling station in the central business go Magistarte’s Court on charges re- The three accused persons were Cymot have been supporting thedistrict of Walvis Bay last week. lating to the possession and intent to Save the Rhino Trust (SRT) since 2015 “For more than 30 years, SRT has trade in protected animal products informed by the court that they will with an annual sponsorship of N$100 worked tirelessly to protect the desert- In their possession were two fresh- before being transferred to Walvis be able to formally apply for bail 000, which is given in the form of adapted black rhino of the Kunene andly cut rhino horns wrapped in tin Bay where his case was joined to before their next court date during much needed equipment and tools and Erongo regions. From the point of nearfoil. The horns still had the blood of proceedings in Walvis Bay. directly distributed to the SRT’s team in extinction, the rhino population has re-the slain animal on them when the the field. bounded and SRT is proud to be part ofpolice confiscated the contraband. A this success. But we owe much of ourthird person was arrested during the “Our business is based upon the success to our supporters and we areincident but after being interrogated desires of people to explore Namibia’s extremely grateful to Cymot for theirby the police it was found that he wide-open spaces and our special dedication in supporting our efforts,”was not involved in the case. wildlife. For the last two years, we have said Simson Uri-Khob, CEO of SRT. been supporting Save the Rhino Trust A fourth suspect, Champion because we believe in the work they Save the Rhino Trust was founded inKapans Haraseb, was arrested in are doing and it is imperative upon us 1982 with the mandate to monitor andOtjiwarongo, a day after the initial as a company to give back,” said Axel conduct research on the desert-dwellingarrests in Walvis Bay. Theissen, chief executive officer of the rhinos in the Kunene Region. popular chain of retail outlets. Damaseb and Omeb made their With support from the Ministry of En-first appearance in the Walvis Bay The recent donation was sparked vironment and Tourism, WWF, IRDNC,Magistrate’s Court last week and through a campfire conversation at last NACSO, conservancies and local com-were remanded in custody until year’s RMB Ride for Rhinos, where munity members, SRT is proud to betheir next court date scheduled for SRT trackers voiced their needs and part ensuring that the rhino population18 June this year. Haraseb made his requested binoculars that would make it has grown and expanded over the past possible for them to improve their work three decades. in the field especially at night. Save the Rhino Trust is the only rhino Cymot stepped in and handed over conservation group in Namibia that five night vision Bushnell Equinox Z has a Memorandum of Understanding with the Ministry of Environment and Tourism.Republic of Namibia MINISTRY OF INDUSTRIALISATION, NAMAs excitement at TRADE AND SME DEVELOPMENT the coast VACANCY NOTICEDEPARTMENT: TRADE AND COMMERCE Niel Terblanche talent. Music and art play an importantDIRECTORATE: INTERNATIONAL TRADE role in everybody’s life and some of theDIVISION: TRADE AGREEMENTS The Namibia Annual Music Awards most popular music and songs from thePost Designation: Deputy Director Grade 4 (NAMAs) that will take place at liberation struggle has its origin in ourSalary Scale: N$ 438 734 – 461 242 Walvis Bay over the coming weekend town,” he said.Motor vehicle allowance: N$ 25 751 per annum has moved the coastal community intoRunning costs: N$ 71 916 per annum high gear with regards to prepara- Wilfried added that music has theCapital costs: N$ 97 667 per annum tions. ability to break down barriers and uniteTotal allowance: N$ 68 188 per annum people from all walks of life.Housing allowance: Windhoek On social media, several traders have1 x posts: begun to advertise specials on Brazil- The awards will take place at the ian hair extensions and various items Namibia Development CorporationMinimum requirements: of clothing like dresses and shoes. One building situated in the industrial area ofA B - Degree at NQF Level 7 plus nine years appropriate experience. opportunistic ‘entrepreneur’ has even Walvis Bay. gone as far as advertising tickets for saleEnquiries: Mr. B. Katjipuka at a very special price on one Facebook “We are excited about hosting the Tel no: 061 – 283 7331 forum to those who would like to attend. NAMAs in Walvis Bay for the very first time,” said John Ekongo, one of theDIRECTORATE: GENERAL SERVICES This is despite rules clearly stating organisers of the event.SUBDIVISION: HUMAN RESOURCE DEVELOPMENT that tickets should only be bought fromPost Designation: Chief Learning and Development Grade 6 recognised vendors. “We are glad that the leadership atSalary Scale: N$ 301 045 – 359 778 Walvis Bay understands the importance1 x post: Windhoek During the announcement that the that such big events play in the local prestigious red carpet event will take economy and reputation of the townMinimum requirements: place in Walvis Bay about two months and have therefore embraced it. WeA B - Degree in Public Administration, Human Resource Management or Development plus five years ago, Immanuel Wilfired, the mayor of would like to encourage the residentsappropriate experience. Walvis Bay, officially welcomed the from Walvis Bay and the entire Erongo organisers of the prestigious NAMAs to Region to be part of history by attend-Enquiries: Mr. M. G. Kuyonisa the coastal town and said it is heart- ing the event. We are also extending an Tel no: 061 – 283 7337 warming to see that the port city’s invitation to all Namibians to join us to popularity is increasing as a destination celebrate the best that our music indus-Attractive range of benefits includes housing allowance, transport allowance, pension and medical aid fund for similar events. try has to offer when we convene at theas well as ample vacation and sick leave. Public servants must apply via their Office/Ministry/ Agency and coastal town,” concluded Ekongo.submit their application form under cover of form ZO/352 {1}. “Our excitement to host this prestig- ious event is drawn from the fact that The NAMAs is scheduled to take place Walvis Bay and its residents want to on Friday, 28 April when the invitation- play a role in the appreciation of local only Industry Awards will be given out and on Saturday, 29 April, the public will be allowed to share in the festivities of the main awards.NB! Failure to complete all items on the applications form (156043), and not attaching all the necessary certifieddocuments will disqualify the application. Foreign qualifications must be evaluated by Namibia Qualifica-tion Authority (NQA) and proof of evaluation of qualifications should be attached.CLOSING DATE: 29 MAY 2017 FOR ALL YOUR ADVERTISINGADDRESS: THE PERMANENT SECRETARY CALL 061 275 4713 | MINISTRY OF INDUSTRIALISATION, TRADE AND SME DEVELOPMENT 061 275 4714 | 061 275 4715 PRIVATE BAG 13340, WINDHOEK
27 April - 04 May 2017 COASTAL 11WOMAN KILLED IN FREAKSecond woman was seriously injured on her legsACCIDENTA woman was killed in a horrific freak accident when a boundary wall of a well-knownmeat supplier in the industrial area of Walvis Bay collapsed on top of her. Niel Terblanche debris of the two metre high boundary the police mortuary. A second woman TRAGEDY: Members of Nampol load the mortal remains of the woman who was wall to get to the remains of the sustained serious injuries to her legs killed when a boundary wall collapsed on her. Photo: Niel TerblancheThe wall collapsed after a truck deceased person. According to eye during the freak accident and was delivering meat bumped into it witnesses, the deceased was waiting taken to hospital by an ambulance forwhile the driver tried to reverse out for the factory shop to open and was further care. Deputy Commissionerof the yard of the factory shop. The Erastus Iikuyu, the Erongo regionaltruck belongs to Dikwels Transport sitting on the sidewalk against the crime investigations coordinatorfrom Mariental. of the Namibian Police, confirmed wall that collapsed on top of her. the incident and said the family On the scene of the accident A chorus of anguished voices of the deceased person still has tohorrified onlookers watched as be notified of her death. He said amembers of the police dug into the sounded up from the group of women case of culpable homicide has been that waited at the entrance of the opened. butchery along with the deceased person as members of the police loaded the body into the vehicle ofBotswana explores Nam export Desert rivers reach the seaopportunities west of the scientific research Niel Terblanche installation. After Swartbank, the water Staff Reporter started seeping away underground. Sustained rainfall over the Khomas A tour guide for Uri Adventures,With Walvis Bay set to become the HUB: Aerial view of the port of Walvis Bay. Photo contributed Hochland in the catchment areas of Danie van Ellewee, said the Hoarusibpreferred logistics hub through especially the Kuiseb River caused River, which has its catchment areavarious transport corridors for from Botswana to Namibia in non- Moagi said the expectation is that water to start flowing again. in the dry area to the north and east oflandlocked countries within the diamond related exports. the deals being negotiated will have Puros, was flowing strongly. He saidSouthern African region, a recent long term positive effect on trade Along with the Kuiseb, two other the water was very high and that hefact-finding mission by companies The recent relocation of Diamond flows from Botswana to Namibia. rivers flowing through some of the had a few moments where he worriedlocated in Botswana are expected to Trading Company (DTC) to harshest desert areas in the world about crossing the river without beinggenerate export business potentially Gaborone resulted in Botswana The fact-finding mission has reached the Atlantic Ocean again after washed away.worth millions of dollars. exports to Namibia growing by 123% established that some of the products good rains in the catchment areas. Both between 2011 and 2015. Namibian and services needed in Namibia are Hoarusib and Ugab Rivers flowed On his way south on the coast he also Botswana Investment and Trade exports to Botswana are dominated by electrical fittings, face bricks, plastic strongly and travellers had to exercise crossed a flooding Ugab River. VanCentre (BITC) Director of Corporate diamonds, which come to Botswana water tanks, sorghum meal, mining caution while crossing the streams at Ellewee said the muddy conditions ofCommunications, Kutlo Moagi, for beneficiation. conveyor belts, vinyl floor tiles and the most unexpected spots. the two rivers were very tricky.said the organisation provided firms waste water management solutions.with a platform to explore export “The low base of trade in non- The Kuiseb River has been flowing “It is a very rare sight to see bothand partnership opportunities in mineral products provides Botswana Namibia is in close proximity to steadily since Saturday and reached as those rivers reach the ocean. Onlyneighbouring Namibia. with an opportunity to grow its Botswana and the Trans-Kalahari far as the Gobabeb Research Station. very few people have ever seen such product portfolio in the Namibian highway provides good connectivity a sight and that makes me feel very “Although it is still too early to market,” said Moagi. Some to the Namibian market. The transport The water even reached the privileged,” he said.estimate the amount of business companies have already received corridor also connects Botswana Swartbank area, which is 25 kilometresthat will be generated, it is worth requests for quotations while some directly with the port of Walvis Baynoting here that the potential buyers, are already negotiating agency which holds even more opportunities ALL THE WAY: The mouth of the Ugab River made for difficult driving conditionsidentified during the fact-finding agreements. for exporters from Botswana. after it also reached the Atlantic ocean in the past week. Photo: Danie van Elleweemission, include mostly the biggestproduct distributors with a widefootprint in Namibia and significantmarket share as well as governmentinstitutions,” Moagi said.In 2015,Botswana’s share in Namibianimports was about 12%. Unprocessedindustrial diamonds and the restaccounted for 97% of the exportsOliver Muhau SMS: EDU to 711BED Honours Degree graduateI graduated with a Teacher’s Diploma from the a Bachelor of Education Honours (BED Honours)University of Namibia in 2012, but could not study Degree (I was one of the first intakes). It was notfurther due to financial obstacles. I then learned easy but I never lost focus. I completed the courseabout a 100% financing scheme with easy and in September 2016 and graduated this year, 2017. Iflexible payment plans when one studies through am very proud to be the first student to graduateIOL. I registered without hesitation for an Advanced with a BED Honours from IOL.Certificate in Secondary Education, majoring inBiology and History for Grades 11 and 12 through With Distance Education, you need to be patient,one of IOL’s Marketers (David). focused and determined. All in all, I now feel more academically mature and motivated to contributeThrough hard work and hands-on assistance from to the betterment of our country. Thank you IOL forthe IOL staff, I completed the Advanced Certificate the changes you brought into my life, your coursesand graduated in 2014 and soon after registered for are rewarding.Contact us today for more information:Call Centre +264 61 270 9100 • Email: [email protected] • Website: www.iol.na
12 NORTH 27 April - 04 May 2017NO FINANCIAL BUDGETRelocated and forgotten by councilFOR OSHIKOOshiko residents are complaining about the lack of development in their area after the Ongwediva Town Council yetagain failed to include the location in the financial budget for 2016/17. Maria David son Muma of ignoring them “I use close to N$200 old David Nghuulikwa said council serviced the area MAIN SUPPLY: NORED transformer in whenever they approach every day just to refill the that he was told by NORED with roads, sewage and Oshiko. Photo Maria DavidThe residents demanded the town council to inquire generator, once the petrol is that they can’t give him water. that town council about service delivery at the finished I am forced to refill electricity as they live in arepresentative explain to informal location. to ensure that my household township. Muma added that thethem what they meant by is not left in the dark,” said residents of Oshiko haveland service delivery as Janie Mumbangala, 37, Mumbangala. They further requested that not been forgotten and thatthey continue to go without said they are tired of the way if nothing else, that town council will provide toelectricity and have been town council keeps on treat- Mumbangala added that council at least put up street- them other services, once itexcluded from the town ing them. they have lodged several lights for them to ensure is done with other areas incouncil budget for the past complaints to the town coun- their safety at night. Ongwediva.five years. She added that she now cil and NORED about resi- depends on a generator for dents syphoning electricity When approached for He also assured them that They further accused Ong- electricity, which has over from a nearby transformer. comment, Muma said the electricity will be installed,wediva spokesperson Jack- the years put a dent in her residents were relocated but couldn’t give an indica- finances. Another residents, 50-year- to Oshiko in 2014 and that tion of when exactly.UNAM promotes Informal vendors trained on food safetyfood security Maria David tionally or exported to other countries. and quality management in order to The manager responsible for food strengthen the capacity of the food Maria David He added that these efforts INFORMAL food vendors this month handlers,” he said. deserve sustained support to ensure received training on food safety and safety and standards at AMTA, Salo-The UNAM Ogongo Campus is food self-sufficiency through the customer care at the Rundu and Ong- mon Tsanigab, said the overall objec- Currently, safety guarantees on foodpromoting food security through correct choice of crops, seeds, wediva Fresh Produce Business Hub. tive of the NFSAP is to create national products traded nationally or exportedresearch in crop science and irrigation methods and agricultural awareness on food safety and hygiene to other countries is being carriedtechnology. mechanisation. The Agro Marketing Trade Agency procedures which is to be adopted out with the assistance of Ministry of (AMTA), together with the Food and by consumers, food businesses, and Health and Social Services, Ministry During the UNAM gradua- Ogongo Campus has also initi- Agriculture Organisation (FAO), operation and street vendors in order of Urban and Rural Development,tion held in Ongwediva last year, ated long-term studies to monitor conducted workshops in Rundu and to ensure food safety. Food and Agricultural Organisationformer President Hifikepunye the effects of different modes of Ongwediva focused on food safety to and the Namibian Informal SectorPohamba pointed out that food mechanised ploughing, as well as the informal food venders. “Vendors have been trained to gain Association.security remains a top priority, and the effects of crop residue manage- skills and knowledge on food safetyas a result the Ogongo Campus ment practices on the quality of A total of 21 informal traders werealso assists farmers in Omusati and soil and crops yields which will trained at Rundu, while 19 were MERCHANTS. Photo for illustrative purpose only.other regions to grow both rice and help promote sustainable farming trained in Ongwediva under the theme:mahangu. and food security in the country. “strengthening controls of safety threats, plant and animal pests and Pohamba further urged local Pohamba noted that through this disease for agricultural productivitybusinesses to support the Kalim- project, local communities, includ- and trade in Southern Africa.”beza National Rice Project near ing learners, students, farmers andKatima Mulilo in the Zambezi researchers, were trained in rice The programme is aimed at sensitis-Region in order to contribute to the cultivation. ing food traders on the importance ofeconomy of the country. food safety and quality in relation to As a specialised crop science trade, health, safety, consumer protec- The project was started in 2007 campus, the Ogongo Campus is tion and a sustainable environment,as scientific research under the also expected in the long run to while at the same time promoting theUniversity of Namibia by late pro- assist in the mechanisation of use of best practices in every processfessor Luke Kanyomeka and grows agriculture in the communal land towards the value chain.three varieties of rice, namely the in Namibia.Supa, Irga and Angola. In 2015, the AMTA revealed plans to introduce the National Food Safety Policy (NFSP) aimed at guarantying safety of all food products traded na- Organic Olive Joedir Revlon RelaxerOil Wrap Mousse HH 28pcs SuSpuer / Regular / 207ml all colours Mild 225ml8495 12495 1795 Perfect Choice Nobel Disney Navi Brazilian Oil Sheen Spray Weave Wave 14, 16, 18 240ml 3495 & 20” 1795 4495 Magic Monica 5295 Joedir Black Pearl Deep Tider Water Sta Sof Fro Wave 8”Special Blend 15995 Joedir 104Nina Soft Dread 95 250ml Nature Darling Yaki Braid Colour #1B Straight 56952595 Wave 8” Magic BG Regina Darling Freedom Darling Mini all colours Hollywood all colours 6495 5195 1095 Prices valid 27 April to 14 May 2017 all colours 13995 5995 CBD, Namlex Chambers, Shop 4 Channel Life Tower, Shop 29 Shoprite Centre, Shop 4 Pick n Pay Centre, Ongava Street, Omongo Street, Etetewe Street,Independence Ave, Whk. Independence Ave, Post Street Mall, Whk Katutura, Whk. Katutura, Whk Okuryangava, Opposite Wanaheda, Katutura, Ombili, Katutura, Tel: 061 242 640 Tel: 061 264 677 Tel: 061 257 342 Shell Service Station, Whk. Opposite Hilton Hotel Whk. Whk. Whk.
27 April - 04 May 2017 NORTHERN 13 Landowners fail to develop their land hence actionTOWN COUNCIL STRONG-ARMSLAND OWNERS Medipark aims for more students Maria David elevate the standard of health- and experiences to enhanceOshakati Town Council has denied land beneficiaries the chance to ap- care in Namibia to be in line their teaching capacity.point their own contractors for building their houses after the awarding THE Ongwediva Medipark with proven global trends andof land by the council. has become the first private the Namibian health needs. Inaugurating the training, hospital to train students UNAM Vice Chancellor, Prof Maria David studying medicine, nursing “Government alone can’t Lazarus Hangula noted that and pharmaceutical at the uplift the health sector but there are 30 UNAM graduatesThis came to light after several residents in University of Namibia. we all need to get involved. working as medical interns at Oshakati complained of being denied the We got involved to ensure Oshakati State Hospital.option to appoint affordable contractors to The Ongwediva Medipark that skills are transfer to thedevelop their houses. currently has 30 specialist next generation of healthcare “Medipark gave UNAM the doctors, both local and for- workers in order to contribute backing for an intake of not The beneficiaries are allegedly required to eign, in various fields. towards the health develop- just 50 medical students as themake the payment on the land to aquire owner- ment of our country,” said ultimate target, but aims forship within eight months of receiving the land, The managing director of Iithete. more. Overstretched clinicalwith failure to do so inevitably resulting in Ongwediva Medipark, Dr training sites were the bid toundisclosed penalties by council. Tshali Iithete, said that they Iithete added that they have limit the capacity of UNAM have recognised the need to brought in a variety of skills to grow,” said Hangula. Beneficiaries are also given a period of twoyears to complete their houses using council DEVELOPMENT: PRO of Oshakati Town Council PROFESSIONAL: MD of Ongwediva Medipark, Dr Tshali Iithete and Vice Chancellor of UNAM Profappointed contractors for the development. Katarina Kamari. Photo contributed Lazarus Hangula. Photo Maria David Beneficiaries say they do not see the logic left without development was high,” she said.in spending N$528 000 to build a house on She added, “The houses to be constructed81 square meters when they can build a big-ger house for less if they appoint their own will be within the ambit of affordability to thedevelopers. beneficiaries and prices will not be determined by the developer. There are various types of Oshakati spokesperson, Katarina Kamari, houses with different prices that a beneficiaryexplained that using allocated developers to has to select in accordance with his or herbeneficiaries will speed up development at the budget.”town. All recommended developers fall under the She added that serviced land cannot remain mass project scheme and because materials areunutilised for long periods as it opens up the purchased by the developers in bulk, costs ofserviced area to vandalism. construction inevitably drops. According to Kamari, in the past council allo- Kamari also added that the developer do notcated land to individuals who failed to develop have any influence or authority to benefit fromthe land within a reasonable period. the selection of land ownership. “In this regard, council has been losingmoney and the number of erven that have been GO GREEN FOR BEAUTY For news and more in the North, call Maria David The First National Bank (FNB) has donated ten trees to the Oshakati Town Council with the aim of beautifying the town. Tel: +264 065 233 315 The consignment consists of three cypress trees, four evergreen and Cell: 0817690120 three coco’s palms. The trees were planted in the Agostinho Neto Street during a Email: [email protected] ceremony attended by Oshakati Mayor Angelus Iiyambo and FNB branch manager Tuuliki Shilongo. In the picture are council employees preparing the trees before the official ceremony kicked off. Reef Top Society Fabupham Satiskin Inecto washing Babyline Aqueous Cream Foam Bath Super Black powder Assorted 2ltr Petroleum Jelly White 250ml 1595 500g 500g 5295 1895 1195 1695 Angel Easy Clere Body Dishwash Wave Coconut Cream 500ml Liquid 725ml Hair Food 250ml Assorted 1195 1495 2095Crez Petroleum Garnier Oil Jelly 125ml Control Epimax Cream Gold Series Panache Deo/ assorted 400gm Perfume ESP Deo 90ml / Vanishing 995 Cream 5695 Assorted 100ml Enigma 60ml 40ml Legacy 125ml Top 2595 2495 Society Body 1695 Look / Lotion 350ml Oreez Glycerine BarQ Bath Soap 100ml 6*75g or 6*90g assorted 550each 1495 895 Prices valid 27 April to 14 May 2017 CBD, Namlex Chambers, Shop 4 Channel Life Tower, Shop 29 Shoprite Centre, Shop 4 Pick n Pay Centre, Ongava Street, Omongo Street, Etetewe Street, Independence Ave, Whk. Independence Ave, Post Street Mall, Whk Katutura, Whk. Katutura, Whk Okuryangava, Opposite Wanaheda, Katutura, Ombili, Katutura, Tel: 061 242 640 Tel: 061 264 677 Tel: 061 257 342 Shell Service Station, Whk. Opposite Hilton Hotel Whk. Whk. Whk.
14 SPEED 27 April - 04 May 2017 SPEED Powered by www.namauto.comGWM M4 SUV - AFuel efficiency meets travel comfort FOR DRIVING SCHOOLSPRETTY BEASTIf you want a good-looking drive that ticks the affordability, style 2010 Chevrolet Sparkand safety boxes, and opens up a more adventurous lifestyle, look 65,000no further. Adorned with a sporty look, a refined new front grillewith squared-off front-end features and Daytime Running Lamps Phone NOW to avoid(DRL), the GWM M4 SUV crossover’s cheeky looks is bound to 064 403 666turn heads. A/H Antonio @ 081 273 6926 Negumbo @ 081 274 0888 crossroadscars.com.na Zorena Jantze This means that maxi- with audio control, cruise push-down function at safety package. height-adjustable. The 2014 Toyota Hilux 2.5 mum power of 71,3 kW control and Bluetooth the driver’s seat, auto- Dual front airbags and rear doors also feature D4D SRX D/C 4X4For most, GWM is remi- is developed at 6 000 ensures that you’re always matic air-con and a CD child locks. niscent of comfort with rpm providing 138 Nm of in control. Cup holders player. disc brakes all-round 295,000a lot of style, and the new torque to the front wheels. and a cargo curtain help backed by ABS with For days filled with 2012 Toyota Hilux 3.0GWM M4 series offers just keep things organised, as The M4 has been EBD are fitted. Isofix rain and hazy weather,that, but with more adven- Inside the cabin, the do the separated foldable designed to meet global child-seat mountings are the M4 has fog lightsture up its sleeve. Great Wall GWM oozes comfort and rear seats with a 60:40 safety standards and mounted at the rear and front and rear to boostMotors (GWM), coined after class. A trip computer split that provides extra boasts a comprehensive the front seatbelts are visibility and rear radar.the Great Wall of China will puts all the vehicles vital luggage space. There are Security is providedtake you places with GWM statistics at your fingertips, also electric windows with by a standard immobi-M4, as it is geared for both whilst the steering wheel liser, with the furtheron and off road driving with convenience of remotea robust ground clearance central locking and a D4D RAIDER D/C 4x4of 185mm, and a special car locating function.luggage carrier for that The GWM M4 comes 305,000weekend trip out of town. with a 5 year/100 000km 2012 Toyota Hilux 2.5 warranty, as well as a D4D 169,900 Under the M4’s bonnet, two-year AA roadsidethe two-wheel drive car assistance with an op- 2012 Ford Ranger 2.2 Dsports a 1.5-litre VVT petrol tional service plan. 180,000engine, with a five-speed 2009 Ford Ranger 3.0 Dmanual transmission that’s SUPERCAB 4X4been designed for fuel ef-ficiency in mind. 185,000 2015 Nissan NP 300 2.5 D LWB 169,900 And many more! Call A/F:Becoming a winning auto company in Africa Antonio @ 081 273 6926 Mike Whitfield up layers of trust with government and in- expertise to local counterparts – are a must. imported - if demand has shifted to passenger Negumbo dustry stakeholders. Get to know who’s who vehicles. @ 081 274 0888As a first-mover into automotive assem- and what they’re responsible for. Never go in Knowing your markets www.namcars.net/bly in Sub Saharan Africa, Nissan joined with an all-knowing approach. Listen, sug- Knowing current and anticipating future Capitalising on logistical synergies crossroadscarssales.htmla number of South African-based compa- gest, discuss but don’t preach. market trends is vital to managing the finan- Distribution of vehicles and parts to over 40nies that are creating successful businesses cial health of the business, as well as prepar- countries in Sub Saharan Africa can be un- Only getting hotteron the continent. Grooming a localised workforce ing for growth and expansion. wieldy and expensive. In Africa, a company Governments want to know that your in- Africa is a hotchpotch of markets: small and working on its own doesn’t have sufficient For advertising call Mike Whitfield, MD for Nissan Group of vestment is going to benefit the local econo- large; left- and right-hand drive; some econo- volume or scale to create efficient solutions. +264 61 275 4700 / 26Africa said there are some pre-requisites he my and its people. So it’s crucial to localise mies and infrastructure more developed than So it’s cost-effective to make use of logisticalbelieves are important to long-term sustain- your operation as much as possible as early as others. So having an accurate gauge of vol- synergies as much as possible.ability on the continent. possible. This means building an experienced umes and product-types required in the vari- This means optimising inward- and out- workforce who understand their role in build- ous markets is wise from both a manufactur- ward-bound land, air and sea routes for Building strong relationships ing your brand. Whether it’s at operational, ing and retail planning perspective. There’s no freight transport, either within the company Legislation, systems, processes and cus- sales or distribution level, skilled and knowl- point, for example, in having an over-supply or with external partners.toms are different so it’s important to build edgeable employees – who can pass on their of pickups – whether locally manufactured or
27 April - 04 May 2017 6 1871900 45 2 1877704 45 9 1882868 45 6 1856523 45 11 1883496 45 ADVERT 15 WINNING REMINDER NUMBERS THESE 5 NUMBERS APPEARED IN LAST WEEK’S INFORMANTÉ. IF YOU HAVE ONE OF THE NUMBERS, THEN YOU ARE A WINNER.www.informante.web.na • 061-275 4102 / 4363 Find us on Your Community NEWSPAPERyour number The bearer of this newspaper is authorised by Trustco to sell it at any price between N$4 - N$10 for his/her own benefit. There can be no true freedom for all without true prosperity for all. CONGRATULATIONS Miss Aili Iilonga N$ 10 000 WEEK 1 WEEK 2 WEEK 3 WEEK 411-60125-1 | 14-65856-1 | 06-56452-1 13-104543-2 | 6-96510-2 | 15-67069-2 1-115005-3 | 6-131537-3 | 6-142224-3 6-174164-4 | 6-173190-4 | 15-153258-402-29273-1 | 03-30936-1 1-75628-2 6-110014-3 | 1 117952 3 13-186662-4 | 14-186859-4 WEEK 5 WEEK 6 WEEK 7 WEEK 815-193269-5 | 6-213595-5 | 15-197166-5 6-263397-6 | 1-23945-6 | 13-269868-6 6-293392-7 | 6-297187-7 1-104543-8 | 15-96510-8 | 1-67069-814-229750-5 |15-190382-5 3-244274-6 6-75628-8 | 14-355 900-8 WEEK 11 WEEK 9 WEEK 10 WEEK 12 1-450947-11 | 14-481726-11 | 6-464257-1113-395689-9 | 6-382907-9 | 15-359514-9 6-415206-10 | 1-409719-10 | 6-432381-10 1-493317-12 | 6-517582-12 | 15-488505-126-381326-9 6-420676-10 WEEK 15 WEEK 16 WEEK 13 WEEK 14 6-620622-15 | 11-644428-15 | 1-608904-15 6-632333-15 | 6-612902-15 8-683047-16 | 6-659838-16 | 3-654515-166-554570-13 | 3-531983-13 | 13-564120-13 1-567371-14 | 11-601661-14 | 1-569246-141-525884-13 WEEK 19 WEEK 20 WEEK 18 WEEK 17 4-780874-19 | 12-809719-19 | 6-792512-19 6-841546-20 | 3-820206-20 | 6-827985-20 13-769201-18 | 1-733653-18 | 6-748700-18 1-817770-2011-726532-17 | 12-727143-17 | 6-721715-17 6-754574-18 | 11-767713-18 WEEK 236-716076-17 | 14-729687-17 WEEK 24 WEEK 22 6-959516-23 | 1-939729-23 | 6-955656-23 WEEK 21 13-976425-23 | 6-949788-23 11-1015406-24 | 6-1005582-24 | 1-978653-24 1-897145-22 | 6-913077-22 | 6-904914-22 6-989006-24 | 6-987359-246-873103-21 | 6-884695-21 | 8-889215-21 13-933556-22 | 6-924083-22 WEEK 2711-890402-21 | 1-855644-21 WEEK 28 WEEK 26 11-1138537-27 | 6-1117840-27 | 3-1133948-27 WEEK 25 6-1123028-27 8-1178290-28 | 13-1182652-28 | 6-1160104-28 6-1073498-26 | 6-1078233-26 | 1-1061515-26 6-1153306-286-1035687-25 | 4-1052981-25 | 6-1039707-25 6-1066478-26 | 5-1094581-26 WEEK 311-1020684-25 | 6-1048073-25 WEEK 32 WEEK 30 1 1272195 31 | 4 1301032 31 | 12 1306040 31 WEEK 29 3 1299974 31 | 6 1274370 31 2 1339407 32 | 5 1343246 32 | 3 1340694 32 6 1239007 30 | 6 1241610 30 | 11 1263883 30 6 1321132 32 | 6 1335627 323 1217852 29 | 6 1203755 29 | 1 1189401 29 5 1231083 30 | 6 1238606 30 WEEK 355 1219418 29 | 6 1192843 29 WEEK 36 WEEK 34 6 1444355 35 | 1 1434620 35 | 3 1466155 35 WEEK 33 6 1446396 35 | 13 1473640 35 13 1515533 36 | 6 1498190 36 | 2 1505264 36 6 1411564 34 | 11 1428762 34 | 6 1412267 34 6 1502098 36 | 6 1483624 366 1368297 33 | 1 1354890 33 | 6 1364992 33 11 1396635 34 | 3 1377601 34 WEEK 396 1377601 33 WEEK 40 WEEK 38 1 1604251 39 | 2 1630217 39 | 6 1611512 39 WEEK 37 4 1633469 39 | 6 1622739 39 11 1677248 40 | 6 1648820 40 | 6 1668200 40 13 1597631 38 | 6 1570793 38 | 12 1596208 381 1521225 37 | 11 1552748 37 | 6 1524483 37 10 1593990 38 | 6 1583924 38 WEEK 43 WEEK 444 1550071 37 WEEK 42 6 1770057 43 | 4 1798258 43 | 6 1777890 43 6 1814854 44 | 13 1845208 44 | 6 1813474 44 WEEK 41 6 1769999 43 | 1 1766000 43 1 1807880 44 | 6 1821654 44 13 1763608 42 | 6 1748175 42 | 6 1735842 421 1685389 41 | 1 1685844 41 | 6 1710356 41 1 1726263 42 | 6 1731688 426 1699773 41 | 3 1715028 41Visit Informanté’s Facebook page for more details on how you can win, how you can claim your prize as well as all the Ts & Cs
16 GENERAL NOTICE: NAMIBIA’S GFATM FUNDING STATUS AND NEW FUNDING ADVERT REQUEST PROPOSAL FOR THE PERIOD 2017-2019 27 April - 04 May 2017 BACKGROUND & INTRODUCTION This General Notice serves to inform all stakeholders about the current funding status and modality for the new Funding Request. The NGamENibEiaRCAoLorNdiOnaTtiInCgEC: oNmAmMitIteBeIAfo’Sr HGIVF/AATIDMS,FTUBNaDnIdNGMaSlaTrAiaT(UNSaCACNADTuNME) Wis oFvUerNseDeIiNngGtheGENEimGRpEleANmLeEnNRtaOtAioTLn IoCNf EOthe:TRNPEICrQAoEgUMra:EmISNBmTAIeAPsM’,RSiIO.BeGP. IHOAFISV’AS,ATTLGMBFFaOFnARdUTMTNMHaDlEaFrIiNPaU,EGNfRunDISOdIeTDNdA2GtTh0rU1oS7uST-g2hA0At1ThN9eUDGSloNAbEaNlWFDunFNdU.ETNWheDIFNUGNDBACKcGuRrrOeUnNt Dfu&nIdNiTnRRgOED(2QU0C1UTR4IOE-NE2S0Q1T6U)PEfoRrSOtThePPmOReSnOtAioPnLeOdFS3OAdRiLseTFaHsOeERarPeTaEsHRaErIeOPeDnEdR2in0gIO1o7nD-322100D11e97ce-2m0be1r92017This GaennderalaNsoticpeesrervethseto inGfoFrmATalMl stakNeheowldersFaubnodutinthge cuMrreondt efulndiFngunstdatusRaundlemso,danlityoforethxetenenwsFiounndingfoRrequpersot.grammehAisCT3iN.e1KhGa.emBDGHeieNbgaiIAmnVcRiarla,leameoCpbmOTncirleBbeKbatyaUi,aemoatlGruninNoCedNn2dRnon0DtuhoMo1tasOira7satde&mitlipacaUindoernaoeirInadNtibuiNo,nydnasgwDfT.ustetAi.nChlRpdlnr&oeeeyvbOmrderesIemthDNttsmhaiegtrtaUTroertGitauneoRCFgionnAhffgtOoiTTenrtfMhhuIdDfeOHneoNdfIUGVorNsiemn/lrwfoACrdboINDFiamTcaalSuaInaFl,mOltdnueTiinsneNbBddgxti.iaasaaMTtknlihnboldoeegdecehgMyclaruooaaFtrlninrualoedtnrd,nnidauet ntufRrh(uusNtuisnisalledeiCdazisnpaC,bbgeytAnoir(Toot2ihouu0neeMd1txs4p).tt-teaeA2hinsr0rtnsei1oooiy6ofvd)cnterh,ferueosfwomrerirniertldhaeiplniericngnnoamogittnetrtehadgfnebmuatiemfolinlmuoneadcnepimaddldietnpdimso3lgienetfdminruoiostsetanielnmttiazaitaoaaslnttetaiituooononansfrtepwehtaeahixlesrleiinosbanddePtr,ieenrwgowmgergilanlrnandotmoiendtdmgbaeefooslnir,tyr thadedTitniBhoenaiaswsl teoGFdtheueonnnneedwritnahaglellocNRaGtoielootnqibcauameelosuFsntuet..nrvdeBsotaordi’ns fodermcisiaolnl sintaNkeovheomldbeerrs2a01b6ouotnththee caullrorceantitonfunofdirnegsousrtcaetus,s and m BTBas,feModNarolaantrmhitaheieabniGnadleobhbuwaailldsFiFnubgnueRdneeBndsoilaiiaenrdnlgl’tos&cdReSacuetiessqtidoauninUeainbSsNle$to.S3vye7sm,t1ebm0ers62,f0o91r06H5eoanflotthhre(HRaSlIlVoSc,HaT)t.ioBTnh,eoMfarlaeloslcaoaurtriiaocensaa,nmNdoaumbniutbsiialfdohrianasgllbceRoeuennstariilelloisecahntatevd&eUbSSee$un3s7dt,ae1t0ien6ra,m9b0in5leedfopr rHi-IV,hermeNadruailcybSmtiboayanissbsfeterieoddammoonCtshndeofisdopoeirrasersvHedeioaeibunsausearltdtohtbetiannu(l aRgradnllSodeCcSinanotcHiaoom)nmn.doemTfliehUnivteScet$elo.a1meN1ll1aoe,mf2co9ilabe3rita.vi1oHei2sn4lI.c.VlaNasm/asAimofiIeuDidbnSaitass,aifsnTourcBplaapleaslrs-ncmiofdiiduedndMlet-raaiinesclasoamrnhieaaucvop(euNpnebtarrey-.CemTnChieddAdaelTlloeteuc-airMntmecd)ionamiemsdoeuopncvtroiiesmuranastsrreiigyleny. ifiincagnt themuprrlePeRnmOiTtmPeThfOnupheSetnlEeaNdDamtiilaDonloeImngScnEaitoA(btae2SfitdaE0ito1hSaCnPm4eLo-oIo2TPouf0rrndo1tthig6inser)aaaPtfmiosnrirgmogngtehiCfriseaco,ammmni.mtemer.eenidtHsttuie,oIcVenit.i,oeefnTdo. BrfHr3oHIamVdIn,VitdshT/eABMaIpDsaraeeSlnav,idaroiTuraeMsB,atafosualtananalrddiraaeelMl,doecfautanhlntadirodroinieaugodg(fhoNUthnatSrhC$o3e1uC11gG1AhD,lT2oe9utbhc3Ma.ee1l)m2GF4isbu.loenobrdva.e2lTr0sFh1eue7enmrnlaopdncltpBlAeihtavrna,aomiansttiacpiuigenmswooeudcnPBnwsilnluenprlodRaiutsgdrnhptlsieuasOveactteieehhdhenmmPtaedeeadridtonOipsdotsoehgrnicfsebSeeunnutuevshCsyEnnaiwptntostehaesOoDutiedxtoei.estUhttlnshriiltDconNeheparoGbernTIngruaegSdeetsRnbeFahEtovatYwrr(yAdavyegi2ebAoieAniTaarrrlu0oSgPPtlrlalMaoscr1PtEGobndohcyL4cagecfertSFtrIaloeei-CPatonN2uP,AmhrdngAgotn,h0LeTeTgerStetfrhaIIo1rpMOawoTecifylnmn6ioNrstG,uattd)SaslenNMolkupFiltNbofcerdfOlayfoiahuitcaceDlnomnraifnFeteleAwodetuneedtiieLntrobddhdriIdjsssunnTieNashattYaF,gootatiatflusmceithblcamooipatnekeuhMretceinoedioyGabnptrpnroioolycnltaitofosdainioclgoeeonberedvdfn,itnaberhlwtmllheee.tMiueFhtFtchdyhFtohfuiooeitoslahllunloil3npdenozwdngprwpoeadiendiedhapnlgtmroagirittsoistuihcshPeosiFRenipdirstpdosaaubScugrtp.eiooprsonplanelAenspiemdsteurosouonbirfSlrsom,taiyrappoeeidRtrltripitdoodtere,:nrnpueed.atowsoahlmtsAeesoneeindlstantlahaafb,eeioytncanirvxhlGsoeleiaeornltnsontedwebggoeobomaenfinnnlrefiesFngatudhlueietaiennhiPovnnxdedaadrni.nngonPtdstaerggkiloytoenrfgsifayrorinofssaomupnmroiomnofap3SStudhln1ppplaeasltilrttoiini.nooDtfI:vnfnrgteoeseohcs,rrxactepmamseieesmeonpnmptoaitemlfsrennobwgegee grant, unused by the start of the indGicloabtealdFaulnlodcPartoiopnosuetdiliPzraotgiornampeSrpiloitd, will not be additional to thaasmeidbaialolonhcaatshtieboenARGeatenliqmotsuHTabeOoBlsIalrutoVdlPnic/nrAFtaao.rpIutyoeDnmsdSadeleU(FtiBnRSgoP$,)ah3fero7dlrd,2’1so0n0171d60–e,9F2ce00ibs15r9iuo.afAnoryPr2riHo0np1Io7VNs, ,aNUoUlTaSDvSC$Be$eC2v,5mAe9,MlT,8o4bu7p0Mae6m6l,rea5r,e8n8rst628ioaT30leva1eamd6nt(doPosDbunTbu)mihtlihdat saeinbtageaielonRlrleocedocsnFasiulttiniiteoudntinnetgd of resources, & SustainableystemBsasfoerdHoentWaolottgrhhkeTMinen(oegaRtrlaaGaGSlllryrlSoioauoHbpvesa)r.slaeTneFdhutehSneuabdplrlCooBopcmooasmaatilirtotdwene’rsistianhgmdaevpoercouicbsneeisteoUssnnUSafnon$Sodi$3rmn17mai,n,81elNal20ete3otc6idn,ov4,g9f5euso04rmna5ttrhrbeieeecusarrprphe2lnia0ctlavy1teio6onnbgopeorinoencgne.tshTdsee.ecBhtneraoicrlalmadol cinaetidonpriomf arreilsyoahseeACadtOliSNtUlsooNrAOyacneTnsrmapRddtiYrtneieieniabAsmsrcdyPieelaPumsnaaLsethsmIsSaifeCvoteatotaAieinomrvksTgbeueIe,dHOhubshnioNoseeretfllcodddMateiuhefesoOlernsntrnDdhsaek1Aiaieal0oaeLyl(slonFlIRvnTfiogeugaYdubSrncnnerecuatiSgtiaaniftornakiHeyccndersod2ad)yc0.oimno1nUfnpT7tgtes,hoShruNepetllea$hteuNadCe3tlavCiaauoC7eAtPnlciClT,oslort1.uAoinaMocTN0gsrauen6,rraeMata,spimfmn9ooreteloi0vnicolebamSi5ppdtiaeaplatedoftmlteoihtstidolsurioevntbtouHhicmenpitlsneiagItarVdkpatessersw,tovsapcTiifiitltleoofaohBirsceuersedt,tdsahaadFMkerulutealeornaistdndchtlpigaineoasalg:AlaeurnpRaicanareesliultql,eoraaupisnewcenpsdasitadetMPhtnrirhabo-doytmpaunho2aveisi0lodaed1blpfd7i(rnFab.olURergeatPS-ideci)Rn$ifnporc1eraaod12snt0im1egio1lien,7tee2e–n9oor2cmftf30o1&.iu91n.n2eSAt4dur.ys.ptraRasOeTaPSerProdeocmPTbhpOa□□oenonaSsiShRnisStncotiasppecavafhOlEilelltepkatDiihWttahaCrsedPeD,emtoootleevhsklmOooredrooeokuDnrlypiodtelnicnpfSozdpiffIgnrneiruamtSeceEaoaddntGttiserkcpiEveearDsionetosonininttodAuophd,eTsntplaDadeauseaSsaCtShpMjaeactoutlorasiIeaeosmsgimEosaStwfrtinlonihgmeccdetgtcd(ehrinieeuEcoPocafdlSodeo,lSirtstDhbuiciGinurinAonsguwNnuPeTaainaugnFbzngvuiaf)ntSnttoteLihACriCioeriahtoaloddgtdylpwECfaInnoonnrinreeTsatmdeasAwyi,yhaltnTbdlimSaifentnocioenoudhaeanendtonigPMvehPtrdsealntaasneeeltristlfgutMolhirLherlninnhplceibgin.ecseacgciorleeImnnd,aityinoThsCapetntxriFPsreease2cadiotoitttdsivr0voinhrilifntnfeieto1iouwoitRlheaafiscocl7tnnlbgoinewietrnt.caoGteitahdeoroehwctn,geaafminirnetdoslpnneeionftmanoufiahtspdneylegnIgmttrbonnedrrieedosoaSbmettonicaualu(enntaeeeesnpGitbdgranrsslhrgs)eolmvaaletsiruicis(rFletetlspdePolei.btyaysocsqrudRraoclbeisruIoreot.gnneinecfslinvoraoeaoltsds)Nieoahnrtinct,dltuirtbensneEstseiaohataz:Fbesd(sthCefPasehsemfmuuetaf.etrioeaougicrtlonodnhpnit.snictHodnaepbofCtmdodloPIeslitpfiVcpionisci.nuodao,trntaphgoorlanTtocitnapcrithaeBoifsrttotoyoserrepn,IeesasynpqtgoaatapntdcNhuoifnenlnerppseodotlewsrspdhearecsrPterMeaeoeeetsiGrstssrdersiatdNenp)vbsslll(aoaganots.eaaciohintrtoBfgb.CpeihasdgatsiarrdtoaeurCae.ooneEalcaaCAdnsddtretoeddFehTogmsidittusaunHsceohoottMcsnahIcssaenVetSkundPae,praetmdap.ohtonTlctmloenfdNBlhioacolntiedo,eyhnttlleeu.tealleeftroodiinpsnrdadcwm)gasipansetabMlheiaolantoetagahlrricytveugol-eatseaemiconrriPuiapsenaPrnirrorddeoroonfodpctgfoglolUynerrsosaatS-ehunmimlgdent$aoct1iinoSo1gn.psm1l,ie2t:9c3o B□□□asptoeroSthdceeelesHToGsctFnBfiIooTanVllthnohodew/feiAotnihtmgheIpeetDPhrrleireinniSnCetvceoiifrpoonnarfalulitsciRosut enobcafcmilpIonditetoteuinnnrteong(ssrt)ttorh(aryPegnRadfaunsEin)lztldbahoaitincicossgenaPdsp.toroiolonicpynaoost,rafattlnhhfseoeprNaarUaGelUClnStClthSo$aAr$enbT2edu5a9Md,p,8lor4aocF7n0gu6dumr6a,ne5m,n88dmte68deh3ssaeislse1ctp9iorMnoapyo2s01e7d. the following 1 □ MitigMatianglaanryicaonflicts of interest based on its Conflict of Interest UanSd$E1th,i8cs2P3o,l4icy5.4 ProgramThe timeline ToCtOaUl NTRY DfuInAdLinOgGpUroEpo/sSalTfAorKaEllHthOreLeDpEroRgrCaGmOlmNoSebsUUiaLsTl1SA9F$TMIu3Oan7yN,2dM1001EP7E6.rT,oI9Np0GoS5sed Program Split for submitting the ThereHisIaVn/eeAdIfDor Sbroader stakeholder consultation to ensureUtSha$t 2a9ll ,s4ta0ke6h,o8ld6e3rs are well informed n iCnOcUluNTsRivYeDIAdLiOsaGcnUduEsfoT/srSmiBoTApnKarEtrHeoOfgLtahDerEdRapiCnpOlgicNaSttihUoLneTpArPToIOcreoNsgsM.rEaREmeTpINreGSsSepnltiattivnees eofdkUseyStmo$i5nt,isa8trk7ie6es,,5pm8lua8ltcilaete,rawl aitnhd btihlaeterapl articipation ofeapkreTreehssheeeronentlaidsttiaveaetrnsisevoeefdksafeoyadptroecembaovrfcioednpaoilelrsoeMTdmetupreiomleirlnicaevssteti,itlvnanarnmagyksatluetrinlhptwtiuioatllaiatetlridhottekenvnrreeHasecrlIysoalVa.,nnn,sdpnupFobtloethniaoolepat-pigltoueplloneorlvaiatvweloaadtrfeitnifeeneonmvcsegsnuetleeornscedpt,tamtothhblrepa,yinotas/etlraingpvoldliaanscprnatgtaniollzlekeawnoertshtiisht,olohienunlvdorsTlein,tpnrB-asaggk,rtoUaetiviproyeeewUeSsnrwona$Siwpmeftflh$3heeleaoicn17ntntaf,teha,o8hfdda1lfremo2ve0crepe3gt6edobaa,ddpn4,naaiui9nz5sisbladna04eytettife/iooa5oldirnrvnemssissn,etpgkoaaisenrnynwtGdaoaitfflhfonentthbhcedmeatteewladFalpoapuprrakolniiabspcdn,a,urtaloaiotlniayonpdssriosacrneadsnson.egfRt-eepth-oefvewsotmrkse, pnetosplethlivainatgcwwtivitiihltileHgsIVua,ripedeioenpvleittheadeffetocntetehdexbtsyt/atlihvkienrgheowelditheyrTemBa,erpeetcionpyglecs.laeffe,cttehdebyc/lioviungnwtrityh mnaelaeriad, sacatodemeiicthinestirtuctioonns afinrdmthethpreivaptersoepctoor,sed and all other parties who have an interest in Global Fund activities are invited to the stakeholder meetings.plit oAr nprionpcolusseSivtaaekechdhoialsdnecrgumeseseiintoinngtshareeregPpalraorndgneirndagamstfhoSlelopwliPst:.roIngrcaamseSopflipt rnopeoesdesdtochtaankgeepslatoceth, ewaitbhotvheePproagrtricaimpaplitS,tasrkueehfpofilrcdeeiresmneetnetjtiuangstsitvaiferiecspalatonionfendreafoslefrovltloahwnes:tckheayngpeompuulasttiobenss,upbemoiptteled ltiovinthge wGiltohbtahleFudnisde.ases and a broad ra stakeholders Daatte countryVelneuveel.StaFkeoPhlholoyldswiecrianCl gAondsdutrhletsiasstioncMoneeTstiiumnlgetsation and Pubraposseed on the analysis investmen2ts6 Athprailt2w01i7ll gEuviednteSqtuhaere /nGeZxt tChnreBiesmyarecka&r Dcrycl0e9,h0th0e– 1c7ho0u0ntrDyecnisieonesdonsStDoA ePriitohrietyr confirm the p1ro Centre W Külz Street, Areas & Disease Split Split or propose a change in the ProgrWaimndhoSekplit. In case of proposed changes to the above Pr Split, suffic10ieMnatyju20s1t7ificaEtvieontnCSeqfnuotarreret/hGeZ chCanWnr BgKisüemlzamSrtcrkuee&st,Dt rbe 0s9uh0b0m– i1t7the0d0 toC&otnhIsneofloidrGmatlaiootinob,nCaSolhnaFsreiunnsgnusd. WindhoekCONTACTS:For acodndfiitriomnaatlioinnfooFCrfmoaOatrtNteaionTdndAdapiCtnlieoTcaenSs,a:epl lcienoafnosteramcctoaMntitosan.cDtpMalellsea.esNneaWmcoiutnbktooaoloci taMMtwtsea.lenDpghaaollalenaeet:nt+eW2le6ip4tbh6oo1noei2a8+t324t6e04l1e60p1,he2o-0nm3ea:2il+2: 72d3a6,l4leee6-mn1@a2ilc8: c3nma4mn0a1um0k,[email protected].:n.cao. m.For
27 April - 04 May 2017 ADVERT 17OPEN TO THE etro SEPAESCTIAELRS!!! PUBLIC NAMIBIA A Sefalana Group Company Mama's Classic Rice 1 x 10 Kg BULK DEAL 1399 Bakpro EEAACCHH White Bread N$213.49Case Flour Equates To 1 x 10 Kg N$26.68 Each Top Score First Choice 9399 Maize Meal EEAACCHH 8 x 2.5 Kg Milk 9499 6 x 1 Ltr EEAACCHH BULK DEAL Ricoffy Instant N$83.89 N$239.99Case Coffee 6 x 100 G COMBO DEAL Equates To N$11.99EachBULK DEAL ++ N$79.99Case Marathon N$59.99 White Sugar Equates To 20 x 1 Kg N$ 13.33 Each All Gold Tomato Sauce 700ml + C & B Mayonnaise 750g + MRS Balls Chutney 470g BULK DEAL Family Favorite 7499 Wellington N$59.99 Sunflower Oil EEAACCHH Sweet Chilli 8 x 2 Ltr Sauce Equates To N$287.89 Nola 6 x 2 Ltr N$1.50Each Mayonnaise N$299.89 3599 4 x 3 Kg Robertson's EEAACCHH N$299.89 4999 Spice Envelopes EEAACCHH Assorted 40 x 7 G Buy Any 3 For: Buy Any 2 For: N$59.99 N$9.99 1399 Force or Monique Redo's EEAACCHH Roll On Ass. Balers Ass. 50 ML 50 x 24 G Hugo's NO TMhiisstisake!!! Tamoto 2799 EEAACCHH Sauce PRICES VALID: 6 x 700 ML Elso Dew Fresh 11 APRIL - 07 MAY 2017 N$79.99 2 LtrAll Metro Stores open from 09H00 - 13H00 On 1st & 4th May 2017 ALL PRICES AND ILLUSTRATIONS ARE CORRECT AT TIME GOING TO PRESS. HOWEVER THE MANAGEMENT OF METRO CANNOT BE HELD RESPONSIBLE FOR ANY CHANGES ORPRINTING ERRORS THAT MAY OCCUR. ALL PRICES ADVERTISED INCLUDE VAT UNLESS OTHERWISE STATED E&OE WHILE STOCK LAST. WE RESERVE THE RIGHT TO LIMIT QUANTITIES FACEBOOK: METRO NAMIBIA
18 SPORT 27 April - 04 May 2017 He has been sparring since being a pre-teenFROM ORPHAN TOWORLD CHAMPRelatives of Namibia’s boxing sensation and super-lightweight champion of the world, Julius ‘The Blue Machine’ Indongo, insist that the boxer’s tre-mendous successes did not come as a surprise to them as from a tender age he already showed promise of someday becoming a great boxer.INDONGO interview at Trustco HQ. A steely humility and a disciplined frankness with a remarkable spirit of sportsman- Placido Hilukilwa after 12 rounds of hard work.ship and fairness are the trademarks that Julius Indongo, the newest world boxing sensation and world beater from “Boxing is in his veins,” said Indongo’s Burns wanted to take Indongo’s IBFNamibia, displayed in a facebook live interview after he was welcomed to the Trustco recording studio by the Deputy aunt, Anna Kandjala.CEO of Trustco Group Holdings, Quinton van Rooyen (jnr), on Tuesday, himself an ardent crossfit sportsman. title in a unification fight, but wasPhoto: Informanté Indongo, who is undefeated after defeated on home turf. 22 professional fights, was born in WHOLESALER Windhoek 34 years ago, but was Indongo, described by the European 30 New Castle Street orphaned at the age of three when his media as “talented and tireless”, brought Northern Industrial, Windhoek father, Matheus Jacob Indongo passed another world title last year when he Open Mon - Fri 08h00 to 17h30 away in 1986. stopped Russian Eduard Tronovsky in the 40th second of the first round in Saturday 08h00 - 13h00 Indongo then had to leave his Moscow. Kandjala revealed that before widowed mother in the capital city and Indongo faced Tronovsky last year, a lotTel: 061 262 687 | Fax: 061 214 786 | C: 081 127 3787 | E-mail: [email protected] Valid 28 April - 13 May 2017 move in with aunt Kandjala at Onamutai of people were discouraging him saying village in the Ongwediva Constituency the Russian was too strong and posed a Sweets Lolly Joedir HH Darling Mini of the Oshana Region. serious danger. Pop 30’s ufo 28pc Hollywood He grew up at Onamutai and attended “This made Julius a little bit nervous, N$ 12.00 N$ 99.95 N$ 52.95 school there before moving to Oshakati but I literally commanded him to go where he completed Grade 12 in 2002. because ‘the proof of the pudding is in GVOAORLOUMDEOSROTEFOANTN$H1DE500 Darling Navi Galaxy the eating’,” she said. Vibrations Kandjala said Julius grew up in her BUY GET19S20OPGCAMSPBFBARATERHEQ! N$ 59.95 traditional homestead where all other Wilhelmina Petaya, a neighbour and N$ 51.95 children of his age were female. relative of Shaambe’s, said Indongo’s achievements made Iikango village and “Therefore, he grew up performing the surrounding areas very proud. household chores that the girls performed, but still demonstrated his “Many kids around here see him now will of being a boxer. He picked up old as their role model,” Petaya said. socks and made them his boxing gloves, using other objects as punching bags. After completing high school, Indongo When other kids discouraged him, I moved to Windhoek and joined the encouraged him to continue. I could see Namibian Police the same day he that that was his calling,” she said. celebrated his 21st anniversary. According to Kandjala, Indongo is Also, the MTC Nestor Sunshine well-mannered, respects both young and Boxing and Fitness Academy embarked old; is highly religious, and as a school on a massive street parade throughout learner took his studies very seriously. the city of Windhoek on Saturday, 22 April, to thank the fans for their support Informanté also traced Indongo’ for Indongo. mother, Frieda Namutenya Shaambe, to her homestead in the Iikango village “We are nothing without our fans, near Ongwediva. they pay big money and sacrifice their time to come and watch and support “While he was schooling at Onamutai, the MTC Nestor Sunshine Promotions I was informed that he is boxing and I every time we have events. This gave him my blessing,” she said. achievement of Indongo is not just ours, but theirs as well, because we Shaambe said she did not watch the are nothing without them,” said Nestor recent match between her son and Ricky Tobias. Burns. “I am humbled by the parade because “I spoke to him before he left for it allowed me to meet so many diehard Scotland and wished him well, but I did boxing fans today. So many of them told not watch the match. I only received a me how they watched my last fight from phone call afterwards informing me that the young to the most senior citizens, he has won. I am happy that my boy is and just knowing that the whole nation really doing his best,” she said. was behind me means so much to me. It encourages me to go out there next time Julius defeated Ricky Burns, taking and do it again, not just for myself but away his WBA super-lightweight title for all Namibians,” said Indongo. Black Pearl Magic Magic Romance GB Regina Monica Wave 8” N$ 56.95 N$ 48.95 N$ 94.95 Angel Dish Nobel DisneyWash 400ml N$ 8.50 Weave Zara N$ 32.95 Nubian all colours N$ 46.95 Clere Body OrganicCream 300ml Olive Oil Wrap Mousse N$ 15.95 N$ 73.95 Sta Sof Fro Hi Sheen / Extra Dry Spray 350ml N$ 23.95 Joedir Wrap it GVOAORLOUMDEOSORTFEONAT$H3NE0D00 all colours Kings Candles N$ 127.95 BUYWhite 400gmBags Ice 200’s GETN$ 11.95 15XLTRRERVLEOLANXER FREE! N$ 10.95 E&OE HERO: Julius ‘The Blue Machine’ Indongo (centre) with some of his fans. T&C APPLY Photo contributedOPEN TO ALL RETAILERS NATION-WIDE!
27 April - 04 May 2017 ADVERT 19 ORANJEMUND Recreation Club | 1 June | 18h30 “Making money in a controlled environment is challenging. Transparency is key.” DR QUINTON VAN ROOYEN 21Quinton van Rooyen @qvr @trustco_group • #QVRFAQ
20 SPORT 27 April - 04 May 2017 SPORT Five clubs advance He lost in riveting final by one point in FA CupDIRK CLAIMSARCHERY BRONZECompound cadet, Dirk de Bod, clinched the Bronze medal for archery at the first leg ofthe European Youth Championships last weekend in Greece. Gabby TjirozeThe 14-year-old learner from EYES ON THE PRIZE: Teams onto the next round. Photo contributed Windhoek Gymnasium shot1/8 eliminations against Sebas- Staff Reporter thriller at the Sam Nujoma Stadium.tian Osnowski from Belgium Beauties were 3-1 up before theon Thursday, winning De Bod Five teams have advanced in the boys from Kavango-East bounced111 points against Osnowski’s last-16 finals of the Debmarine back in a surprising manner which105. Cup following action played out forced the game into penalties. on Saturday at the Oscar Norich He then had to shoot in the Stadium and Sam Nujoma Sta- UNAM FC then took on Elevensemifinals against fourth-seed- dium in Tsumeb and Windhoek, Champions and in the end theed Giovanni Abbati from Italy, respectively. Clever Boys recorded an impressivewhich proved to be more of a 3-1 win over Champions.challenge for the young blood UNAM, Beauties, Touch & Go,and he lost in a riveting finale Eleven Arrows and Young Chiefs Premiership outfit Young Chiefswith a mere one point. joins Bee Bob Brothers, Eastern and Kavango-West’s Kantema Chiefs and Try Again after qualify- Bullets squared off, with Chiefs This meant that Abatti went ing for the next round. Bee Bob winning 3-2 at Tsumeb.through to the Gold medal Brothers, Eastern Chiefs and Trymatch and De Bod had to shoot Again qualified without kicking a Ogongo United faced Elevenfor either Bronze or settle for ball after their opponents withdrew Arrows with the latter winningfourth place. from the competition. 8-0. The day then closed off with a clash between Oshikoto regional Saturday’s match against More Debmarine Namibia Cup qualifiers Khuse against Namibiatenth-seeded Kai Thomas- fixtures are slated for this weekend Premier League returnees TouchPrause from Great Britain (29 and 30 April), with the final & Go. The two sides played to anproved an easy win for De Bod programme to be confirmed next exciting 2-2 draw before Touch &as he sailed through the match week. Go proved their bravery and wonand won comfortably with a 4-3 on penalties.nine-point margin. During last weekend, Rhino FC faced Young Beauties and UNAM Each of the clubs will receive “What a great first interna- FC took on Eleven Champions. N$18 000 for preparations fortional competition for this Rhino FC produced a six goal every round of action and the finalyoungster. We expect to see is slated for the 25 November thisgreat things from him in the year.future. All and all it was a greatlearning experience for the BULLSEYE: Dirk de Bod. Photo contributedwhole team and we are surethat we are on the right path Welwitschias readypreparing your youngsters for for Blue Bullsmore international events,”said Archery Association ofNamibia, Heidi Reddig. The team arrived on Monday.CHAMPIONS Gabby Tjiroze Playing against SouthThe Namibia Under-20’s won the Africa Cup when they beat Kenya 66-24 in the Rugby Africa Barthes tournament in An- The Windhoek Draught Welwits- African teams istananarivo, Madagascar on Sunday, 23 April. Namibia led 26-12 at the break with fullback Romanzo Lento, right wing Rudy chias will face South Africa’s always a challenge,Pretorius, lock Reinhardt Carelse and eighthman Riaan de Klerk each scoring two tries and scrumhalf Wihan von Wiellich Blue Bulls in a match on Saturdayand fly half Cliven Loubser one each, while Loubser added eight conversions. Photo contributed at the Hage Geingob Stadium. LYNN JONES Although the Welwitschias were Coach defeated 50-33 against Hino Valke in their opening match in the Forwards: Christo McNish, SuperSport Rugby Challenge last Shaun du Preez, AJ de Klerk, Mu- weekend in South Africa, Coach niovita Kasiringua, Ruan Ludick, Lynn Jones expressed satisfaction Thomasua Forbes, Rohan Kit- with their performance. shoff, Leneve Damens (vice-cap- tain), Andries Rossouw, Gerhard “I am quite impressed with a lot Lotter, Collen Smith, Mahepisa of aspects of the team in the way Tjeriko and Victor Rodriques. they handled and approached the game. We are now fully prepared This year’s tournament is the for Saturday, even though it is not first edition of the SuperSport going to be an easy match. Play- Rugby Challenge previously ing against South African teams is known as the Currie Cup, a sec- always a challenge,” said Jones. ondary domestic rugby union competition in South Africa. Jones will still announce his starting 15 and seven reserves but The competition is organised by has named a 24-man squad for the the South African Rugby Union match, with the only newcomer (SARU) and will be played be- being lock Ruan Ludick, who tween 22 April and 16 July. It will comes in for Max Katjijeko, and feature all 14 South African pro- fullback Heinrich Smit. vincial unions plus the Windhoek Draught Welwitschias. The Welwitschias squad is as follows: Backs: David Philander, Tickets cost N$60 for the main Lesley Klim, JC Greyling, Darryl stand, N$30 for the open stand de la Harpe, Gino Wilson, Theuns and N$10 for students and chil- Kotze, Eugene Jantjies, Francois dren on the open stand. Wiese, Aurelio Plato, Cameron Klassen and Heinrich Smit.
Search
Read the Text Version
- 1 - 23
Pages: