Jan21 East Algarve Magazine

MAGAZINE © OLHÃO · SÃO BRÁS · TAVIRA · ALCOUTIM · CASTRO MARIM · VILA REAL DE SANTO ANTÓNIO ISSUE NO. 141 JANUARY 2021

KOZIISHOP.COM R. Dr Augusto Silva Carvalho, 2C TAVIRA - Open Every Day WINTER SALE 5 0 %U P T O HOME DESIGN - FASHION - ACCESSORIES

Thank you! 2020 has been an unusual year but we would like to thank all of our buyers and vendors for trusting us to buy or sell their Algarve properties.We wish all our clients and friends a merry Christmas and a happy and healthy 2021. Here is just a small selection of the villas we have sold so far this year. TVR4453 / LUZ DE TAVIRA / €1,750,000 TVR4458 / LUZ DE TAVIRA / €525,000 TVR4454 / LUZ DE TAVIRA / €475,000 TVR6719 / SANTA LUZIA / €365,000 TVR6618 / SANTA CATARINA / €395,000 TVR4451 / LUX TAVIRA / €325,000 If you are thinking of buying or selling please get in contact. Fine & Country Tavira (Fine Estates Lda) AMI 11564. | Avenida Engenheiro Duarte Pacheco, n.˚54, 8800-537 Santa Luzia Office Tel: 281 023 263 | [email protected] | Emmanuelle Deschamps 919 025 200 | David Holder 919 004 100 International head office Park Lane London | UK telephone 0207 3180631 | 121 Park Lane, Mayfair, London W1K 7AG, United Kingdom

EastAlgarveM A G A Z I N E Welcome... PUBLISHER & ...to your January issue and indeed to 2021. DESIGNER This month we give you an alternative view of Vila Real de Santo António along with a brief look Richard Bassett into its history. We visit Tchin-Cheese, a cheese and wine shop recently opened in the center of Tavira EDITOR offering a huge selection of cheeses and organic Richard Bassett wines. Maureen Lobeu has been busy this month; firstly meeting Nino, the 'go to guy' in the East CO-FOUNDER Algarve, and secondly visiting the Pastelaria with a Richard Bassett Snr. difference, Pastelaria Jardim. We also introduce a brand new column for a bit ADVERTISING of fun: Bad advice, Ask the Expat. I'd love to hear Call 961 700 200 or email your thoughts about it (remember it's for fun). [email protected] All this plus our regular features including local news, property, gardening, health and finance. DISTRIBUTION As always, your comments or suggestions are 3,500 copies printed. welcome, please email [email protected] All advertisers are issued copies for distribution, Richard Bassett, Editor along with retail outlets. COVER PHOTO Richard Bassett All rights reserved. Except for normal review purposes, no part of this magazine may be reproduced without the written permission of the publisher. Every care has been taken in the preparation of this magazine, but the contents are only meant as a guide to readers. The proprietors of this magazine are publishers not agents or sub agents of those who advertise therein. The publisher cannot be held liable for any loss suffered as a result of information gained from this publication Unipessoal Lda INDIAN TASTE THE DIFFERENCE! FARMER CABANAS Home grown spices imported from India gives a unique flavour producing the best Indian cuisine in the East Algarve! 4 www.eastalgarvemag.com

Contents 6 NEWS 48 Local news. 8 8 PLACES Tchin-Cheese, Tavira. 12 PLACES Vila Real de Santo António. 16 PLACES Arraial Ferreira Neto. 18 PEOPLE Mr Linked-in. 22 PROPERTY Rentals during Covid-19. 24 PROPERTY Property of the Month. 28 PHOTOGRAPHY Photo of the Month. 32 TAVIRA Find our advertisers on the map of Tavira. 34 PEOPLE The reality of living with Covid part II. 36 BAD ADVICE Ask the Expat. 37 HEALTH Sara from Ser Igual. 12 37 HEALTH Diet & blood sugar levels. 41GARDENS The Almond. 44 FINANCE Finance news from Ricardo Chaves. 46 FINANCE Financial advice from PCC. 48 PLACES Pastelaria Jardim. 52 GOLF Temper, temper. 54 CLASSIFIEDS Grab a local bargain. www.eastalgarvemag.com 5

News Algarve’s Portugal masters puts a spring in the step for European tour Portugal Masters returns to Dom season is traditionally hugely popular said: “It is always an honour to host one Source: www.golfmagic.com Pedro's stunning Victoria Golf with visiting golfers, thanks to the of the European Tour’s most popular Course from April 28 to May 2 in destination’s warm temperatures and events and everyone took great pride 2021... manicured courses. in the way the tournament was staged The Algarve, one of Europe’s finest golf The Portugal Masters is one of the in September with so many new safety holiday destinations, will put an extra big-hitting events on the Tour and was measures in place. spring in the step of the European Tour praised for its superb organisation in “This is extra recognition of the trust schedule as the Portugal Masters makes a 2020, where a successful Covid testing placed in us to deliver another safe and seasonal switch for the 2021 Race to Dubai. programme allowed the event to run successful tournament for many of the Traditionally hosted in the autumn smoothly and also saw the European world’s top golfers and we look forward in recent years, the annual 72-hole Tour host its pilot pro-am event, to welcoming them all once again to the battle over the challenging Dom Pedro supported by the Algarve Biomedical Algarve in April.” Victoria Golf Course will now take place Centre. Additional incentive to visit the Algarve from April 28-May 2, 2021 as part of a The Algarve has implemented extensive this spring is being provided by the revamped schedule of tournaments. Covid measures in recent times for tourist board’s “Golf Clubs are on Us” Alongside the recent positive news on guests to feel safe as possible on the promotion, which covers the costs of vaccines, the announcement represents stunning southern Portugal coastline golfers taking their clubs on flights for some extra encouragement for golfers and to maintain their confidence in the travel up to the end of May. Bookings, to plan their own spring return to the destination. however, must be confirmed by 31 Algarve’s cherished fairways. The spring A spokesperson for Algarve Tourism January to avail of the offer. A22 tolls to be Positive results in climate change Source: ThePortugalNews.com cut by 50% Portugal has climbed eight positions, compared to 2019, in the Climate The PSD’s proposal to Change Performance Index and was the third country with the highest reduce tolls by 50 percent, increase in climate measures, after Sweden and New Zealand. in ex-SCUT roads, The Climate Change Performance Index 2021 (CCPI) is a comparative analysis of including the Via do Infante (A22), climate protection in 57 countries (plus the EU), which represent 90 percent of has been approved by parliament, global greenhouse gas emissions, and is the responsibility of two international with votes in favour of all parties, organisations; Germanwatch and NewClimate Institute. except the Socialist Party and The list released doesn’t yet reflect the year of 2020 and the consequences of the Liberal Initiative. pandemic, however, the two organisations said that no country on the list is on According to Sul Informação a path compatible with the objectives of the Paris Agreement, signed by almost newspaper, the reduction of tolls every country in the World in December 2015. ‘by 50 percent for combustion However, they point out that greenhouse gas emissions are decreasing in more vehicles and 75 percent for than half of the countries analysed. The EU receives a high rating of climate electric vehicles’ will come into protection and within this there are seven countries that also stand out positively, ‘effect from 1 July 2021’. one of them is Portugal. “In regions where there are no In the analysis of the Portuguese classification, the environmental association alternatives, where accessibility Zero, which is part of the International Climate Action Network (which costs are very high and where cooperates in the publication of the Index), highlights the important rise of public transport isn’t a good Portugal, but warns that the emission of greenhouse gases per capita are still option, it is vital to take essential increasing, without a large increase in the use of renewable energy. steps to minimise context costs. The Index, published annually since 2005, measures greenhouse gas emissions, That is what the Parliament has renewable energy, energy use and climate policy, and intends to create political done with this decision”, said and social pressure on countries that don’t reach the objectives. Cristóvão Norte, PSD deputy. www.eastalgarvemag.com 6

Alfresco SUPERMARKET The taste of home Tel: 00351 281 326 197 or 00351 920 039 424 Rua Dr. Jose Padinha, No126A, 8800-354, Tavira Facebook: DAWAT INDIAN RESTAURANT EAT INSIDE, ON THE RIVERSIDE TERRACE OR TAKE-AWAY BFORROYWOUSR WINTER Ruy Barros SPA PACKAGE Hairstyling & Beauty Salon ONLY 3 for €49 Ladies & Gents BROW DESIGN Welcome to our new AND TINTING: » Back, Neck and Shoulder space in the centre Massage of Tavira! With a • Sobrancelhas professional and • Henna brows » Hot stone therapy friendly service. • Microblading » Deep cleanse facial Cut, colouring, • Permanent make-up/ » Eye collagen treatment » Mini anti aging facial perming, hair extensions, hairstyling, Micropigmentação » Foot and Ankle Massage hair treatments, massages, face/body • Eyeliner » Bright eyes treatment treatments, make up artist, epilation, • Lots of Beauty treatments » Lip collagen treatment laser, lash extensions, gel nails, nail art, gel polish and much more. JANUARY SALE PAMPER YOURSELF, MON - SAT 09.00H - 19.00H Brow tint & design €8 YOU DESERVE IT... All year Travessa Zacarias Book for a free consultation, we are I look forward to seeing you... Guerreiro No16, Tavira behind the old Cinema in Tavira: Tel +351 281 023 636 Tel; 919 630 255 Mob +351 964 888 810 or 18 Rua Guilherme Gomes Fernandes [email protected] 913 999 906 800-669 Tavira Email: 910 944 437 [email protected] For your brows only.com Rui Barros Cabeleireiros e Estetica www.eastalgarvemag.com 7

Places Age only matters with Cheese & Wine You can now enjoy the best of fine cheeses and organic wines, from Tchin-Cheese,Tavira 8 www.eastalgarvemag.com

Tchin-Cheese, has the ultimate In search of new challenges, in 2014 Gaëlle to grow organic products. selection of cheese and organic went back to school to learn about organic In the interim period Guillaume began to buy wines, located in the heart of plants, teas, and medicinal herbs. Guillaume and sell Portuguese organic wine to bars and Tavira. Owners Guillaume and went to agricultural school, and earned a restaurants which he continues to do; (see Gaëlle, from Brittany, opened master's degree in how to sell wine; a very Theorganicwinecollection on Facebook and their new venture on the 18th of September, involved process that included learning Instagram). 2020. everything about growing wine. Part of this The outbreak of COVID-19 hugely affected The couple has a background in video and included biological and organic wine, very business which gave Guillaume and Gaëlle filmmaking, specialising in music videos, much in-line with the path Gaëlle had taken. three months to consider what to do with their specifically Electro music. They ran a Their new-found knowledge inspired a future here in Portugal. During this time the programme called 'Plug-in' which aired on change of life that was much more organic ideal space and location became available in local TV in western France. and involved a different circle of friends and the center of Tavira, the perfect place to sell Having had a holiday home on Armona Island acquaintances, along with a new direction of organic wine. since 2000, Portugal had always been a place life. Their intention was to sell the house on Guillaume became familiar with Tavira selling for a restful retreat, within easy reach of home. the island and buy a Quinta in the countryside wine at the annual Mediterranean diet fair www.eastalgarvemag.com 9

Places 10 www.eastalgarvemag.com

Places which was very successful. He also noticed Also available are Spanish manchegos, wine, cheese tapas, or even a cheeseboard that there were no cheese shops in Tavira. The mozzarellas, burattas, and many other while sitting at the shady terrace. perfect pairing was made... Tchin-Cheese! seasonal products. As for the shop’s wine In the future, Tchin-Cheese will be holding The shop sells mainly fine French cheeses, selection, Guillaume and Gaëlle choose wine tasting and presentation evenings, and including some of their favourites such to work with 15 small and independent art exhibitions. Currently, at the store you can as Comté, Camembert and Roquefort, all Portuguese winemakers. see some of Guillaume's sister's stunning fine handcrafted, organic, and made with raw The store’s organic ethos is taken very artwork; incredibly detailed using black ink and milk, along with a meticulous selection of seriously as the couple is “committed to the gold leaf. Look out for a feature in a future issue. local products, including carefully selected protection of the environment and the welfare You can find Tchin-Cheese at number 24 on Portuguese honeys and olive oils, spices, of domestic and wild animals”. “We have Tavira’s Rua da Liberdade. organic teas, chocolate, coffee, and more. always tried to eat and drink safe and organic Tel; (+351) 915 474 033 During our interview, a very important delivery products when possible,” they say. email; [email protected] arrived... fresh black truffles! Visitors can also choose to enjoy a glass of Facebook; 'Tchin-Cheese' www.eastalgarvemag.com 11

Places Vila Real de From the first stone laid to the inauguration in just over 18 months, here's a little about the incredible town of Vila Real de Santo António V ila Real de Santo António extends for 62,45 Km² and is the first stone laid on 17 March, 1774 and divided into three parishes: inaugurated on 13 May, 1776. The city Vila Real de Santo António, plan was marked in the place then called Barranco on March 2, 1774. The buildings Monte Gordo, and Vila Nova de were pre-fabricated and standardised to Cacela, with circa 20,000 inhabitants. replicate downtown Lisbon. The orientation The history of Vila Real de Santo António was longitudinal to the Guadiana River, has a relatively recent origin. The now town facing Ayamonte in Spain, also located at the (elevated to this status in 1988), was ordered mouth of the Guadiana river, on its left bank. to be built by a Royal Charter signed on From the 19th century Vila Real de Santo 30 December, 1773. Its construction was António attracted workers from neighbouring completed in a little more than two years, towns and villages due to the fishing industry 12 www.eastalgarvemag.com

Santo António and the increasing number of canning economic prosperity of the municipality in factories (the first one appeared in 1879), the 20th century. Vila Real de Santo António which were followed by the industries of was then called \"Bolsa do Atum\", and this bobbin lace and palm made objects. This fish was responsible for changing the way increase in economy was also helped by the of life of the local population, especially in S. Domingos Copper Mines, which exported gastronomy. Tuna was also the cause of the their copper pyrites shipped along the biggest demographic increase in the town. Guadiana to the port of Vila Real de Santo People came to look for jobs not only in António. This port quickly became the most fishing and canning, but also in the various important one in the Algarve province, with factories and shops that complemented foreign ships collecting copper and tuna. these activities. Tuna was mainly responsible for the www.eastalgarvemag.com 13

14 www.eastalgarvemag.com

Places www.eastalgarvemag.com 15

Places FerArerirraaiaNleto (Hotel Vila Galé, Albacora) Once a self contained village and now a Hotel,Vila Galé Albacora houses a small, yet fascinating museum dedicated to the history of the Tuna Fishing industry in the Algarve B ack in 1941 the owner of a Tuna fishing company, Jose Silva 'housing' area being yellow/ochre, and 'work' Part of the Co-operative area now houses a Ferreira Neto, built what is now areas white. These colours are still used today, museum. The most impressive exhibit being a the Hotel Vila Galé, Albacora. although the complex has no division. The huge model of how the Tuna fishing nets would accomodation was made up of eleven 'streets' have been set out at sea offering a fascinating Originally the complex was each named after a predominant figure within insight as to how the process worked. The huge designed to be what is known in Portugal as the community. network of nets would slowly be reduced until an 'Arraial'. A small village accomodating The 'commander' of the Arraial lived in the main the fish were confined to a square surrounded 4-500 people, consisting of the fishermen house, along with the accountant, teacher, by the fishermen in their boats. This square was and their families. The Arraial included small and village hairdresser. The house is located referred to as the 'Almadrava'; the killing place. houses, a church, school, a co-operative centrally and has a viewing tower (big brother The fish would thrash around violently, and as where people would trade their goods within was watching back then too). they were hooked out of the sea it would turn the community, and working areas. The space A pretty little church was added later in 1949. red with blood. was divided into two zones, work; now the area The fishing season started in May, when the At its height in 1881, the fishery caught 43,000 around the pool, and living; now largely hotel nets and boats would be blessed with salt Tuna fish, however, due to a change in the accomodation. Areas were separated by a wall water, and an offering of a crown made of route the fish took to breed, in 1971 this figure (now removed) and also defined by colour; the flowers would be left on the beach. plummeted down to one single fish. 16 www.eastalgarvemag.com

www.eastalgarvemag.com 17

People 18 www.eastalgarvemag.com

People Linked-inMaureen LoBue meets the most 'Linked-in' person in the AlgarvetheEastAlgarve...from organising Fado evenings, to property rentals, Nino will be able to assist, or will know someone who can Ihave a 3 month stay in the East “What's missing for people who will stay here these years of operation.” Algarve and want to see the area and on either short holidays or for longer stays?” A returning couple who has attended dinner find events where I can meet other The answer was the connection between dances described them as “Fantastique!” people. I need a place to stay, but I am clients and businesses, the transparency and An important factor in his success is the close not sure which area suits me or fits my the consistency, a central way to not only get support of clients. When an event is planned, budget. So many questions and uncertainties information but feel supported. such as a dinner dance or Fado night, Nino that make me feel overwhelmed. Who do I “When you do it well, they always come arranges individual transportation to the event talk to? Who can I trust? Who knows about back” and personally meets everyone at the venue. local activities and events?” I am stressed How does Nino connect with the community That kind of support is rare. According to an about all of this. and maintain that connection? Initial contact event attendee I spoke to, “It is fantastically Then, I find the person who I now consider through www.montegordo-online.com, word organised. He picked me up in front of my door!” to be 'Ultra Linked-in'. The one person who of mouth, or other businesses. A continued “I always start with the logistics” can answer all these questions and help my connection is done by keeping in touch with In 2015 Nino observed another gap and filled stay go smoothly, a central support person. clients even after they leave through email, it by creating 'Sports Algarve'. With the same No longer overwhelmed, I can look forward WhatsApp, or phone. focus on supporting clients, Sports Algarve to my Algarve experience. And if I return to A key to building the trust of clients is is designed to connect football and athletics the Algarve after being away, I will have some transparency and consistency. “We have been groups throughout Europe with training favorite things to count on and familiarity creating packages for over 10 years so we camps and facilities in Portugal. Nino works which is essential. know what to offer and we can explain it with as the organiser, setting up the logistics. “I Ultra linked-in, better known as Nino, has ease. The structure and pricing are consistent always start with the logistics.” When a trainer created a one of a kind organisation for the throughout the year.” Returning clients know contacts him to arrange a time frame between East Algarve, a central resource and support they can count on a wonderful time each and October and April, Nino arranges a package for activities, events, apartment rentals, and every time. One couple's response after an with the same transparency as with events more recently, sports training camps. All of evening event was “It was a very beautiful and activities. Venues, accommodation, these can be found in a central place as well, evening with fantastic musicians and a etc are all included the entire experience is on the website www.montegordo-online.com. wonderfully well-groomed dinner.” catered for. The connection is made during all Each section has a clear link to details and The keys to keeping that trust are consistency the arrangements. It is continued by meeting contact information, whether it be hiking or and support. “People never ask for the the groups at the airport and being available scooter exploration, local entertainment, or details, it is a given all events will be at any time during the camp intensive. This accommodations. Everything can begin here. organised to the highest of standards and message from a trainer, “First day training “How can I be different from the others” without any \"surprises.” Clients return for camp of Sports Algarve almost behind. Like so many, Nino came to the Algarve events and packages because along with the Training on a great field, beach walk, football knowing no one. Quickly he started transparency there is the trust that the quality and a lot of fun”, sums it up well. making contacts with local businesses and will remain and that communication will be Two special events lined up for 2021 include people. Looking at a number of projects he clear. “Clients continue to return during all the Jeu de Boules Tournament and the discovered what was most needed, a consistent connection between International Football Tournament for agencies and their clients. So, in 2007 veteran teams over the age of 35. he became that person, a connector. He Sports Algarve details can be accessed created and established his own unique from a link on www.montegordo- organisation. online.com or from a separate website His strength in doing this comes from www.sportsalgarve.com. a background in The Netherlands New people coming to the area can where he learned about processes count on Nino to get them connected to and logistics in the business world. the community and get to know it. Long Listening to people here, led to seeing stay and returning people feel they are the gap between agencies and clients part of the community through familiar and he decided to fill it. events and activities. Whether you The question behind it all was “How are new to East Algarve or a returning can I be different from the others?” resident, Nino the connector is there to support you. www.eastalgarvemag.com 19

www.tavirada Visit us: Travessa Jacques Pess Call us: 962 012111 Email us: tav www.facebowok.wcow.m/ttaavivriardaartdesa Visit us: Travessa Jacques Pess Call us: 962 012111 Email us: tavi www.facebook.com/taviradartes Follow us: Follow us: w w w. t av i r a d a r t e s . c o m Visit us: Travessa Jacques Pessoa 8,Tavira, 8800-374 Call us: 962 012111 Email us: [email protected] Follow us: www.facebook.com/taviradartes www.instagram.com/tavira.dartes Compass Property Sales www.compasspropertysales.com Rua de Santo Estevão 25A [email protected] Tavira. AMI 17591 Call us +351 281 323 876 ¤550,000 BEAUTIFUL, QUALITY 4 BEDROOM VILLA WITH POOL AND GARAGE ENJOYING MARVELOUS COUNTRYSIDE VIEWS Impressive, never lived in 4 bedroom / 5 bathroom villa (204 m2) enjoying a 9m x 4m swimming pool surrounded by extensive cobble stone terraces, nestled in the hills in between the coastal town of Tavira and the quaint village of Santa Catarina da Fonte do Bispo in the Eastern Algarve. The solidly built property sits on an elevated position of a fully fenced, low maintenance plot and benefits from a good size garage (35 m2) and open views of green and gentle rolling hills. Oriented to the West, the property is flooded with light and enjoys a warm Mediterranean feel with the use of ceramic floor tiles in terracotta and oak wood finishing’s. This is a home not to be missed for those who seek a property in an authentic Portuguese countryside environment, without comprising on quality or comfortable living. • 4 bedrooms • 5 bathrooms • 1000m2 plot • 204 m2 habitable area plus spacious 35m2 garage • Constructed 2013 • Double glazed windows • Aluminum shutters • Solar panels • Pre-installed air-conditioning • Fully fitted and equipped kitchen • Oak wood works • Fully walled plot • Countryside views • 9m x 4 m swimming pool • Automatic irrigation • Extensive cobble stone terraces • Mains water and drainage (2nd meter possible) • Reference number: V-COT • Energy rating: E 20 www.eastalgarvemag.com

HAPPY NEW YEAR - HAPPY NEW HOME! 3 BED UPDATED APARTMENT - €155,000 2 BED APARTMENT WITH POOL- €158,000 Just north of the Convento de Bernardus, Situated in the village of Cabanas, this stylish near Tavira town centre, this spacious second apartment offers modern design, large areas floor apartment was fully refurbished with new and big communal pool. A great investment bedrooms, kitchen and bathroom for a permanent home in the sun 2 BED REFURBISHED APT.- €218,000 4 BED TOWNHOUSE- €245,000 Situated in the centre of Tavira is this recently This closed urbanisation in the small village fully refurbished apartment. Spacious indoors of Manta Rota is only 900m from the beach. with a large terrace, you have plenty of It offers a large communal pool, private garden choices to create your own dream home with BBQ and stunning views THE BEST OF THE ALGARVE Rua 1º de Maio, 32, 8800-360 Tavira Tel: +351 96 25 66 421 - www.proluna.com E-mail: [email protected]

Property Rentals during Covid-19 The past year has been How the current pandemic has affected the difficult for many people long and short term rental sector, from Robert Bijker and businesses all over the world due to the pandemic. Director,Yellow Homes Algarve Lockdowns, closed borders, curfews, and quarantine PROPERTY MANAGEMENT HAPPY HOMES ALGARVE measures have put many lives upside down. As the Algarve´s economy is highly dependent ALGARVEAN COTTAGES V I LLAS A PA RT M E N T S TOWNHOUSES QU INTAS on tourism it was badly hit. According to Rita Marques, Portugal´s Secretary of State for Happy Homes Algarve is currently looking for additional good quality Tourism, tourism has been set back by 10 rental Villas and Apartments to offer to our customers for next season. years due to Covid-19 and lost 7.7 bn Euro in If you have a property to let, please contact us for more details' revenues in 2020. There are always hotels that normally close Confused about the new rental law? during the winter months, but not to this extent. Contact us for specialist advice. At the end of December, only 80 out of the 400 hotels in the Algarve were open and these had h a p p y h o m e s l da. Contact us today: 281 320 283 very few guests. With so few holidaymakers w ww.p o r t u g a l - a c c o m m o d a t i o n . c om in the Algarve, it makes financial sense to R ua Dr. Parreira 1 37 temporarily close as the fixed costs of running next to Barclays Bank a hotel are relatively high. The local lodging 880 0 - 3 46 T av i r a sector is also suffering, albeit to a lesser extent than hotels. Income may be down year on year, REAL ESTATE LAND & HOUSES ALGARVE but the operational costs are also much lower compared with hotels. Only very few owners of GOLF PROPERTIES VILLAS A PA RTMEN T S T O W N H OU SE S PLOTS rental properties had rental income equal to or higher than in 2019. The majority registered a LHV - 1062 fall in income of 30 to 35%. Some sadly did not have any bookings at all in 2020. Covering the whole of the Algarve as independant real estate agents, we can provide you with unbiased advice when you Mr. Elderico Viegas of the hotel association decide to purchase a property and can introduce you to a wide choice of reputable mortgage banks, architects, lawyers, builders, AHETA expects it will take 4 to 5 years for charteredsurveyors andinterior designers. We have been in business for over 16 years, finding the right property for countless satisfied business to return to levels enjoyed before the clients. We currently have over 900 properties available online and would be very pleased to help you find your ideal home. pandemic descended. However, we believe that the local lodging sector will recover faster If you are the owner of a good quality Contact us today: 281 320 281 for two reasons: property and wish to sell, please contact www.l an d an d h ouses a lga r ve. com A shift has been noticed in holidaymaker’s us to arr ange an appoin tment preferences for self-catering accommodation owing to the fact that during the pandemic TAVI RA VI L A MOURA people prefer to avoid the shared facilities that hotels offer. (Who wants/needs a stranger to Rua J osé Pi r es Padi nha 1 78 N1 25, B enf ar r as, B ol i quei me go into their bedroom to make the beds every 8800 - 354 Tav i ra 810 0 - 068 B ol i quei me day?) Increase in demand for long stays from both 22 retirees and people preferring to work from home. This trend started long before the pandemic, but the latter is gaining traction due to increased acceptance of working from home) Few hotels offer this type of service, but this may change. If you bought a rental property in the 2nd half of 2019 or in 2020, it is highly likely that the rental income was below your expectations. Properties that have been available to rent longer have the benefit of having established marketing channels in addition to the benefit of repeat customers. An additional benefit is being open-minded to accepting long www.eastalgarvemag.com

stays in combination with short term lettings. Property Many homeowners do not accept a long stay booking as they wrongly assume that they DRONE VIDEO & pay a higher tax rate of 28%. However, and PHOTOGRAPHY if booked correctly, you can invoice long stay income under the AL regime and benefit from High resolution photography the lower rate of 8.75%. and 4K Video, With the rollout of vaccines and ongoing safety call or email: precautions, eventually, things will normalize. How long this will take is everybody’s guess. In T: 961 700 200 E: [email protected] the meantime, we believe that holidaymakers will continue to have a preference for private accommodation such as apartments, village houses, and villas with a private pool as it offers their families a more protected environment. If you are the owner of a good quality property with or without a swimming pool and would like to have more information about the do’s and don’ts of local lodging, rules and regulation, and taxation please contact us. We are currently listing homes for the upcoming season to add to our portfolio. Best wishes for the New Year and stay safe and healthy. Robert Bijker Director Happy Homes Algarve Rua Dr. José Pires Padinha 178 8800 - 354 Tavira Tel: 281 320 283 Fax: 281 321 901 www.portugal-accommodation.com www.eastalgarvemag.com 23

SOL SOL Russell & Decoz wishes you all a Very Happy, Healthy & 24 www.eastalgarvemag.com

A defining year requiring a new & diverse approach. Forward thinking strategies providing excep�onal results Your HOME?& sa�sfied clients.Your HOME? Selling your HOMEW, beuasrineehsseroepptoorsteulnl iytyouorr pprroojpecetrtisyat We are here to sell your propertythe heart of what&wefindod.yWoeurhnaveewcoHnO�MnuEe.d to support our homeowners throughout 2020 & are excited about & find your new HOME.receiving new proApdeerfi�niengsy.eBarerecqoumirineg apnaewrt&odfiveorsuerapepxropaachn. ding por�olio in 2021 &&Fosreaw�xasprfdieetdhricinleikeinnntgcs.setratthegeiesapdrovvaidnintgaegxceepo�ofnoalurersults D bespoke service. ASedlleinfignyinoguyreHaOrMreEq,ubiruinsignaesnseowpp&odrtiuvenritsyeoarppprroojaeccht.is at We would like to ttFohhouerrawhhnaeorakmdrtetahooliwfnlwknoiehnuragstrstwthrceraoltduieeogg.hineWostuepstrh,2oa0vvv2ieed0icnn&ogdnae�orxencrueesepxd,c�iotbteonduasluayrpbeeposrouusrtltt,s Facebook, Instagrap&reomcsrea�i�evosilrnfiiosge,idnneYc2wloi0e2pnu1rtTos&.pueebrx�peeesrr.iseBne&cceomPtheienpatadervtaroneftasoguterfoeofxpollauonrdwineg rs LDifnotrothoeursu2p9pthoyretagri.vSbWeeeelslnpiwnogodkuyeuoldsuerlrriikvHneicOgteMo.2tEh,0abn2uks0ianleal osnsuordpclpgieoonrttiusn,nvigteynfodororprswr,objaeucyrtedirss,at Fthaecehbeoaorkt,oIfnwsthaagtrawmeedrso,.YWoueThuabveersco&nP�innuteerdestot fsoullpopwoerrts oifnoutrrothhooeumrsu2ep9optwhoynreetargsri.vtehnroduugrhinogut22002200a&ndagreoienxgciftoerdwaabrdout LD www.russell-decoz.comreceivingnewproper�es.Becomepartofourexpanding salbpeeosr�[email protected]&sleewssxp.@eerruirelunslcses-sdteheelelal-ldd-vcdaeneotcacgozeozoz.f.c.cocuooor mmm LD caWlle:wo+uld3likec5toat1lhla:nk+2a3ll8o5u1r9cli2en8t7s,9v9en7d2o9rs2,b7u7ye88rs5, 5Facebook, Instagramer+s, 3You5T1ube9rs1&1Pint7er6es5t fo1llo0we0rs for the+sup3port5giv1en du9rin1g 20120 an7d g6oing5forw1ard00 Coninttaocoturu2s9tah ynedarl.eaDron you have a house for sale? about our sales strategies. Contact us and Do yaobwuowuhwta.ovrueusrassehallol-edusescseotzrfoa.crtoesmgailees?. learn [email protected] call: +351 289 792 785 +351 911 765 100 Licença AMI:870 & Prosperous New Year Do@yoruusshealldveecoaz house for sale? 25 www.eastalgarvemag.com

Property Casa Anibal R/C loja B, Estrada da Manta Company AMI 7673 Rota 8900-038 Vila Nova de Cacela Office: Tel/Fax 281 952 820 Mobile: 00351 911 041 862 SALES: www.algarvemantaproperties.com RENTALS: www.algarvemanta.pt EMAIL: [email protected] HAPPY NEW YEAR FROM ALGARVE MANTA PROPERTIES VILA NOVA DE CACELA CASTRO MARIM GOLF 260.000€ REF 2646 390.000€ REF: 2643 • Fantastic townhouse 4 beds • Private sale • Private pool • 3 Bedroom villa • Roof terraces x 2 • Private pool • Open plan living/dining • Large plot • Close to centre and facilities • Air conditioning • Parking in front of gate and on drive • 3 Bathrooms • Train and bus routes in town • Gorgeous views • 1.6Km to the beach Manta Rota • Master suite with huge veranda EastAlgarveM A G A Z I N E MAIN OFFICE – (Waterfront) Ava Ria Formosa, Centro Comercial PROMOTE YOUR Loja 2, 8800-591 Cabanas de Tavira BUSINESS WITH US TEL: 281-370277 Mobile: 91 7212498 FROM ONLY €65, OFFICE – E.N.125, Cevadeiras, UP TO €295 FOR 8900-024 Vila Nova de Cacela TEL: 281-951165 Mobile: 91 2177055 A FULL PAGE EMAIL [email protected] If you would like to LICENÇA No 504-AMI WEBSITE www.estealgarve.net promote your 1 BED. PENTHOUSE W/ STUNNING ROOF TYPICAL LYNKED COTTAGE W/ ANNEX business with the East TERRACE (65M2)- CABANAS - Within - TAVIRA HILLS - Approx. 16 kms from Algarve magazine walking distance to all amenities and beach Tavira and 11 kms from Vila Nova de Cacela, contact us on access. Sold partially furnished and equipped. in a small hamlet. Covered area of 71m2 Large east/south facing terrace (33m2). and patio 57m2. Beautiful countryside view. [email protected] Private parking in basement, access to s. pool 3 bedrooms. Small roof terrace. ENERGY or Tel 961 700 200. ENERGY CLASS B+ €228.000 CLASS - E €205.000 As an advertiser you www.eastalgarvemag.com automatically become a distributor, and will be provided with a number of copies to issue to your customers. 26

LUXURY APARTMENTS IN CABANAS Divine Home - Scan the QR- Luxury 2 and 3 bedroom apartments, Sublimematriz Med. Imob. Unip. Lda code to view full in advanced construction phase, Rua 25 de Abril, 4 photo gallery and located in Cabanas de Tavira, just a 8700-081 Moncarapacho description online mere 100 meters from the Ria Formosa, 00351-289 247 824 one of Europe’s most beautiful natural [email protected] reserves. www.divine-home.eu These apartments are built according to very high standards and with good quality materials. All apartments are built with a fully fitted kitchen, luxury bathrooms, air conditioning and built- in wardrobes. A parking space in the underground garage is included for each apartment. There is a good variety of 2 and 3 bedroom apartments available: Ground Floor: 2 bedroom apartments with a private garden, direct access to the communal garden and communal pool. Prices from ¤245.000 to ¤255.000. First Floor: 2 bedroom apartments with a private balcony. Prices ¤235.000 and ¤240.000. Top Floor: 2 and 3 bedroom apartments with private plunge pool, private terrace and unobstructed views to the beautiful, green surroundings. Prices starting from ¤410.000 All amenities such as the beach, bars, restaurants and shops are all located on walking distance of these apartments. making this the ideal holiday home, permanent residence or superb rental investment. Do you wish to receive more information about these apartments (ref.: SAP1138) or do you wish to book a (video) viewing for this development? Call us at 00351-289 247 824, email to [email protected], or visit the website www.divine-home.eu for more information. You can also come and visit us at our office which is located next to the pharmacy, opposite the market in Moncarapacho. www.eastalgarvemag.com 27

PHOTO OF THE MONTH 28 www.eastalgarvemag.com

3 bedrooms townhouse Urbanização Marlin - Tavira Great views. Private pool 415.000€ A beautifully serene image by Peter. 3 bedrooms townhouse As usual submitted to the Santa luzia 1st line Facebook page: ‘Algarve Amateur Private condo with parking place Photography group’ Private elevator on the house Amazing views Camera used: Canon EOS 1300D, with CANON Zoom 680.000€ Lens EF 75-300mm Photographer: Peter Lanman (from Tavira) ALGAR VILA, Lda Comment from photographer: \"I never get bored of the Since 1986 (AMI 431) different opportunities to photograph in such beautiful Travessa das Cunhas, nº 29, 8800-372 Tavira, Faro locations and in such a range of light conditions.This day was no exception with calm waters and bright sunlight (+351) 281 324 115 Tlm. 00351 963 660 971 making me reach for the camera yet again\" Email: [email protected] www.algarvila.com www.eastalgarvemag.com 29

Car insurance Solicitor Looking for quality car insurance? specialising in: • Multi-policy discounts Real Estate • Legal and breakdown assistance Property Conveyancing • Protected no claims bonus option available Family law 281 325 842 Power of Attorney [email protected] English, French and Spanish speaking Rua 1 de Maio 26B r/c, 8800-360, Tavira Telephone: +351 281 321 794 www.ibexinsure.com/tavira Mobile: +351 963 096 407 Car Home Motorbike Travel Health Boat Business Pet Community Email: [email protected] Tr. Das cunhas n.º 35 8800-372 Tavira MONTE da PALHAGUEIRA VILLAGE Villas from: £140,000 Ι Apartments from: £95,000 DESIGNED FOR THE OVER 55’S Monte da Palhagueira offers 33 houses and apartments, exclusively designed for the over 55’s. Set within a traditional village development of 22 acres, just 20 minutes drive from Faro International Airport, the village nestles in the tranquil and picturesque hillside of Gorjões, Faro in the Algarve. EXCELLENT FACILITIES The village offers many unique features, including its own own Anglican Church, public restaurant, tennis court, two swimming pools and an ornamental lake, all set within traditional village surroundings, bounded by stone walled lanes and terracotta tiled buildings. COMPLETE PEACE OF MIND In addition, village properties all have access to British trained medical staff, on duty at all times, via an aid call system linked to the village nursing home. MAKE AN ENQUIRY MEFMFEoo--omormrnnffatautueieirlrl:tdtd:hhmamaeePrdrPoapiainnlnlvhtfhfeiaooladglrrgaaummpugeaaeeiartl@ithairiooaaaVngnmViuplpeilelalsleilgerabaaeagus@,seereG,ycgGcaoomobrnonabjrtôitaejlôae.cycscet.o,ctso8m,CA0m8ll00ieΙv05Wxe5-aW4-eRn48bed88o:b8rbwSe:SetwwNatra.twwes.BwvB.oare.arernsbretbit+aoriarren+aermam+3de5+deen13enNt52tvNv1e8iilxe9l2llexaa89,egg99A,ee09Appl99gool00agrrr0att9vuur0evgg0,aeaPl,l.o.cPcoroot..ruuutgkukagl.al. Part of the Amesbury Abbey Group, Church Street, Amesbury, Wiltshire SP4 7EX www.amesburyabbey.com 30 www.eastalgarvemag.com

Places A reliable real estate agent simplifies your life! FASTIGHETSBYRÅN TAVIRA +351 281 322 762 Rua Jacques Pessoa, nº 26, 8800-350 Tavira FASTIGHETSBYRAN.COM The importance of voting here in Portugal Exercise your right to have your say! O ne of the best things about inevitable. I know that as a resident my voice • Argentina, Chile, Colombia, Island, Norway, being an Expat and living in a and vote do matter and I will be using them to New Zealand, Peru, Uruguay and Venezuela patch of the world where the create an even better bubble. (Declaration nr. 4/2013, of 24th of June) weather is much milder than This past year has shown us how important it The UK has signed a bilateral agreement northern Europe and the skies is to vote, this right has been won with much with Portugal on UK nationals’ right to are blue for 300 days of the year, is the “Expat struggle between the centuries and has never vote in local elections. The agreement Bubble.” Slipping into that blissful bubble is been more important than ever. Democracies guarantees that if you were living in all too easy, feeling as though the real world and our voices remain and grow to create a Portugal before 31 January 2020 you has little to no impact on my personal life. The better world. Local elections for Tavira will maintain the right to vote and stand in local happy bubble feeling is enhanced because be held in 2021. As a resident you have the elections. the news here is in a language I do not speak, right to have your voice heard! Follow future If you have moved to Portugal after 31 write, or understand. This means that politics proposals and candidates with this practical January 2020, you will be able to vote in local is happily off my radar and yet, my entire guide for registering as a voter, the process elections after 3 years of residency After 5 existence here is dependent on my bubble only takes a few minutes and is of paramount years of residency you will be able to stand remaining blissful. importance to your future and your time here. and be elected for local office. If my patch of heaven sees changes, it will I am a foreign citizen and live in Portugal. How can I Register my Vote? no longer be my haven, the place I feel is May I vote in the Portuguese elections? Simply go to the Voting Commission (CR), my home. There might be areas that can be You may vote in the elections for local autarchy at the parish council (juntas de freguesia), improved, but by and large, I just really want bodies, as long as they are registered in the this corresponds to the address indicated to this place, the municipality of Tavira, to remain census of the national territory, all Portuguese where you are registered or at the Foreigners as I found it. I want to safeguard and protect citizens (and Brazilian citizens with citizen and Border Services (SEF). Make sure to bring what and where I fell in love with, and the card or ID card) and also citizens from the your ID and a bill (utility, internet etc) with your elements that drew me here in the first place. following countries are eligible to vote: name and address on it, as proof of address Ergo, political changes should very much • Member States of the European Union may be required by the parish. be a concern of mine and dare I suggest, to (Germany, Austria, Belgium, Bulgaria, Cyprus, Until When? all expats and foreign residents here in the Denmark, Slovakia, Slovenia, Spain, Estonia, Your registration must be done 90 days before Algarve. Finland, France, Greece, The Netherlands, the elections in October 2021 This coming October local elections will Hungary, Italy, Leetonia, Lithuania, More information: be held for the municipality of Tavira, it is Luxemburg, Malta, Poland, Check Republic, [email protected] important to all of us expats which political Romania and Sweden); party will come into power as change is • Brazil and Cape Verde www.eastalgarvemag.com 31

32 R. de Sant’Anna RESTAURANTS R.Borda d 1 Abstracto Beco de Santana 1 3 R. Alm. Candido dos Reis 6 R. Alm. Candido dos Reis 6 2 DAWAT Indian Restaurant R. Dr Antonio cabriana1 25 3 Ponto de Encontro R.Joao Vaz corte Real 4 Kohinoor Indian Tandoori R. PRo.eJtoaseEmJoilaiaqnuoimdaJaCraosta 4 Restaurant 5 Mar Azul e Agua da Asseca 4 6 Restaurant Franganario 7 Restaurant Bruncheria Bus R. Jacques Pessoa 3 R. Silva Domingues Station REAL ESTATE 1 Land and Houses R. dos Pelames 4 2 LWL 3 Fastighetsbyrån R. Gonçalo Velho Roman Pingo 4 Proluna Bridge Doce 5 Algar Vila Calçada de Donna Anna Traves HEALTH & BEAUTY Calçada da Galeria 1 Elle sa da Fonte Praça da Republicac R. dos Cais R. Eduarda Lapa 2 Rui Barros lia Rodrigues 3 Thai Massage Expert t R. 4 Buaka O Tavira 5 For your Brows only 7 Dr. Jose Pires Padinha MaOrkldet 6 Serenidade Estética e Saúde 7 Ayurvedic massage R. Ama 2 SERVICES Tavira R. da Liberdade R. Dom Travessa Dr. Parreira 2 R. Dr. Jose Beach 1 A.F.M. Accountants Castle R. Ferry 2 Ibex Insurance R. Dom Paio Peres Correia M5arcelino Franco 7 R. Palmeira DPirr.ePsarPr5aedirianha 1 3 Rui Horta Lawyer 4 Maria Luisa Cabeçudo Carlos Palma R. Monialvao 5 Solicitor 4 5 Casa Serviço 3 PLACES TO VISIT R. Dr. Augusto 2 R. Primeiro RR..4dasdeSaliOnuatsubroR. Silva 1 Kozii store Av. Dom Manual 1 2 Kozii store 6 R. Dr Silvestre Falcão 4 2 de Maio R. Primeiro de Maio 3 Artesis Galeria Vila Gale 4 Tavira d'artes To Tavira train 1 5 Oliveira station and Lidl Hotel 6 A Venda da Maria www.eastalgarvemag.com 1 Elle Salon R. João 5 2 Ruy Barros R. das Freiras BARS & CAFES 3 Thai Massage Arias 1 La Baguette 1 La Baguette 2 Somewhere Else 3 Artesis Galleria (Daves Bar) c Tavira Câmara t Tourist Information TAVIRA

AbstractoRestaurante Tel: Chuttcha +351 924 289 594 • Foot Massage (Reflexology) Traditional Portuguese Cuisine Vorakorn +351 925 431 636 • Oil Massage • Traditional Thai Massage Facebook: Thai Massage Expert • Therapeutic Massage for Pain Relief • Sport Massage (Deep Tissue) Av Dr. Mateus Teixeira de Azevado TAVIRA, 8800-379 Loja No 24 From the station walk down to center Rua Dr. Antonio Cabrera, 34 Thai Massage, Olhão 8800-344, tavira Tel 937 037 712 A typical Thai space, where you can find peace to enjoy different types of [email protected] massages and personal care. Gardens Square Roman Rio Bridge Avenida da Republica, 105, loja 12, 8700-308 Olhão Gilao Tel: 915 509 781 Restaurante See Dok Mai on Facebook Abstracto Specialized in Property Management and Bishops Holiday Lettings in the Eastern Algarve. Square Our office is in Tavira, where we have been Restaurant.Abstracto.Tavira based since 1989. Rua Almirante Cândido dos Reis, 142 8800-318 Tavira www.casaservico.com Office hours: Monday to Friday – 09:00 until 13:00 Land line: 00 351 281 321 764 Mobile: 00 351 96 26 19 022 SSSooommmDDD AAAeeeVVVwwwEEEhhh’’’ eeeSSSrrreeeBBB AAAEEERRRlllssseee La Baguette FRENCH BAKERY IN TAVIRA Fresh bread, croissants & pastries made daily using French flours on site! Teas, coffee, chocolate and fresh orange. See Facebook for details: 'La Baguette Française De Tavira' Located close to the castle, 20 rua Dos Mouros Tavira T: 281 403 070 E: [email protected] www.eastalgarvemag.com 33

The Reality of Living with Covid-Part II The real life and ongoing experience of our dear friends Terje and Denise Dahl. Our thoughts and prayers remain with you both Thank you to everyone who took with the intention of doing something sit with the patients as much as they would the time to read my article The positive with them after he recovered. But like, to reassure and comfort them - an Reality of Living with Covid in did he write his notes in English, so I could important part of the healing process. She the December edition of East better understand should he not survive told me when she gets back to her room, Algarve Magazine. Sadly, as and therefore I can take action on his behalf exhausted after a very long shift, she feels predicted, Terje died on December 8th at to hopefully reduce the suffering of other angry that she hasn’t had the time to do the 17:40 having never regained consciousness patients in the future? real role of a nurse, they barely have the from the induced coma, a necessity when The notes are scrambled and sometimes time to make sure the technicalities of the being treated by an invasive ventilator, repetitive. Yet, his frustration and fear job are completed. A doctor told me there on 24th November. Never in my worst comes through very clearly. He writes about is only one physician, this same physician nightmares did I ever imagine losing my wanting to be seen as a person, not an is on duty to cover 12 patients on Covid soulmate, my best friend so early and the illness. As a psychotherapist and educator, ICU every 24 hours. Nurses don’t stay on consequences of being widowed. We had he was observant and perhaps more aware the same ward or unit for the full shift. They another 10, 15, or perhaps even 20 years of how patients should be treated. rotate across different areas every couple together. These are some extracts from his notes: of hours to where they are most needed. Terje had been looking forward to his ● Not trying to tell you how to run a hospital Where is the continuity of care? Doctors birthday on 30th November which would or ICU and nurses don’t get to see their families or mark his retirement from the Police ● Thoughts from a Covid patient loved ones as they live at the hospital 24/7 Academy in Oslo. We both looked forward I’m not always awake and you threw away to reduce the risk of spreading the virus. to the coming years in Tavira, without him my last notes I don’t want to repeat how difficult it is to having to commute back to his work in ● Awareness – are you ok? How are you get information or the infrequency of being Norway every few weeks. Tavira is the city feeling? Are you tired now? contacted as a loved one of a seriously ill we have called home for almost 5 years. All ● Staff too distracted/easy to forget. Then I family member. I was promised Terje would our dreams and plans together are gone - need to nag if I need water or my sleeping never be put on a ventilator without them vanished. This is the real reality of Covid-19. pill – very tiresome and frustrating when in a contacting me first. This never happened. If In my opinion, the medical staff at Faro vulnerable situation someone had called me and held a phone hospital gave Terje dedicated medical ● Unnecessary nagging for them AND for to his ear, I could have spent even just 60 care and did everything in their power me/patients seconds to reassure him and tell him how to save him. Unfortunately, they are so ● Doctors – make time for me – tell me my much I loved him – this, with the benefit of very short staffed, they have very little situation hindsight, would have been the last time I’d time to communicate with the patients ● PATIENT, PATIENT, PATIENT first speak to him. as individuals. On 21st December I found See them always– be there– make their day A senior doctor friend at a private hospital the courage to unpack Terje’s personal ● The nurse’s job is to make the patient in the Algarve told me that this is only the possessions returned to me by the hospital. believe, inspire them, motivate, give hope tip of the iceberg. Elective surgeries and Inside I found some heartbreaking notes ● Say ‘hi’, a thumbs up – takes 15 seconds outpatient clinics are being cancelled so written by him on paper towels and but means EVERYTHING all resources can focus on the Covid crisis. marked ‘DO NOT THROW’ in Portuguese ● 2 hours and more than 10 people passed This is not just a problem in Portugal, it is a and English. Miraculously, they were not not seeing me – do I need anything? global problem. discarded. Terje was always making notes ● See the individual - we are all different. So what do I do now? The wonderful about situations that concerned him, funny BUT everyone needs to be seen Portuguese people have a culture of stories, or ideas for a book he hoped to When I was lucky enough to see Terje never challenging or complaining directly write one day. Interestingly they were written through the window the day before he was to authorities or people who can make a in English and not Norwegian, his native ventilated, I had a conversation in the car difference. I am a foreigner with a fighting language. He obviously wrote these notes park with one of his nurses. They are so spirit and I intend to tell our story through as a reminder to himself of his experiences very frustrated by not having the time to the media, in the hope that someone in the 34 www.eastalgarvemag.com

OuPtdeoporles Portuguese government, at the very over 1000 families from Vila Real de Santo would you like to donate them? least, hears the reality of living with Antônio, to Tavira, to São Brás de Alportel You can drop off food and essential Covid – be it directly or indirectly in and a lot of places in between. We may not items at Pedras da Rainha reception some economically related way – be in lockdown now, but we can all see the in Cabanas anytime; on Wednesday and then takes action to improve the restaurants, hotels and bars are suffering, mornings between 10:00 and 12:00 support. many are closing down and staff are being at EAFIN headquarters in Tavira (the If hospitals recruited family liaison laid off. This has a ripple effect on suppliers old music school behind the Black persons who could spend time too. Realistically, these establishments Anchor and opposite the bike hire talking to the patients and their family were only vibrant from the start of July to shop); Tavira 2nd Chance shop on members, it would relieve the medical mid-September. It’s a very rough winter, and Mondays, Wednesdays, and Fridays professionals to totally focus on the for many, it was a non-existent Christmas. (Rua Dr. Parriera 29A, Tavira) and technical care. Why don’t hospitals We fully anticipate the situation worsening as always the Black Anchor pub in in Portugal, as they do in other between now and Easter and possibly Tavira during opening hours. countries, appeal to retired medical beyond. Are you aware that without an Monetary donations can be staff to come in as volunteers to employment contract for the previous made by PayPal via contact@ increase the number of employees? eighteen months there are no government pinkflamingocroquet.com (Reference We are in a state of crisis. benefits and many employees work as daily EAFIN) or by bank transfer to our What about the lack of support hires for cash? dedicated EAFIN account in the name from local councils to ensure the EAFIN was started again in November by of Denise Dahl IBAN PT50 0033 0000 Portuguese people are being fed and a close friend, leading it in my absence 4549 2035 1420 5 Every euro donated housed in these terrible economic whilst Terje was sick, even though we have goes directly to purchasing food and times, especially those who are low funds and few supplies. In the past essential supplies. No expenses are impacted by a lack of tourists? month, we have delivered to approximately paid to volunteers or administration. For those of you who still believe 150 families which included 102 adults To date, donations in memory of Terje Coronavirus is just a bad flu it isn’t! and 68 children in the week leading up to at his church service on December Deaths recorded worldwide today, Christmas. 17th in Tavira, bank donations, and since the start of the disease, are at 1.8 We desperately need your help, so we, via PayPal have raised €2600. million. That is 1.8 million families who have in turn, can help those in need. We need a story to tell. When you lose a loved one, volunteers (drivers and packers), but of CHRISTMAS IN A BOX after almost six weeks of suffering, without course, we desperately Terje was inspired to help local children being able to hold their hand, without being need non-perishable foods from struggling families to have something able to visit them or say goodbye, when you and essential items, or to open this Christmas. Thank you to can do nothing and you are powerless, the monetary donations. Pasta, everyone who donated toys and candy realisation of how horrendous this virus truly rice, flour, sugar, olive oil, which were labelled from Santa and his is, will hit you. PLEASE obey the rules. Wear stock cubes, cornflakes, elf Terje. This was a tribute to such the your masks without complaining, keep your tins of beans; tuna; fantastic man I have been so lucky to be social distance, and wake up to the reality. sardines, frankfurters, and with for the past twenty years. Our EAFIN And although we have no quarantine or tinned tomatoes. Also hand volunteers delivered to over 70 children testing rules in Portugal for those coming soap, toothpaste, baby aged between 6 months and 16 years a few in from overseas, I believe those travellers diapers, washing powder, days before Christmas. should take personal responsibility to self- and cleaning detergents. Thank you to all the EAFIN volunteers and isolate or at the very least make sure they Meats, eggs, cheeses, everyone continuing to support us with wear their masks and social distance for bread, and vegetables we food and monetary donations helping local two weeks (symptoms can appear between purchase on a daily basis families to struggle less. 2 - 14 days). We also have to start being from our funds. Do you I will end this article with a lesson learnt accountable and telling the travellers they have too much fruit and from Terje and from this experience. should do this if we see they are ignoring vegetables in your garden, Don’t sweat the small stuff (don’t let small the advice. arguments or differences bother you), don’t For those of you still playing sports such as be so judgmental of others - none of us paddle tennis, golf, walking football, etc. know what history we all have and be more is it worth the risk without masks or social forgiving and tolerant. Tomorrow is not distancing yourselves? guaranteed... Some of you may be aware that Terje and I Remember to stay safe, to protect yourself own the Pink Flamingo Croquet and Social and others. Club at Pedras da Rainha in Cabanas. On Sunday 27th December we laid a stone at Denise Dahl our primary lawn in Terje’s memory. Due to the rising numbers of those infected by Covid in the Tavira municipality, we are currently closed but will open again when the risk lowers with, as before, masks and social distancing. As a non-profit association we have held fundraising events for the Bombeiros, and more recently, East Algarve Families in Need (EAFIN). In March we identified there was very little support for local families who were suffering economically due to Coronavirus damaging tourism and local businesses. We started the EAFIN initiative with monetary and food donations, together with the excellent help from some marvellous volunteers, we were able to feed www.eastalgarvemag.com 35

EAxpskatBAD ADVICE... the Not all advice is good and not all people are as genuine as you may think. Enjoy our 'bad advice' column from the expert we've all met, know and love... the Expat. Today in Our Bad Advice, we items, be it glass, unmatching crockery, or Furstenberg. If they demand repairs, claim it are joined by a panel of two scuff marks. was they who caused the damage. prominent local individuals We have demanded more money, but they Evi: We would love to meet you as a fellow determined to provide you, are refusing to give us any - like the thieving Elite. Breathe in, as we know the difficulties our local East Algarve Expats, vermin they are. of letting property to inconveniences who with a helping hand of inconsistent but Other than writing pitiful messages on Expat should not have been born, let alone have broad bottomed and heartfelt advice. Facebook pages about our plight, how rights, not to mention stain your atmosphere can we deal with these appalling \"rogue and furniture... Today we are joined by Sabrina and Evi tenants”? of the Elite Algarve Landlord Alliance who A mix of cafeteria, bakery and are seeking to empower the interests of Sabrina: Quite right, there is nothing more pastelaria, where the concept landlords in the Algarve. appalling than the interference of the state is to join different styles and “I am writing to you because I need urgent in property owners business, which is why eating habits in the same space. advice about my tenants. I am appalled that at the Elite Algarve Landlord’s Association they have given us three months' notice we offer illicit advice and tactics of Specialsing in Paleo foods because they learnt we were overcharging manipulation, deception, and intimidation, them and they dared to criticise us for being though without any legal duress and Address: Rua da Liberdade n26, Tavira unresponsive as landlords. disclaimers of legal non-accuracy. Facebook: 'À da Marta' They complained of winter mould and There is nothing worse than an ungrateful dampness. We told them, if they didn’t tenant who seeks out information about Telephone: 00351 962 480 768 breathe, there would not be any, they how to support themselves. As Elite people, Email: [email protected] can hold their breath! Regarding a leaky we have regular quarterly meetings at the lavatory, we also told them we have no duty Opulence Golf Club and Resort to extend Open: Everyday 8am till 7pm to repair it and that this expectation is to be our networks and protection rackets. Saturday 9am till 3pm, Closed Sunday met by tenants, especially overweight ones We have great associations, with roughies who crack the plumbing with their abhorrent for hire, who are indispensable at collecting waste. debts that are not owed or hiring individuals With five months left, we have demanded posing as Portuguese law enforcement. Of they pay the entire year and shockingly course, this is all off the record, but if you these lots refused. join our association, people will know you We are sitting in one of our other houses mean business! in Bordeaux and are disgusted at their intention to quit. They shouldn’t be allowed Evi: It also seems you were somewhat to as we are off to an Antiques Auction naive in your approach. Might I suggest today, which this Algarvian house was due creating false picture property adverts and to fund as a spoke in our multinational demanding a full year's rent upfront, if you empire. remain outside of the country? We have threatened them with international Portuguese and European rights are very solicitors, who we haven’t actually spoken pedantic, but let’s face it, there are always to yet, but they have thrown back the law loopholes to find and ways to maximise your of Portugal at us! We are horrified that as profits with minimal efforts on your part. tax exiles and property owners, we are expected to fulfil any duties to gain profits. Sabrina: Yes Evi, it seems inventories are a We are refusing to return any deposits, so useful way of extorting more money. If you they are refusing to pay any rent. We also discover the tenant hasn’t taken a dated gave a detailed inventory of each item in video of the house, always claim more the flat, and warned that there will be a damage. If you offer basic amenities such minimum of 100 Euro fines for any broken as Ikea plates, always claim that they were 36 www.eastalgarvemag.com

Health Sara de Melo Castanheira is an expert in Occupational Therapy and Quality of Life. She is also the Technical Director of SER Igual, an Association of special rehabilitation services in Tavira My new year's resolution: more empathy ANew Year's resolution is a tradition found all around the world. It is the between two types of empathy: Affective a marked difference between feelings and decision to do or not do something empathy - sensations and feelings gotten emotions. to accomplish a personal goal or in response to others emotions; including Feelings are both emotional experiences and break a habit. It comes at a time mirroring what that person is feeling. Cognitive physical sensations. Feelings are a conscious when people look back at the past year and empathy - the ability to identify and understand experience. According to Psychology Today, make an effort to improve themselves as the other people’s emotions (sometimes called an emotion “can only ever be felt…through New Year begins. “perspective taking”). the emotional experiences it gives rise to, One of my resolutions for this New Year is to The neuroscience of empathy even though it might be discovered through spread the word EMPATHY and its meaning, Empathy has been associated with two different its associated thoughts, beliefs, desires, and so we can be better persons, and build a pathways in the brain, scientists have speculated actions.” community. that some aspects of empathy can be traced to A fundamental difference between feelings Empathy is the ability to recognise, understand, mirror neurons, cells in the brain that fire when and emotions is that feelings are experienced and share the thoughts and feelings of we observe someone else performing an action consciously, while emotions manifest either another person, animal, or fictional character. in much the same way that they would fire if we consciously or subconsciously. Developing empathy is crucial for establishing performed that action ourselves. Research has So, to check if you, dear reader, are an empathic relationships and behaving compassionately. also uncovered evidence of a genetic basis to person, ask yourself the items below, see if there It enables pro-social or helping behaviors that empathy, though studies suggest that people is anything you can do to improve and become come from within, rather than being forced. can enhance (or restrict) their natural empathic a better person for your community and world: Empathy helps us cooperate with others, abilities. ● I always try to put myself in the other person’s build friendships, make moral decisions, and Having empathy doesn’t necessarily mean we’ll shoes when they’re describing how they feel – intervene when we see others being bullied. want to help someone in need, though it’s often whatever the situation. Humans begin to show signs of empathy in a vital first step toward compassionate action. ● I don’t believe – or tell people – that I “know infancy (starting at 18 months old) and the Empathy and Rapport, what's the difference exactly how they feel”. trait develops steadily through childhood and Rapport is defined as a close and harmonious ● I believe that it's important to listen to their adolescence. Most people are likely to feel relationship, understanding each other's perspective in order to get under the skin of the greater empathy for people like themselves and feelings or ideas and communicating well. issue. feel less empathy for those outside their family, A relationship characterised by agreement, ● I resist the temptation to mentally tick off a community, ethnicity, or race. mutual understanding, or empathy that makes “Yes, yes, I know exactly why this is happening Are empathy, sympathy, compassion communication possible or easier. and what to do about it”. synonyms? Empathy is the ability to understand and share ● I genuinely care about this person’s interests, Empathy, sympathy, and compassion are the feelings of another and Rapport is a close agenda and issues. often, incorrectly, used interchangeably. and harmonious relationship in which people ● I care about people. Sympathy is feeling concern for someone or groups understand each other's feelings or If you want to become more empathic and else, and a desire that they become happier. ideas and communicate well. supportive in 2021, you can assist one of our Empathy involves sharing a person’s emotions. What do we understand about feelings? And children and teenagers needing rehabilitation Sympathy is sharing the feelings of another… is there any difference between feelings and treatments in our Association. Many of whom understanding someone else's suffering. It's emotions? suffer from development delay, autism and rare more cognitive in nature and keeps a certain Feelings are mental experiences and are diseases. Their parents bear high costs with distance. Empathy is understanding feelings, conscious. If they were not, we could not have therapies, and a little help would help to ease but not necessarily sharing them, requiring knowledge of their existence. Feelings are the the monthly bills of these special families. an emotional component of really feeling and experience of some aspects of life state in an Please contact SER Igual: Tel: 918 100 020 or experiencing what the other person feels and organism. These experiences are a report about email [email protected] if you would like to thinks. Compassion is empathic understanding the life state in each moment in the interior of assist any child in their therapeutic process and of feelings accompanied with altruism, the the organism. come along to visit. desire to act on that person's behalf. The terms feeling and emotion are used as Thanks for sharing your time reading my Contemporary researchers often differentiate synonyms, but they are not interchangeable. thoughts for these New Year's resolution. Stay While they have similar elements, there is safe and stay tuned for my next month's article. www.eastalgarvemag.com 37

Health How your diet affects your blood sugar levels Ellen McCCallum from Naturopathic Nutrition Tavira explains how a balanced blood sugar helps a balanced mood, hormones, weight, energy and sleep The body is an incredible thing, with an innate capacity for self- Some of the most common symptoms of called ‘man boobs.’ In short, high sugar and healing. We can see this easily in dysregulated blood sugar include: or high levels of refined carbohydrates switch our immune system: if we catch • Belly fat and or man boobs on genes for sugar burning and fat storage. a cold or encounter a harmful • Fatigue Low fibre diets, especially if they are also of • Energy crashes poor nutrient status, result in irregular insulin pathogen, the immune system immediately • Waking up feeling sluggish balance, which in turn affects the adrenal glands starts a process of reactions to eliminate the • Finding it hard to concentrate and then other bodily systems. The minerals pathogen and creates memory cells which will • Feeling irritable – or ‘hangry’ (irritation and fibre present in unrefined foods are the enable the body to recognise that pathogen soothed by eating) nutrients we need to regulate blood sugar and more quickly the next time it is encountered. • Feeling on edge or moody in refined foods, these are stripped out. Many processes of self-healing go on all the • Headaches Alcohol consumption affects blood sugar as time without us having to do anything special or • Increased sweating the resources of the liver get diverted into to change things, but sometimes homeostasis • Craving sugar or carbohydrate rich foods clearing alcohol from the system instead of is altered to an extent that something needs • Hormonal problems managing blood sugar. Drinking on an empty to change, and this is definitely the case with What can tip the balance? stomach can lead to rapid symptoms of low dysregulated blood sugar. Carbohydrates and sugar cause insulin to blood sugar. Healthy blood sugar levels help to keep stress be released from the pancreas which in turn Exercise is incredibly positive for blood sugar hormones low, energy constant, sleep deep triggers the cells to take in glucose and amino regulation making the body more sensitive to and refreshing, and inflammation in check, acids from the blood. This is normal and insulin. which in turn reduces our risk of chronic necessary for the cells to produce energy and Stress causes the adrenal glands to release health issues like diabetes, heart disease, and carry out their physiological processes. glucose from various organs which can result auto-immune conditions. If we eat more carbohydrates than is needed in increased sugar in the bloodstream. If this Cries for help the excess glucose gets stored as glycogen is repeated too frequently, it becomes harder Fortunately, the body is rather good at letting in the liver and muscles. When the glycogen to gain blood sugar control. It is easy to think us know when things are out of balance and stores are full, the glucose can be converted of stress as an emotional problem, but stress the good news is that blood sugar imbalance into fatty acids and triglycerides. This excess can be caused by eating something that is possible to reverse, it does not lead to a life fat is then stored in the body often around the disagrees with us, toxins, illness, and difficult sentence of medication and ill-health. middle and in men, it can produce the so- situations. 38 www.eastalgarvemag.com

5 Top Tips for Blood Sugar Support Serenidade Whilst the processes underlying blood Estética e Saúde sugar management can seem complicated, stabilising blood sugar can be surprisingly • Podiatry/Chiropody simple. • Waxing, Facial 1Start the day well with a breakfast that treatments, Body Shape, includes some protein and healthy fats, Massage these will help to keep insulin levels balanced. This could be an omelette with some cooked • Manicures, Pedicures diced sweet potato and greens which are and Semi premanent folded into the eggs or some wholemeal toast gel polish with nut butter and fresh, lower carbohydrate fruit such as apples, pears, oranges, or berries. • Lasers, Radiofrequency, IPL and other energy 2Swap the processed carbohydrates and based devices sugary foods for complex carbohydrates, natures' natural blood sugar regulators. Good Praceta Eduardo Felix Franco, foods to include are beans and pulses, whole 10 Loja F, TAVIRA grains, and a wide variety of vegetables. 963 458 163 3Eat an organic rainbow – eating a wide range of colourful foods ensures that we get many phytonutrients, these support healthy blood sugar. Organic foods tend to have fewer toxins that must be processed by the liver thus diverting resources from blood sugar management. 4Exercise regularly, this positively affects muscle metabolism and helps regulate blood sugar. 5Reduce stress – this could mean avoiding certain situations, lowering intake of stimulants such as caffeine, or taking positive steps to include regular relaxing activities in your day. For updates on upcoming nutrition workshops visit Natural Nutrition Tavira on Facebook. www.thenaturopathicnutritionist.co.uk Carly Richards Free 30 mins massage when Personal Trainer & Fitness Instructor booking first block of 10 sessions Sports/Deep Tissue Massage available Tailored training programs. Training in your home or workplace. All equipment provided Free Consultation. Discounts on block bookings www.4fitnessandhealth.co.uk Diet Plans, Nutrition advice, Cardio, Boxing, Weights, Core building, Rehabilitation, Stretching and Flexibility Call Carly to book your free consultation 00351 926 671 132 Over 10 years experience www.eastalgarvemag.com 39

Gardens AlTmheond A tree of myths and legends 40 www.eastalgarvemag.com

Gardens A lmonds are members of the Rosaceae (rose) family, along the shores of the Mediterranean in northern Africa and along with many other tree fruits such as peaches, southern Europe by Egyptians, Greeks, and Romans. It was apples, pears, plums, cherries, and apricots. Within brought to California in the 1700s by Spanish Padres who settled the genus Prunus, almond is most closely related to the Mission at Santa Barbara. Around the turn of the century, the peach, and the two crops share the subgenus the industry started in California, due to development of superior Amygdalus. cultivars in the late 1800s. Tariffs on almond imports were levied to Almond and related species are native to the Mediterranean protect the industry. From then until about 1960, the industry grew climate region of the Middle East (Pakistan eastward to Syria and at a moderate pace, but acreage and production have increased Turkey). The almond and its close relative, the peach, probably several-fold since then, making California the clear world leader evolved from the same ancestral species in south-central Asia. in almond production. In 2002, there were over 500,000 acres of Almonds were domesticated at least by 3000 BC, and perhaps almonds in California, making it the most widely planted tree crop much earlier since wild almonds have been unearthed in Greek in the state. archeological sites dating to 8000 BC. The almond was spread Almonds are commonly mistake for a variety of nut, but the www.eastalgarvemag.com 41

Gardens almond is actually the seed of a fruit of an almond tree, which is part stages of growth. of the same family of the peach tree. The fruit of the almond even Almonds need to be grown in areas that receive full sunlight. Once looks like a peach, which eventually splits and releases the seed, the you've found a suitable spot, the tree should be planted in a hole almond. Following these guidelines will help you successfully grow an deep enough so that the roots are not bent or crowded together. almond tree of your own. Young almonds trees often struggle with heavy winds because they There are two types, bitter and sweet. Sweet almonds are cultivated grow rapidly when new, so it's strongly suggested that you brace as food; bitter almonds, which contain prussic acid, are grown mostly the tree. Simply place a shaft of wood or pipe in the ground next to for their rootstocks on which sweet almonds are grafted. Almonds are your tree and tie it to the brace. This gives the tree support against raised for ornamental and nutritional reasons. Like other nuts, almonds winds so it grows straight and sturdy. are high in vitamin B and protein. One cup of shelled almonds contains Once your almond tree is grown, it's a good habit to prune your 26 grams of protein, 77 grams of fat, 28 grams of carbohydrates, 332 tree to maintain it. Pruning simply involves cutting off dead or dying milligrams of calcium, and small amounts of vitamins B, and B2, iron, branches at the base of the trunk. You can also thin out any parts and niacin. of the tree that are beginning to look overcrowded. The best time The first consideration you need to make is your climate region. Almond to prune is in late winter before buds and new growth appears in trees need warm summers and cool winters, so we can grow almonds the tree. Following these guidelines should keep your almond trees happily here, but if your garden sees some frost, you probably won't fertile and hearty for years to come. be able to grow an almond tree outdoors. Similarly, if your region is hot The almond requires a sandy, well-drained soil, neutral or tending all year round, you will probably not be successful and it's best to pick slightly to the alkaline. Since good drainage is essential, plenty of a different type of tree to grow. Almond trees are native to the Middle humus should be present to hold moisture while permitting excess East, so any area around the same latitudinal region should grow fine. water to drain away. Having said this, almond trees can be grown with success indoors in The hole where the tree is going should be just large enough to receive these climates with proper planning and know how. the roots without bending or crowding them. If a soil auger is used, Secondly, almond trees are not self-pollinating. If you want your tree it should be 24-inches in diameter and the sides of the hole should to produce almonds, you have to have at least two trees of different be broken down to eliminate the auger's glazing effect. Compost varieties. Almond trees aren't especially tall, usually growing from 4 to or manure should never be placed at the bottom of the hole. It can 10 meters, so this isn't a major concern for growing outdoors, but this create problems may rule out growing trees inside because two are required to produce for the tree. almonds. Flowers bloom in the Spring, and in December pollen grains appear, and by January the buds grow very rapidly. This is the reason almond trees cannot grow in regions that have snow or frost, but they still need a cool winter to activate growth of the buds and pollen. The best time to plant almond trees is January to February, because the colder temperature stops leaf buds from appearing and keeps the growth focus on the roots which is extremely important in the early 42

LANDSCAPING & GARDEN CENTER BEM-VINDO • WELCOME QUINTA DAS PALMEIRAS CENTRO DE JARDINAGEM EN 125, c.p. 126-E 8800-118 To To Moncarapacho Luz de Luz de Tavira Olhão EN125 Tavira e-mail: [email protected] Fuseta To Tavira www.geojardim.com Tel: 281 961 189 Look out for the flags Find us on facebook at: Geojardim Landscaping & Garden Center The roots of the tree run deep. It is advisable to break up the Keeping your pets moving topsoil thoroughly and to as great a depth as possible before planting and then fertilize with plenty of organic matter.  Post operative and neurological rehabilitation Many commercial growers plant cover crops which are then turned  Improved quality of life under for green manure, protecting the ground and enriching the  Arthritis, hip dysplasia and other joint diseases soil. This practice should not be necessary on the small homestead  Wound repair and skin issues where only a few trees are planted.  Pain relief Compost should be worked in late in the autumn. Place straw mulch under the tree but not close to the trunk. A range of non invasive therapies helping your pet to return Almond trees begin to bear in three or four years and should be in to full health and mobility. For more information or to book a full production in 12 years. Nuts should be harvested when those consultation please get in touch. in the centre of the tree are ripe. Nuts which fall to the ground before the regular harvest time should be cleaned up daily to +351 910 719 526 prevent disease. [email protected] After harvesting, shell and dry the nuts. The kernels should be Www.caninecavalophysio.com spread for drying in a shady location until the meat is crisp. Kernels can be stored in airtight jars and kept in cool places. 43 According to this delightful story, during the time when Al Garb still belonged to the Moors, there reigned a young Caliph in Silves called Ibn-Almundim, who fell in love and married Gilda, the daughter of a great lord from the North, who had been defeated in battle by the Moorish king. Their love was mutual, and the marriage was celebrated in grand style. However, the beautiful princess grew sadder day by day, with the Caliph unable to make her smile. They consulted magicians and wise men from all over the world, but none could find a cure for her sadness… Until one day when an old Nordic man told the king that Gilda was longing for the white snow-covered fields of her homeland. Ibn-Almundim then ordered thousands of almond trees to be planted outside the windows of the palace, which, when they were in blossom, covered the land with white petals. The illusion took away her longing and she became joyful once more. And this is why, since that spring so long ago, the Algarve relives each year the magic of the almond blossom. www.eastalgarvemag.com

Expert financial advice Keep up to date with our Finance expert, chartered accountant Ricardo Chaves from All Finance Matters. Tax calendar: dates to put in your diary for 2021 We wish all readers a MARCH must be made by 31st of July. This is the healthy year of 2021, and If you became a resident in Portugal in 2020 deadline for the Tax Authorities to refund you. it is our desire that the and want to apply for the Non-Habitual AUGUST new year is much easier Residency scheme, you have until the end of If you have IRS tax to pay, you should make to everyone than the year March to submit your application at the tax the payment no later than the last day of we just said goodbye to. Below you can find portal. August, providing you have delivered the tax some of the dates that you need to put in your During March, you also need to check your return within the time limits. If the tax return diary, concerning taxes in Portugal. e-fatura page at the tax portal and if you feel the was submitted after the deadline, payment Please remember that before you submit your information is not correct, you can challenge may be made until 31st of December (fines IRS you need to perform some tasks as per the calculations made by the Tax Authorities. and interest will apply). the new habits acquired in the previous years: In other words, your tax deductions will The second instalment of the IMI council tax tasks like validating, or registering invoices at be summarised here, under family general is due this month. This is applicable for all the tax portal are now procedures that have expenses, healthcare expenses, training and those where the yearly IMI payment is higher become part of the routine of any taxpayer. education expenses, charges with property than 500€ per taxpayer. Your role is important in determining your IRS for permanent residence, invoices VAT and SEPTEMBER deductions, therefore check the tax calendar, costs with foster homes; if your total invoices If you have AIMI (additional council tax) to make sure you don’t lose any deduction or is not consistent with the one totals shown in to pay, this needs to be paid by the end of pay any fines. the portal, you have this two weeks window September. Remember that you are liable JANUARY to contest it. Please note that it’s necessary for AIMI payment on all properties owned If you have a business activity which was to check this for each taxpayer. by companies. Individual owners are only VAT exempt under article 53, but in 2020 you APRIL exempt from AIMI, in the first 600 thousand exceeded the VAT threshold, then you need You can submit your IRS tax declaration for Euros worth of property (based on the tax to change your VAT status until the 31st of 2020, from the 1st of April, until the end of value and not in the commercial value). January. Likewise, if you were paying VAT June. This means that all declarations can NOVEMBER but did not exceed the threshold in 2020 and be submitted during these three months, Payment of the third and last instalment of the wish to become exempt, the same deadline irrespective of your income category IMI council tax. This is applicable for all those applies. (employment income, pension income, self- where the yearly IMI payment is higher than If you have a rental contract and are not employment income, rentals, etc.) 100€ per taxpayer. obliged to issue monthly rental receipts, you Please note that all residents, include Non- RECURRING DATES have until the 31st of January to declare the Habitual Residents, need to submit a tax Please remember that if you have a business yearly rental income for 2020. declaration, even if they’re income is only activity, you need to report your sales file by FEBRUARY pensions, and tax exempt, they still have to the 10th of each month. This also includes Each taxpayer has until the 25th of February fulfil this obligation. rental income from AL license holders. to query, report and verify invoices. To do this All non-residents that have income from Each month you also need to issue your you should access the e-Factura portal and Portuguese source (ie property rentals, sale of monthly rental receipts in case you have a access your personal page, where you should a property, etc) also need to submit a yearly rental contract registered. verify if all your invoices have been properly declaration. The car tax needs to be paid by the last day communicated. If you find any failure, or any MAY of the month when the car was registered. invoice is not recorded, you can add these Payment of the first instalment of the IMI Please do not forget this as the fines are high invoices to your file. It is also important to council tax. If in your case, the council tax is in this case. check in which category your invoices are lower than 100€, this will be the only payment If you have a business activity, please recorded and move them into the appropriate date you need to remember. If it is higher, remember that each quarter you need to section (ie health, education, etc), otherwise please look for other instalment dates in submit a social security declaration. To the deduction will not be accepted. These August and November. ascertain how much social security you will procedures need to be performed for each JUNE pay each month in the following quarter. household expenditure holder, including Do not forget to submit the IRS for 2020 by If you have any questions, please feel free to dependants. the end of June. Please remember that if you contact us; tax planning is critical and you It is also important to update, or register your do not deliver your IRS on time, or if you fail to and your company cannot afford surprises. household for tax purposes, before 15/02. meet some of the deadlines above, you may Contact our office to discuss your personal Please note that this can be very important, lose some or all of your tax deductions. Late situation and avoid any unnecessary fines. not only for tax purposes, but also for other delivery of your IRS may also cancel your IMI related matters, such as inscription at (Council Tax) exemption. schools, kindergarten, etc and/or other tax JULY benefits you may be entitled to. If you have IRS tax to receive, the settlement 44 www.eastalgarvemag.com

Relax, we look after your tax a airs, while you enjoy your life. www.eastalgarvemag.com 45

Expert financial advice By Andy Oliver, CEO of Private Client Consultancy The Pensions Conundrum As another new year begins, new plans are set in place, revealed that 15% of women are likely to by pensions. The same Haldane that said and changes are made. And decrease their pension contributions over in March 2017 that \"Bad managers stand pensions, the topic of this the next five months, compared to 10% of accused of holding back economic growth article, have seen a few of their men, meaning the pandemic, apart from in the UK by undermining productivity, own changes over time also. Good and bad! everything else, may set us back some years preventing pay, and living standards rising. A little over a decade ago, women could and further widen the gender pensions gap. The question has to be, has anything been claim their state pension when they turned The research also found that men were more done to rectify this knowledge gap since? 60, and men at 65. With recent changes, the likely to take advantage of possible future Well… the government did finally get around qualifying age for both sexes fell in line with economic recovery by investing more into to the promised “pension dashboard” so one another, and almost four million women their pensions. That means, men seem to be people can monitor their pension pots. To born after March 1950 felt the impact of investing to increase value on their assets, make income drawdown less confusing and this as the government increased the state while women are becoming more cautious help people make well-informed decisions, pension age from 60 to 66. and holding on to what they have - pushed on the FCA also set out several proposals and Gender equality wasn’t supposed to be by uncertainty. recommendations recently. And the new rules financially painful for women. Yet that’s It would, however, be very unfortunate if will be coming into force from August 2020. how it has been described by all those who the equality debate were to overshadow But aside from the general importance of experienced the sharp rise in the female discussion of other, deeper-set problems with saving, it’s evident that through the years state pensionable age since 2010. Another UK pensions. Afterall, one of the reasons the very little, if anything, was done in the form of significant marker in 2010 was how the state pension gender equalisation debate mainstream education until the last decade, number of people (male and female) retiring even gets the attention it does is because it that’s why there should be a much broader after the age of 70 had doubled. is relatively easy to understand. Far bigger government-sponsored financial literacy drive Research conducted by the Institute for Fiscal injustices are lurking in the sphere of the to introduce people to the basics of compound Studies in 2017, found that the increase in the private, rather than state, pension. interest, inflation, portfolio diversification, pension age had placed notable pressure on The introduction of “auto-enrolment” of annuities, and the fundamental importance of the poverty rate of women in their early sixties. workers into “defined contribution” workplace keeping costs down. The 1940 Old Age and Widow’s Pensions schemes in 2012 was a good reform, using On further investigation, and a factor in the Act introduced the 60/65 disparity in favour people’s natural inertia to nudge them gently new proposals, was that the FCA discovered of women in an era of what was known as toward saving effectively – and the results that a third of people who didn’t receive entrenched gender discrimination. It was an were quite impressive with the proportion advice currently have their savings invested in era when women were expected to devote of employees covered shooting up from cash or cash-like assets – meaning they could themselves to the home raising children, while around half to three-quarters in 2018. This be losing out on significant returns. So, the men were seen as the main earner of a family. was because there was rampant ignorance knowledge gap is still there – and still sizeable The earlier pension age for females spilled over and confusion among the public about how even today. into an environment of extreme disadvantage the kind of pensions which they were being Clearly, it’s not just gender equality in the for women in the workplace, when they enrolled, actually functioned. state pension age that’s an issue here, tended to earn much less in comparison A 2018 survey targeting employers on the there’s a much broader gender equality in a to men and accumulated far fewer years of importance of educating their staff, found paralysing sense. And that is believing our national insurance contributions. that around a quarter of people, aged 55 and pensions are out of our control when they’re The past 70 years has however, seen a over, admitted that they didn’t know how their not! That’s why all of us – women and men dramatic change in the workplace structure pensions worked and never even checked alike – should seek the proper advice and get and with the working age employment rate their own pension pots. to work on finding out what we can do today gap closing. In a 2016 speech, labeled ‘the great divide,’ to invest and start producing healthy returns Recent analysis conducted by Aegon the Bank of England’s own chief economist, for the future. Andy Haldane, confessed to being baffled Our future! INVESTORS WANTED We are looking for serious investors interested in a 20% ROI. The project in the East Algarve is 90% complete! Invest anything from 10,000 euros upwards. Contact [email protected] for more information 46 www.eastalgarvemag.com

OOOnnneeeGGGooaoalal-l--OOO nnneeePPPuuurrprppoososesee ““II“aIamammeexextxtrretermemmeeleylylypprprooruoududdttootoaanannnnonouoununcnceceetthhteheef ofofrormmrmaatatioitoinonnoofofPfPrPrivirviavatateeteCClCileileinentntCtCoCononsnsuuslutltalatnancncycyy As weWWhWeeeaaeadlatlthlihnthtMoMMaaannanaonagtaghegeememrmeneneentwntataananndndddmemxmycyiyttitrnratagrnansynsietisatiioitroinofnonarafatfPtefCetrCer1rW1717e7sasulustcuhccceMcesesasfnufsauflgulyelyemyeaeearnarsstr,swwwwooerorkksriakninyigngggwowowitidthibhthye to an unforgdedetdetVaeVebVerleereer2eSS0pSp2ap0aian.iniA.n.n.d with the start of this new year, we are pleased to announce our newly formed pAasrwtneerhsehaipdwinittho​ Saignnoitah​ eW​ renaeltwh​ aasndouerxpcriteinfegrryeedairnfvoerstPmCeCnWt aedavlitsherM. anagement, we say goodbye to an unforgIenIntItnaaabaclcehcha2han0ang2ng0igni.nigAngngbdbubuwsusiinistnhienesteshseslalsalntanadndrstdscocsacfapaptehpe,ies,w,wnwietithwihthsyshehsaihfirtfi,tifniwtnigneggcacrlicleeileinpenltentaetesxeexpdxpepetcoectctaaattnatinoitooinonusnns, ,sci,eniniconcrucrereraeansaseiniswnignlgygformed SpiagrntniaerrWreserghegiuapgullutawlahltiatothothroar​ySsyriaygwannanodindarkdc​ W​ceocodmeomawmplptilthpilhai​laainuanscsncoetceuorerredeprqeeqruvequeifureilreoirermrpememndeeenienwntnvtsfset,u,sasna,tnamdndnsdedranrinstirsidanisndpignvgogicrscotecofsroos.tltsiost; ;stt;hththehearereter’ase’siam’sagatgrogroordwowewilniivnigengrgnnaeneceeodedmdparably betterfofpofreorrsrfsmomsrmamalalellnelrecrIerFI,FAIFAwsAsitsthootojlojojwionineinraacapoprpsrotorsfoefeafsesnsidoisoinloonanwalalenlrnenevtetowwtlawootriorklikrtkytth.htMahatatcytcafcanainrn,hhLeheoleplnpldptothhntehembemamsmemdmaan​SanaingagangegieaeaaWnandnedadlth is a pSirgivnaiaterWreeirdneedvuadueclutcsehtcemtehthehatenhsetbewbuobourfurfrdkidrceedednen.tnw.PhP.iartPrithvirviaiuvsatsateFettCCoeCAlCdileielerinveenetgntluCotClopaCotnonensendsuwuslautlftnaluatdnnancdnhcyscyaiayssinsibtsdthehtpaehaotnatrnttnsfeenoeteltwiwotuwosportorkthkor.ak.ItFIa.FaAIlFAliosmAswcsctaocatnhandenenolneoivwvoweewrfrofyaofdcoccauocuysmusisnpvaerastbolyr tapbhcreeictvetabesterseonsnotptneiononeenocnercvphetfhceehpoesheseesorltesmpalrmpsastlripaauanriyenmnynrignnpycgitpetegaytpa,tohpeathptfwxeoehfpeepiiricesreitrewreehiwrrcrewotcltoiliclsrrhoeoirkeeleawinkra,entk,itewlnntsw,grisstwhrmsahcoiaFhccoiwaaccChhisncchhAttiahhhsweiwgeivroawieivelneinnlvegigldeleuyglemgotlerlmahgoruemtpeerwreapeiaodrptieonatwromowtvaoweevunooeusortdneurttcltmearctthohythcoteeima.holemnimsTtemmetyhe.mb.stiesesMtoswoetewoeanwhxeyxhpexisfphlieaxepsliaisrtptlraitsn,eaunwtdnwLnpdweocdteenttheaohtdiaehtneoatiaerniPtmlrPlibCorPbbCauwCbCanuCsusaCsimtengismhndiimeeanneasnS​gesaeniasgnmvaasgneaagsoeairsgaeyntsthedethWtthaeyhhteyeyehegeyaiieyvnltevhsesyistoouar accessssteoeseetefhiftieft.i.ts.ame expertise in managing their money. This experience in managing money gives you Wtheithbetshtisopaprotrnteurnsihtyipt,owseeenredaelagvroouwrtthoosnhyaoreuroiunrvecostmmbeinte.d knowledge to assist and help our clients to betterPuPCnPCCdCCeCirsissitsaaanaBdB2B2tBh2BeBsiseresrcervirvricvciuceicemepsptrparoornvovcivdeidisedeirnerfrtofeofrorrmIrFIFsAIFAosAsf stfthinhtahaatnatcttaiaatklakewkeseessacclatcarhare.ereoofofcfcucususttsootmommeererrreerlealaltatioitoinonsnshhsihpipip With tmhmimsaanpanaanargatgengeememrmseheneinptnt, ,twp,perprooerdondudduceuctactsvst,o,sa,uanrandtndodssehesraervrvreivcicoeiceusesrstcthohtrmhroorubouignugheghdhakalnaliloalilawinanclnececdesegseswwtwiotithiahtshsmimsmtaajaaojnojrodrrfhifenifnliapnanaoncnuciacriailcallilents to PbeCtCte​WriuneinniasnsdtlttsiehtitturiustMttutiaoitaoninnodnsans,tg,hsce,ceomcoirmoemcnmpirptlcpiluiaislaminanacsncetBcea,2en,mB,cmemasasrearkirnkrevkeittceetienitrnimgnpg,rsg,oao,avnafniddnfdiendprapupnfuobcubrilabilcIillFciwAcrreeserlaealtlahlttatihaoit.otinontsnas.k.sTe.ThsThihsicsaiissriseitsthohtefhecenunensettetwowtmwooerorkrkrrkfeofoflraortrionship managtethhmtohoesosneeste,IFIFpAIFArsoAsdsaaunancdtndsd,bbarbronordkokekesreerssrrvswwicwhehoshoothhhahravoaveuvegebhbebeaceclolcoimaomnmeceeedsdidswiseiiesntenhfnrframfarnaancnjcohchrihsisfeiiesndedadnwwcwiitaithlihtihntthshttehietieruiritnrinoennetestw,wtwocoororkmkrkpliance, mPCaCrk​Weptepinrparogolrtv,ovhaivdindMiedderaeprnoruoarborgltriethcmhtorhoeesolsenaesttewiowiswnhhsaoh.ooBss2imisBmimpspelpylrylvywiwcwaeananptnrtottovotiodsseeesrtetfutoupurppIbFbyAbysytthththeheamemt mstseaesklevlevelsvesescbsabrubeututoatfarareceruessstttsrorutmurgugegggrlgilrnielniglngagtionship managwewmwititheihtnhltilc,ilceipcenernosnsedesuercreetrgseg,ugulaualnaltadtootrosryeyrdyrdvediecmemmsaantanhdndrsdos.u.sA.gAlAhllsllasttsallatikaakenkehceheohoslodldwledeirtershsrcscmacananjnbobrebenfeniennefaeiftnifticftrfiarofolrmominmstthhittehueentnieonentetwswt,woocrorkkmr:k:p: liance, mFoarrkmeomtmirnemogori,onreaerfnoeccdrlimcleipleinauentbtnitsolsitncasa,rnanevdnlidasdisttsimomsunmsasala.aleltlelrwerIrwFIFAIwFAsA.spgscgecgetwettethahtelhtehep.pcrprooormtoteetcaectnctioditoinobnonooofokfbfbaebeimeniniegngegbtbinabagcackuckeskedienddgbbyobyuydrded​‘eVceVoeVenreretear,e,ca,tasasuss’ page. Or emPaPiClPCCuCCsCwawwtililinilullfuosuse@esedpdecdecVeVweVereereaerleStShpSp.acpaoianimni’sn’.s’lAsilcinlceidcenendsnsoeesnea’atnanfdondrdwgwewilitliltilonlinilntietiitaitailualyslly,lky,on,opoopewpererayarotateueteaaacracercroaorsosrseEsaEudEureurororpoopefpe.t”e.h”.”e East Algarve FMoargmazoinree.information, visit us at www.pccwealth.com and book a meeting using our ​‘contact us’ page. OM“FraroegmmazCaiACniElCleElOu.EOasOtaaaPntanCdindnCdFf,oFoWFo@uouenpunWcdndcedwiesre,hre,Ara,YAlnAtonhdund.ycdayoOyPmOlrOi.loviAlvseivpnereedrrrdoouns’Yt efoarrg”et to let us know you are a reader of the East Algarve “From All at PCC, We Wish You a Prosperous Year” Whatever your needs, we will work with you to find a solution Whatever your needs, we will work with you Private Client Consultancy is a trading name of Oliver taondfiWndhyatesSoLl,uatnioapnpointed representative of deVere Spain, regulated by the DGS FP number J2807 which has PI insurance with AIG and sufficient financial capacity according to the law    Private Client Consultancy is a trading name of Oliver and Whyte SL, an appointed representative of deVere Spain, regulated by the DGS FP number J2807 which has PI insurance with AIG and sufficient financial capacity according to the law    www.eastalgarvemag.com 47

Places SWEET Maureen LoBue visits Pastelaria Jardim, the most Portuguese Pastelaria in the Algarve! SENSATION You can find pastry shops on almost every corner. But where they say to friends. I chatted with a couple want to do it better, improve always, do better can you find a truly Portuguese who comes here every Sunday after walking today than yesterday, better tomorrow than pastry shop? Where does the through the forest with their dog. When I asked today. It's important to look back over the irresistible sweet aroma of freshly why they come to this same place every week past and ask what have I done to improve baked traditional almond cakes and pastel their response was, “They have the best and business, life, and for the people around me?” de natas draw you in as you walk past the freshest cakes anywhere, the best coffee, and How does he do that? By focusing on his door? Where can you feel a warm, genuine they even provide water for our dog.” clients, some of whom have been coming to Portuguese welcome when you succumb to Curious about what makes Jardim stand out the shop for years, and by helping to create a the aroma and walk in? Where can you stand amongst all the other pastelarias in the area, I destination. in front of a gigantic colorful display case of sat down with the owner Emanuel Alexandre I'm not the Owner. I just have the key. The special recipes and handmade delicacies over a smooth coffee and of course a piece clients own it! carried on from generations of local pastry of almond cake. Before even speaking, his So, is this a cooperative? No, it is Emanuel's chefs, to face the most difficult decision of pride in the business was clear. “We are real shop but without the clients, it is only walls your day, “Which one do I choose?” Portuguese. We have kept our origin in each and windows. “The most important is the “We are real Portuguese” dish and in each cake.” connection with the client. The way you talk I found it... in Monte Gordo. Pastelaria Jardim The pastries are amazing. But it's more than with the client, the way you ask exactly what is so special that the customers refer to it as that. Emanuel has been working hard since they want and give it to them in that way every 'my garden'. “Come meet me at my garden” the age of 16. Over the years he has formed time.” the philosophy to always do your best. “I That's the Portuguese welcome, the 48 www.eastalgarvemag.com

RESTAURANTE FRANGANARIO Tavira www.eastalgarvemag.com TRADITIONAL PORTUGUESE CUISINE Travessa Almirante Candido dos Reis 139, Tavira 8800-318 Telephone: +351 963 882 952 Facebook: Franganario Tavira Galeria Contemporary Art Gallery Affordable Art Open 10am-1pm Sat & Sun 3pm-6pm Thurs & Friday Contact +351 918 973 438 Email: [email protected] Facebook: Artesis Galeria 15 Travessa Zacharias Guerreiro, Tavira 49

connection that says I remember you and I now and then. looking for traditional Portuguese pastries value you. I came into the shop one day and It's all about the destination! and excellent coffee, served by people who chose a pastry to go. The next time I came in, It took me a minute to understand this part will make you feel welcome, come meet me the server asked if I had enjoyed it and would of Emanuel's philosophy. But once I got it, in my garden! I like the same one again. That made me feel I realised this is a major factor in Jardim's A taste of home for those that are away like part of their family. success. People are comfortable when they from home! The other important person who has the key feel a connection to an area. It makes them Emanuel goes above and beyond for his to the success of Jardim is the talented pastry want to return again and again. In Emanuel's foreign customers by offering them a special chef, Hugo Reis. His pride in his vocation is words, “This is an institution that is much more service. He is more than willing to re-create as strong as that of Emanuel, shown in the than me. Our shop improves the destination the flavours his customers long for and miss way he stood tall while holding out one of his for everyone, all our neighbours.” from their home countries. Feel free to come specialty cakes, made from the traditional Businesses in the area work together to in for a chat any time. recipe. Hugo grew up in Portugal, trained as support each other. “It's all about the a chef, then went to Spain to work. But he destination, not the business, so we all need Pastelaria Jardim is back for the past 2 years making these to do our best. We support each other in the R. Diogo Cão 28, 8900-440 Monte Gordo wonderful creations. According to Emanuel, businesses to improve the destination.” Tel. 919 025 496 “He is one of the 5 best pastry chefs in Now that I've found this wonderful pastelaria, Facebook: Pastelaria Jardim Monte Gordo Portugal, in my opinion.” I'm going to follow Emanuel's philosophy Open 8am to 8pm Even the staff can't resist sneaking a treat and share it with my neighbours. If you're 50 www.eastalgarvemag.com