Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore video-magazine-1987-04

video-magazine-1987-04

Published by Alex Chernyak, 2023-03-25 08:19:39

Description: video-magazine-1987-04

Search

Read the Text Version

an unappetizing patina of organic “rust.” Laser rot To Live and Let Die in L.A., Yojimbo, and Leave it too long, and the apple rots. This slowly turns Saboteur. Lawrence Mintz of Silver is essentially what happens inside a con- a disc’s picture Spring, Md. found his copy of The Parent taminated videodisc. One of Pioneer’s pro- into a blizzard Trap suffered from laser rot. Unable to find blems, once it became aware of laser rot of colored snow. areplacement disc, he settled for a refund. was it had no way to determine the condi- tion of discs that were already in ware- Kirk Leonhardt opened the Laser’s houses and on dealers’ shelves—or what Edge store in Canoga Park., Calif. last their condition might be six months, a year, spring. Like many other dealers, or even two years after pressing. Culling Leonhardt was a fan of the laser system the duds was a major undertaking. before he decided to make a business of it. He had heard of laser rot. When he went Are other factors involving materials or through his personal collection of more workmanship contributing to laser rot? Pi- than 1000 discs, he turned up more than 50 oneer U.S.A. buys all the raw materials bad titles. Pioneer replaced them all, and needed for disc production from American Leonhardt, like Ken Kai, believes the suppliers, and the Japanese plant in Kofu problem has been solved. “Potential cus- buys its raw materials from Japanese ven- tomers should be aware of it,” says dors. But since both branches of the firm Leonhardt. “But it’s not a reason to avoid have made problem discs, the causes can’t the laser format. Laser video is definitely be attributed solely to raw materials. “It’s the future of home video. It’s going to re- not only the materials,” Kai admits. “It’s place tape. It’s just got some bugs that the procedure [used to make the discs], have to be worked out.” and the procedure was the same. There WHAT DEALERS SAY was a certain thing there even we cannot really explain.” There are about 1600 authorized But Kai stresses that Pioneer is commit- Not even Indiana Jones can fight off las- videodisc dealers across the country; ted to improving manufacturing tech- er rot: Video snow made our discs of many are mail order houses. Despite the niques, especially since laserphiles are fas- ‘Raiders of the Lost Ark’ (with Harrison problems, sales of both disc players and tidious collectors. “Our customer is amore Ford and Karen Allen) and ‘My Fair discs are on the rise. In the two months strict buy-to-own type,” he says. “A Lady’ (with Audrey Hepburn and Rex prior to our interview, Kai reported that LaserDisc customer is a lot more quality Harrison) unwatchable. Pioneer had its best sales ever, with disc conscious. The smallest thing bothers production up significantly at the Carson him.” Calif. plant. Pioneer produces 160,000 videodiscs per month, representing about As a result, videodisc collecters often 40 different titles a month. Kai says the go through lengthy searches, entailing chances of getting a bad disc now are ex- many trips to video shops, to find keepable tremely slim. copies of given titles. Take Donovan Scott, an actor who appeared in Sheena. He buys Dennis Webb, who operates Verne’s discs from Budget Video in Hollywood, Magnavox LaserDisc City in Westminster, Calif., and went through seven copies of Calif., one of the largest videodisc stores Sheena before finding one worth keeping. on the West Coast, agrees with Kai's as- Bob Stephens of San Francisco reports he sessment. While he acknowledged the has gone through two to five copies each of problem of “laser disc oxidation’”—the April 1987 Video 51

eLaser Rot e term he prefers to “rot’”—he feels it’s a the demand. When a blockbuster title is Bad”). One large video chain, according to phenomenon of the past. “It’s been taken announced, he noted, the company has to Ken Kai, was renting videodiscs repeated- care of as far as I’m concerned,” he said. rush to fill the order, often with a decline in ly, then rewrapping them to return to Pio- He hasn’t had a disc returned for laser rot production quality. “That’s when the mis- neer as “defective” when they became in more than a year, and says the prob- takes start cropping up,” he says. He con- heavily scratched or worn. Like many oth- lem never adversely affected business. cedes, however, that in the three and a half er software companies, Pioneer now years he’s been in business, Pioneer’s places special stickers on its discs so that Webb’s policy on defective discs is sim- overall quality control has improved tre- consumers know they’re getting facto- ple: if you bought it from him, he'll ex- mendously. ry-fresh products, not ones that have been change it for another, extend credit, or, if shrink-wrapped in the back room of a video the title is unavailable, refund the cost. But A few consumers and dealers have taken he won't exchange bad discs bought from advantage of Pioneer’s liberal exchange store. another dealer, especially mail order hous- policy (see “What to Do if your Disc Goes Laser rot is still something of a conun- es, for a reason that appears to shed more light on disc deterioration. “Heat and las- drum. Officially, it has been resolved, even ers don’t mix,” Webb says, citing the risks though Pioneer has never issued a formal of shipping discs across the country by mail explanation of what happened. or United Parcel Service. “Most of the time, they go second or third class, and you Kai and most of his dealers are looking to have no way of telling how they’ve been the future. Pioneer has already re-pressed stored along the way.” In other words, if a the bad titles found in its own inventory, disc has sat in an unusually warm ware- which laserphiles should take as an act of house, its chances of going bad are much good faith. “Despite all the things that peo- ple talk about, I’m going to make sure Pio- greater. neer is a name they can trust,” declares But Dave Lukas, owner of Dave’s Video Kai. “They can expect a long life out of these LaserDiscs and I want to make it a in Sherman Oaks, Calif. disagrees. Mail happy one.” Kai brought the point home order, he notes, is the only way some peo- during a question and answer session at a ple can get the discs they want, and he has trade seminar in January when he asserted customers as far away as Saudi Arabia and that “Pioneer will guarantee its software Japan. He packs the discs in heavy card- even 20 years from now.” board boxes to protect them en route, and encourages his customers to pay for It’s hard to say whether Pioneer’s strug- speedy shipments. To Lukas, laser rot is gle to put laser rot behind it has fully suc- real, and has nothing to do with shipping. ceeded. that judgement, which will come He feels Pioneer can’t always keep up with from Pioneer’s severest critics—its customers—is still being made. In the fall of 1978, before the VCR Laser’s Rocky Road and the discs. Slowly, Pioneer began to had become the proletarian appliance it is today, Kenneth Ingram, a Magnavox sands of white confetti-like dots (called nurture a new client, one who wanted executive, appeared on several national “inclusion”) that made images look as if a perfect or a nearly perfect image. TV shows to demonstrate the sophisti- cated, space age audio/video capabili- they had been filmed ina blizzard. Inclu- The rebuilding process was slow. ties of the Magnavision videodisc play- sion was caused by microscopic dust er. When it went on sale just before particles that had been trapped be- Along the way, the rival CED laser for- Christmas at Rich’s department store in tween the disc’s surface and the plastic mat from RCA was abandoned after Atlanta, eager customers stood in line “overcoat” applied to protect it from costing RCA inordinately large sums. for hours to buy out the store’s limited Pioneer carefully tried to sell laser tech- stock as soon as the doors opened. careless handling. Unlike laser rot, nology as the video version of the which develops over time, inclusion is Problems surfaced almost immedi- “leatherbound book,” in contrast to the ately. The first batch of players, assem- immediately obvious. videocassette tape’s “paperbacks.” bled by Magnavox from kits shipped When the discs and players first from the N.V. Philips factory in the But even as the format was growing, Netherlands, did not all work well. appeared, it was under the aegis of Dis- Many of the original discs were defec- coVision, a consortium of backers that albeit slowly (to date, Pioneer has sold tive and wouldn't play. The problems only 300,000 players, including those it consumers experienced included “laser included MCA/Universal, Magnavox, makes for sale under other brand lock,” in which a disc would suddenly and Philips. IBM soon became in- names), there were still some quality stall during a still frame; “cross-talk,” volved, and DiscoVision became Dis- control problems. Through minor inclu- wherein the image would be marred by coVision Associates. But alone, Big sion and speckling flaws are still re- moving patterns of closely spaced lines; Blue couldn’t overcome the problems ported by some fastidious collectors, and “skipping,” in which a disc would that resulted in poor players and in- other problems like crosstalk have been jump unexpectedly ahead, like fast for- consistent pressings. By April 1982, ward gone haywire. DVA’s pressing plant had been taken virtually eliminated. over by Pioneer Video of Japan, which The future promises further refine- Noisy, snowy discs were also a prob- had been selling a more reliable player, lem. Pictures would be marred by thou- ments. Pioneer’s new SD-1 LaserVi- the VP-1000, for over a year. sion player ($1600) can play both CAV 52 Video April 1987 Pioneer was also pressing discs in and CLV-format discs, while using di- Japan (under license from DVA, which gital circuitry to add enhancements, like retains the patents on the system and still frame and clean picture search, to still collects royalties). It was prepared to work out the bugs in both the players CLV discs, which previously lacked them. —RW, MW

Backwards? Most people do. The way many people shop for their video equipment is by looking at prices first — without looking at the bottom-line. The bottom-line is your price with product delivered to your door; including U.S. warran- ties, factory sealed cartons, shipping charges, insurance, double boxing and credit card charges. The bottom-line is also the credibility of the shipper — being able to get the product promised to you. The hardest part of buying electronics by phone is finding a reputable com- pany to deal with — after that, it’s easy. Call Video Products Distributors today — we’re an Inc. 500 company and now a Ven- ture ‘Fast Track 100’’ company — known world-wide for our exceptional service. Why take chances with boiler-room mail order companies? Call us today for the fastest service and the best prices on all your video electronics needs. No grey goods — No factory seconds — No nonsense. ALL MAJOR BRANDS AT THE LOWEST LEGITIMATE PRICES WE‘LL GIVE YOU THE BEST BOTTOM-LINE PRICES WITH PRODUCT DELIVERED TO YOUR DOOR! Video Products Distributors, Inc. Direct Mail ¢ 2947 Arden Way Sacramento, California 95825 e In California 916-978-7107 For additional information, circle No. 22 on Reader Service Card.

Beating The ; 3 — Beeb Tube GV Adobe PxTAS y (ilua ( WlSaAsdeoere = tee=>.= WR. 0ba willl croncacese@eseana8 t8 Blues couse DEUPPRUUS eefe Je oe How The VCR Saves Britain From Boredom BY MICK FARREN merican rock starJoan Jett, interviewed several years ago During the summer, sports seem to go on ad nauseum. (You can during a tour of the U.K., was moved to complain about never know true boredom until you've sat through an afternoon of the quality of British television. Did they really have to televised cricket.) The English even have their own style of soap close the whole thing down just after midnight, she won- opera. Coronation Street, a saga of working people in the industrial dered, and why were there so many shows about the sex life of the north, and EastEnders, the story of a run-down neighborhood in ant? In many respects, these are not unreasonable ques- East London, command huge fanatical prime-time followings, and tions—they have often been repeated, in substance, by much of regularly top the ratings. Unlike Americans, the British prefer the British public. Part of the problem is that the British area little their soaps funky, free of the wealth and glamour found on, say, strange, and rather than use lobbying tactics and market pressure General Hospital or As the World Turns. There’s just as much to force TV networks to deliver programming more in tune with convoluted sexual intrigue, but the characters are kitchen-sink popular tastes, the British have simply worked around their video natural. They look just like anyone you might meet in the pub, in void. the street, or on a rush-hour bus. Over the last half-dozen years, the VCR has provided a large part of their alternative, plugging the considerable gaps in what the This warts-and-all realism (which includes, suprisingly, a far four broadcast networks offer. Britain has a far higher per capita more liberal attitude towards nudity, violence, and profanity than number of VCRs than its economy could possibly warrant; almost evidenced by any American network) extends through much TV half of all households have one. (American penetration is around 35 drama. Where the American audience seems to have a craving for percent, but rising.) Almost by default, Great Britain has grown fantasies of the rich and famous, the English (who embrace the one of the planet’s most advanced video cultures, all because wy. notion of royalty with gusto) like it rough and ready. This may be there is at best limited and at times downright lousy. symptomatic of an underlying attitudinal problem: the British have Americans who haven't sat in a London hotel room at 2 AM, guilt about television. They typically consider TV the place to park wondering why there isn’t even a rerun of Audie Murphy in Bullet their brains when they’re not using them, but there’s a strange, for a Badman to help them over jetlag insomnia, have an image of almost Victorian unease about it. Shouldn’t I be doing something British TV as an expanded version of PBS, a non-stop parade of costume dramas, Masterpiece Theatre, high class nature shows, and offbeat comedy in the Monty Python vein. The main excep- tions that have surfaced on this side of the Atlantic are the licen- tious humor of The Benny Hill Show, the sci-fi whimsy of Doctor Who, and quirks of the swinging ’60s like The Avengers and The Prisoner. The British would probably like to preserve that respectably haughty image, but the truth is that they have about as much garbage on their tube as any other culture. Besides American series, from Hawaii Five-O and Bonanza to Dynasty and Dallas, there are Anglicized versions of classic U.S. game shows—includ- ing Sale of the Century and The Price Is R ight—although, with the breadline budgets of the average TV station, the top prize is more likely to be a microwave than a Jaguar, which makes for less extravagant drama-through-greed. British TV has its share of old movies and talk (“chat”) shows. 54 Video April 1987

WA Tibevs NUH Ce ee On a) predrborvoep ’1 ; 8 Ohba” © more useful with my time? This guilt helps explain endless at- the public couldn’t be trusted to prevent their children from watch- tempts to elevate TV from merely popular entertainment to some- ing it. thing cultural, even educational. uring the late 50s and early 60s, the BBC (or the Beeb, as Although the U.K. prides itself on being the archetypal free the national broadcasting authority is known), then holding society, the national character has a strong streak of paternalism. a monopoly on radio, decided that rock ’n’ roll was bad for All too often, the government looks on itself as a big daddy (or, in the nation’s youth and, but for a couple of token shows, the case of Mrs. Thatcher, a big mommy) who knows what’s best eradicated the music from the airwaves. Aware of a huge demand for the citizenry. The pubs close at eleven, TV stations shut down for something akin to American AM radio, a number of maverick between midnight and one, and the whole country is packed off to entrepreneurs set up “pirate” radio stations, quasi-legally based bed almost like a naughty child. Prior to the introduction of break- on ships anchored just outside of Britain’s territorial waters. fast TV (a translation of America’s morning “news” shows) there Ironically, it was exposure on these stations that fueled the 60s was serious discussion as to whether people would actually go to British rock boom. By 1967, the BBC caved in and initiated its own work if allowed to watch television in the early AM. The contro- rock stations, but also obtained stringent new legislation to put the versy became even more ludicrous when it was revealed that the pirates out of business. In some respects, video has tended to actual programming would be nothing more than a lightweight parallel pirate radio. A cultural need was not being served, and talking-heads news magazine show, heavy on rock stars, soccer people did something about it. The British took to the VCR so fast players, and celebrity gossip. that they virtually set the pattern of video distribution for the rest of the world. Another recent example surfaced during a Parliamentary de- Even before the VCR truly arrived at the end of last decade, a bate on the establishment of a national cable network. An applica- number of factors were already in place that would make the video tion had been made to include a pay channel that would offer a boom possible. In those early days, the purchase price of VCRs menu of soft porn and horror movies. Prime Minister Thatcher indicated that, when the time came, she would veto such an idea as April 1987 Video 55 ILLUSTRATION BY JENNIFER SKOPP

Illegal door- to-door video duping became a cottage industry in Britain. Contestant Amanda Clark with host Leslie Crowther on Channel 4’s The Price is Right. (converted to dollars) averaged well over $1000; obtaining hard- door in large urban housing estates. Toting a portable VCR, a ware would have been unthinkable for most had there not been a selection of movies on tape, a supply of blanks, and leads to hook widespread, comprehensive network of TV rental companies al- into the family machine, they offer a cheap, instant, and utterly ready in business. Many of these had been set up as subsidiaries of illegal copying service. broadcasters who, at the time color TV was introduced in the mid-’60s, worried that the high purchase price of color sets would hat really hit the headlines, however, was widespread drastically limit their audience and advertising revenues. (One of piracy of first-run films. The modus operandi was the largest rental concerns, Granada, has even extended its oper- crude but effective: a moviehouse projectionist would ations to the U.S.A.) Even in the poorest neighborhoods, there smuggle the print of a hot movie out of the cinema at were companies that would supply a color TV for a minimal deposit night. By morning, it would be transferred to tape. The situation (often as little as $50), ensuring rental payments were kept up by came to a head in 1980, when a copy of The Empire Strikes Back, sending door to door collection agents around every Friday night. despite stringent security precautions, vanished from a theater in It was no trouble for these companies to add VCR rental to their the south coast resort town of Hastings within days of its pre- miere. Producer George Lucas, understandably protective of his services. product, called a press conference and demanded that the authori- As more and more homes acquired VCRs, an enormous demand ties make greater efforts to protect first-run films. In the wake of this furor, the circulation of such pirate tapes diminished, possibly for programming was created. It soon became clear that the as a result of increased security but more likely because the fad for cassette distributors’ dream of a videotape industry based on owning a blurry copy of a movie went the way of all nine-day direct sales just wasn’t going to come true. In the depressed wonders. economy, only a small minority could afford to pay the equivalent What didn’t go away was the flourishing video underground that of 50 or 60 bucks for a movie. It was obvious to all but the came in with the VCR boom. At its most benign, the spread of distributors themselves that, once again, the future lay in rentals. video has made it possible for a lot of fringe product to find an audience. With such a volume of videocassettes in circulation, it’s Free enterprise stormed in to fill the gap, and video rental possible for avant garde filmmakers or up-and-coming pop bands stores quite literally mushroomed across the nation. While other to dupe a limited edition of their work and offer it on consignment countries were still treating the VCR as something of a novelty, by to retail shops. the start of the ’80s Britons were falling into the habit of stopping by the video store on the way home from work to pick up a movie here is, however, a dark side to all this. What the media has for the evening. Video stores came in all shapes and sizes, from dubbed “video nasties” has been causing considerable con- large, well-organized chains to porno outlets that added general cern at all political levels. These minimal budget produc- films to their existing stock. Rentals didn’t stop with video stores: tions base their appeal on the lowest common denominator the traditional corner shop selling magazines, newspapers, candy, in shock tactics; they are either brutal home-made pornography or and cigarettes put in a video rack. The selection was limited—usu- equally brutal plotless splatter loops. Awoman masturbates with a ally just the top 20 cassettes and some porno tapes under the live eel; raw meat, doubling for human flesh, hits the chainsaw. counter—but it was close and handy. The competition thus gener- They circulate in bars, on factory floors, and even, sad to say, ated also served to force down rental fees, security deposits, and around schoolyards, much in the manner of illegal drugs. A sec- membership charges. In an amazingly short time, video became ondary distribution route is from under the counters of less- almost. universally available. continued on page 104 Any growth industry will produce criminals and hustlers; British video proved no exception. Bootlegging became a thriving cottage industry, even on the level of enterprising pirates working door to 56 Video April 1987

tGi @)°{a)40 /CAMCORDERS IDEO CRARRASMCDISNCKEKESOAASRS/RLR//ACIESVSEOQIYP/SSMDUSOTB/PEATEPLROLAEREAITCMERZNOTSARSEK/EBORBCRSNLDLOA/AVIEARDIL/SNDSADCCKEHKESLE¢ TUNERS/RACK SYS xY7.EAR % 867 8% CORDERS/VIDEO ¢ DRAGON RS/COMPUTER SOF AACHINES/TELEPHO ALCULATORS /TYP HEADPHONES AMPBE LOR TELEVISIONS IDEO PROCESSORS CHUCK NORRIS MEL GIBSON AURED ‘ tIious tal MAD MAX M forMurder’ YOUR CHOICE YOUR CHOICE VHS Each FORMAT Forbidden Planet eJailhouse Rock Pink Floyd: The Wall eKelly’s Heroes eNorth by Northwest eLed Zepplin: Each The Song Remains the Same ePale Rider Dial ‘M’ for Day at the Races (Marx Bros.) Night at the Opera Murder eGreen Berets *Mad Max Beyond (Marx Bros.) eThe Dirty Dozen eMissing in Action Thunderdome eKate Bush: Live at Hammersmith eMissing in Action Il -Year of the Dragon eTop Gun eEldorado eRaiders of the Lost Ark eShane eThe eThe Deer Hunter eScarface (Al Pacino) To Kill a Shootist «Witness eBeverly Hills Cop eStar Trek: The Mockingbird eHigh Plains Drifter eThe Sure Thing Motion Picture Star Trek Il: Wrath of Khan eStar Trek eBlade Runner eA Chorus Line *Emerald Forest eThe Ill: Search for Spock eTo Catch a Thief «Holiday Inn Lion in Winter eThe Graduate eJaws eThe Sting eSwin Time eRepo Man eConan the Barbarian eCoal Miners eRed River eThe Undefeated *Dodge City Daughter eConan The Destroyer «Westworld eLogan’s Run eCannery Row eSoylent Green Panasonic PV-1563 VHS HQ Teac MV-350 Toshiba DX-7 Sony SL-HF750 Super Beta 4-Head Video Recorder VHS HQ Video Recorder HI-FI Stereo Digital Video Recorder HI-Fi Video Recorder © High quality picture * Cable ready °HQ circuitry * Freeze frame off the ¢Linear stereo with Dolby * Wireless 14 day/4 event * Wireless remote air capability *Cable ready MTS ¢ Pro quality recording speed * MTS/SAP remote ¢ MIS/SAP stereo cable ready * Digital tape counter stereo tuner * 4-head design decoder * On-screen display * Drawer On-screen programming loading * 21 day/6 event timer List Sale UST Sale List $1199 Sale List Price $779 Price $499 ae Z Panasonic PV-1642 JVC HR-D470 Shure AVC20 Panasonic PV-220 Hi-Fi Stereo Video Recorder 4-Head Hi-Fi Stereo Video Recorder “OmniMovie” VHS HQ Camcorder *HQ circuitry * Cable ready MTS/SAP Video/HI-Fi System Expander *HQ circuitry * Auto focus power zoom. *VHS HQ *4-video heads «MTS/SAP stereo tuner ¢ 14 day/8 event timer © Four 30 watt per channel amps ¢ 3 lens elnstant playback Electronic ¢ On-screen programming video inputs °3 surround sound viewfinder * AC adaptor/charger stereo cable ready *21 day/8 event modes ¢lmage enhancer timer * Black finish Sale Sale List Sale List Sale LIST Price $899 Price $599 Price $999 VIDEO ACCESSORIES Vidicraft Detailer Ill Azden WM20 Video enhancer . . ‘149° Wireless mics =» TIO GE RRC500 Vidicraft A/V Proc Remote System .. .*99% A/V processor. . . $309 Rabbit TR7000 Rhoades SW5X4 VCR multiplier . . . . 869% Video switcher . . . 159% eNNEeaETeoeTOnNNE re ds High Sirf Recoton V622 Harwood VL-250/100 MTS stereo decoder £99 / Recoton V624 be ee - 9\" Maxell TI20 HGX ; MTS decoder/amp ‘124% High Grade Video Tape AC/DC light..... s119°° Sima CopyKit . . $395 Discwasher Wet 2‘J“EjaU1p/UOa0eZ0DsON4Up1UeIOP/DJ2IOaeSIUyUPJPOeJU! Slide to tape VHS head cleaner . 12% HOW TO ORDER BY MAIL: SEND MONEY ORDER, CERTIFIED OR CASHIER'S CHECK, MASTERCARD, VISA or DISCOVER CARD (Include card number, Interbank No, expiration date and signature.) TO: J&R MUSIC ORDER WORLD, 23 PARK ROW, NEW YORK, NY 10038, DEPT. VMO487. DO NOT SEND CASH. Personal and business checks must clear our Authorization Center before processing. $25 Minimum Order. SpIPP ng: Handling & Insurance Charge Is 5% of Total Order with a $3.95 minimum. «Canadien Orders Add 15% Shipping, TOLL FREE with a $9.95 minimum nee For shipments by alr, please double these charges. SORRY, NO C.O.D.’s. NEW YORK RESIDENTS PLEASE ADD SALES TAX. ALL MERCHANDISE SHIPPED BRAND NEW, AND 100% In New York, Alaska and Canada Call : (212) 693-0396 GUARANTEED. WE ARE NOT RESPONSIBLE FOR ANY TYPOGRAPHICAL ERRORS. 10038 Ea 2} 23 Park Row, Dept. VMO487, NY, NY

Part Ill: 8mm and Compact VHS 1987 Blank Tape Tests Complete Guide To The Mini Formats e wind up our 1987 Blank Tape All 8mm tapes carry the MP (metal par- Tests this month with our first ticle) designation, confirmed by the “P,” as survey of Compact VHS and in P6-90. The first numeral in the designa- 8mm tapes, the two mini for- tion indicates the type of video signal for mats introduced since our last series of which it is made: 6 for NTSC, 5 for PAL. tests. Both are available in fewer brands The numbers after the dash indicate the and grades than VHS and Beta tapes, but recording time at the SP (standard play) their number is increasing even as their quality improves. speed. Although no single tape dominates ei- In the near future, 8mm users can look ther format, several shine above the rest. Among the top Compact VHS tapes are the forward to an improved Metal Evaporated Zenith SHG, which has especially strong variety of tape. No manufacturer offers video qualities, the TDK Extra HG, and ME tape for sale yet, but one says it is only the RCA SHG. All are unusually well-bal- waiting for other tape makers to complete their work so they can all announce ME anced. tape at the same time. The Japanese firms In 8mm tapes, the thicker 13-micron va- are also reluctant to introduce it now be- cause of the weak dollar and the fact that rieties usually outperform the thinner 10- ME tape costs about twice as much to micron ones, especially in video character- produce as MP tape. istics. This proved true in our tests. The top performers using the thicker 8mm tape TWO DEBUTS were from Konica, Maxell, Memorex, Polaroid, and TDK, though Fuji and Sony Compact VHS machines and tape de- tapes also performed well. Among the thin- ner 8mm tapes, those by Sony and buted with JVC’s HR-C3U portable record- Memorex stood out. er early in 1983. The recorder was not The two mini formats share a small combined with a camera until JVC’s GR- cassette size but differ in virtually every other respect. Compact VHS tapes are half C1U in mid-1984. an inch wide, 20 microns thick, and coated with oxide particles ona plastic base. They The 8mm format was introduced in Janu- are the same as their corresponding VHS numbers, except for their smaller TC-20 LRBPACEJYOHOWIBNONIESTSRTOTRGafURirCnAyTaPlIHO1N898m5m by GE, Kodak, and RCA. The format was worked out by a cassette shell. Compact VHS tapes record using the committee chaired by JVC. It combined the same information pattern as standard VHS cut from 13-micron stock, and the work of many manufacturers, including tapes and may be used in VHS machines 120-minute length from 10-micron stock. Matsushita, Sony, and Toshiba. The group with adapters. Much of what we said about VHS tape in the February issue is true of The format was designed to accept met- approach was adopted to banish the spec- Compact VHS tape, but Compact VHS ma- chines cannot record in stereo on the linear al tapes manufactured by coating the base ter of further format wars. track or in Hi-Fi. So our Compact VHS film with fine metal particles or by condens- The 8mm format allows 1.6 megaHertz tests provide no information on track bal- ing gassified metal onto the base film ance for linear stereo recording. through sputtering or evaporation. In the for the video signal; a single, full frequency coating method, a binder that contains the The 8mm tapes are 8mm wide with a particles is applied to the film. The sputter- response; a mono AFM signal mixed with magnetic metal layer on a plastic backing. the video; and a digital stereo signal re- The tape is available in two thicknesses corded after each line of video using 8-bit with 15-. 30-. 60-. and 90-minute lengths ing method directs a controlled stream of PCM (pulse code modulation). Because of 58 Video April 1987 gaseous metal onto the base film, while the the number of bits used for the PCM, audio evaporation method condenses gaseous frequency response is limited to about 15 metal onto the film. Currently, only tape kiloHertz. But all the other benefits of dig- made by coating is available. ital recording are preserved. On 8mm machines with digital audio ca- By Lancelot Braithwaite pability, additional audio tracks can be sub- stituted for the video signal so you can end up with six stereo signals for a maximum of

12 (at SP speed) or 24 (at LP speed) hours How to Use the Tape Test Chart of music on a P-120 cassette. So far, little use has been made of this capability. Only The charts on the next two pages, mono audio track near the edge of the the Sony EV-S700U VCR and the Kodak and the evaluations that follow, are to tape, giving them all the limitations of a MVS5000 recorder are able to record or help you choose the Compact VHS or linear audio track, including higher, play the digital tracks. However all the 8mm tapes most likely to meet your more consistent hiss. tapes can record video, AFM, and digital home video needs. Before working audio signals. with the charts—which leave blank Most 8mm recorders use the audio spaces for your own ratings and price frequency modulation (AFM) system, Our tests showed that tape thickness notes—think about what you'll be using which has a much lower noise/hiss lev- and brand have no effect on either type of the tape for and the characteristics that el. But AFM can be plagued by other audio except that the dropout count could seem most important to your particular types of crosstalk noise from the video exceed the error correcting capabilities of type of taping, be it simple timeshifting that show only occasionally. The the machines on which a tape is used. We or complicated home editing. dynamic range describes the difference measured audio frequency response on the between the loudest and the softest AFM and digital tracks and found no differ- No tape rates best in every criterion. sounds not buried by hiss, but does not ences. Therefore, we do not consider the Therefore, you'll want to focus on those include the occasional crosstalk. Note results a useful criterion for differentiating that mean the most for the job you have also that the audio frequency response among 8mm tapes. The entry “T” (for typi- in mind. If dropouts are likely to cause a of 8mm tapes is the same for all brands cal) indicates this on the main chart. The bigger problem than graininess, pay and thicknesses. The similarity reflects measurement is plotted as a point between more attention to the dropout count. a machine limitation rather than a tape good and very good on the individual characteristic; that is, the audio fre- graphs. There are separate charts for Com- quency response for an 8mm tape is pact VHS and 8mm tapes. Note that the fixed once you have chosen the VCR or There was a slight variation in the dy- Audio S/N column in the Compact VHS camcorder in which it will be used. namic range on the AFM tracks which is chart changes to Dynamic Range in the plotted on the graph of each tape’s per- 8mm chart and that the numbers jump You can rate the tapes by using either formance under “Audio S/N.” If you must about 30 decibels. Compact VHS VCRs letters or numbers. If you use letters, compare the AFM tracks, use the dynamic and camcorders only record sound on a weigh the important characteristics by range numbers in the main chart. Though raising the scores in those columns by measurable, we found the differences too Rating Scale one or more grades, or by lowering the small to hear. scores of the less important character- the Compact VHS istics. Then scan across the rows to find GRADE DIFFERENCES the tapes with the largest number of high ratings. If you apply numbers, use From time to time we hear rumors that the accompanying “Numerical Guides” there is no difference between grades of or apply your own numbering system to tape, though manufacturers insist there our letter scale—1l to 7 is the sim- are differences both in tape formulation and plest—and count the totals that way. in the processes used to make various Write the figures in the columns for grades. Our tests bear this out by reveal- “Your Rating,” add across individual ing distinct performance differences be- rows, and look for the highest numbers. tween grades. Though the differences are not always as great as you might imagine, —LB you should try a top grade at least once. Test Rating Scale continued on page 104 Numerical Guide to ss | Video S/N' | Consistency' C=hArMoS/mNa' PCMhroSm/Na\" DCrooupnotut | SA/uNdio aResLponse? | Excellent over 44.1 over 41.9 0to5 over 47.2 cra | over 49 0, 0.1 41.9 | | Very good 49.0 0.2 43.9 to 44.1 6 to 10 AT OVOST Qo ee pe 5 | if TP Bo iat a3 ra a Tish RSIS LarES TT fl ir 41.8 | Good | 48.9 0.3 43.6to43.8 11 to 20 46.7to 46.9 ce Ma | |Average 48.7to48.8 0.4 43.3to43.5 | 41.7 21 to 30 46.4to46.6 63 to 10k | |Fair | 48.6 | 0.5 43.0to43.2 | 41.6 31 to 40 | 46.1 to 46.3 80 to 10k | Weak 48.5 | 0.6 | 42.70 42.9 | 41.5 41 to 50 | 45.8to46.0 | aeraris Poor — Q Mader 33-6 over 0.6 | under 42.7 | 41.4 over 50 over 45.8 | —— > 1. In decibels. 2. In Hertz. April 1987 Video 59

COMPACT VHS TAPES | Video Our Your Consis- Our Your Chroma Our Your | Chroma Our vj sree eres ate aad aoe Buea onsenab ere AM S/N* e eutaes| Rating anit |siti ‘se i‘ a €: eee ee Super HG TC-20 | 48.5 | W. = UG. fee 453° P fe ee ee i 405 | P | LAB eR | HG Super TC-20 eae | Super HG TC-20 7 ae E y 16 P : Moy 42.0 E Super ProTC-20 AAR Pb Peay saa ec ee ee 441) V MAXELL 486 | F | =| o4 [A | ;: a4.4°[¥ HGXGoldTc-20 =| es, A ae [418 |G MINOLTA — | SHG TC-20 ) 41.9] v | |FPCreAmiruoms: Qwonucsiages)lityTiCcs-20 |Ul48.ial 9 | G ii a43.i8 a G 42.0 (EX : | _TOK : ec ee , |Extra HGTC-20 48.7) A 42.0 | E POs G4 ae ZENITH A ee rade OV 41.9) Vv é SHG TE-20.8¢ 1 Foe. age} Ee 8mm TAPES ee e i Video Our | Your Consis- | Our Your | Chroma | Our | Your \"Chroma Our S/N Rating? | Rating Rating | PM S/N! Fratios | | Brand & Grade tency? Rating Rating aba Rating CANON Ri Ve ee Po Bett: fe ee a MP P6-90 (| 44.405 W Rane leo hs | FUJI ie ase, Sgn Re bo ora | 43.9 | P | 8mm P6-90 ee ae OF 43.6) W “8mm P6-120 oR ples Ad. of F KODAK Wb Koes er 44102) OW ag aR 8mm P6-90 Mit Pee RW (86 | Ww | 8mmP6-120 :: i Agata he KONICA ee a 13 iy 44.2 | A |SupMePPr6-90 2 |47.6 | OV rev ee : A u MAXELL | 47.1 «GS e0.2 | a Bre 446 | G | “8mmMPP6-30 45.6 Poi Ee (446) G 8mmMPP6-120 wat Vl pe i s MEMOREX Wa ee ee eee aoe ev ol 446 | G_ _MP30 P6-30 aa Mo Wine we Vv Eo ee ea & ae POLAROID 447 | V 8m/m Video P6-90 SvOiNdYeodPoO wa vee pw [eat vy | [eee ea 7 Fe ee Video 8P6-120 i44.6ae aMeee Wo Ged ubeewPew me [4a5.e2 ||GvO|| _ TDK ey PiODrPaESeO a| 44e.6 |G : 1S/N: signal-to-noise ratio, in decibels. 2E excellent; V, very good; G, good; A, average; F, fair; W, weak: P, poor. 3Between batches of tape, in decibels.

en Dropout Our |Your | etuiblone Niue Audio | ba Your | Auli Etbanebiing | Our | Your | Your | Your | Your Rating | | Rating Count* Rating |Rating) at 2 MHz5 Kesconi S/N! | Rating Rating Response® | Rating | Rating Cost nia Totals ah ~ 3.2/4.4/6.1 | E | ;a SEG aaa |P | : 63-1 ok | A a roe | V5 BRS a 5.7824|e5 | fb Raabe ere 63-10k |A- if A Po eee Eee 49.9 |W ee G.28.8829 1 Vl HS ee a ek |A \\[ay g.9/19:36.2 }ve[ ft) sb] fae feGph [e etiok |11.24.9782] 6 [| | -61 | [463F] | g0-10k| F 2,99,9121. [Els | [ae ae eG a ae ‘gaaos 6s fe] oO) Ope ee ae 314g | E | | -61 | [46a] | |eetox| a | | | Your Dropout T T] f ]] |Rating | Count* Our | Your Output Loss Your Dynamic) Our Your | Audio Frequency Our | Your Ivue Your | Your Rating Rating Rating | at 2 MHz> Rating |Range | Rating Rating Response Rating’ |Rating |Cost | Rating| Totals affl ateeseharei | 0.20.62. | -E.| [Soeoy eh ekeTi]. 0.6/1.4/4.2 E | | -a|9[77] e | | 25-164 T “Weegee Eo ae v PF || ai aoe ee e Peo eT eek PT? | [sono FIr| |Sasa res] a esac TT |15.4/23.6/47.8 | @ -5.3 | [78.6] V | 1.2/0.8/4.8 | ro ro) ~Ifore) nn @ uAaine) fer~~ + m | or De) ~co oO G nmon= Da + | 75.7/13,9/258.1 Ae cb6 Ee | Ge ee M1=(en) fon) <= i { | anm — fen~) ~ el [geese mom |1 booei 1.41.63. | E | SO Ree Gil eh ase YT | 11.6/16.4/38.2 | Gq =| asire ~~co Oo | 5.08.0/16.4 | m eee | — on | 14.5/20.4405 [G | | -49 | LT SE | 8.610.8/29.4 | Vv 1 a Me ea ee oF 415 microns sec/10 sec/5 sec. 5In decibels. In Hertz. 7T: typical. The response is common to all 8mm tapes.

What the Terms Mean Audio Frequency Response is a the variation between batches intro- measure of reproduction of picture de- measure of the range of frequencies duced during manufacturing. reproduced by the tape and the machine tail. High frequency signals carry detail to within 3 decibels of its output level at Dropout count is the number of 1 kilohertz. In 8mm recordings, the portions of the video signal missing information, but high frequency signals tape has a much wider range than hu- mans can hear but response is limited from the tape. They are caused by are- lose strength during recording. Meas- by the design of 8mm gear, making au- as on the tape with too few magnetic dio frequency response a property of particles—like a pothole—or by debris uring 2 mHz output tells how much the the VCR or player in which it is used. on the tape that momentarily separates the tape head from the tape sur- tape contributes to the loss of detail in Audio S/N is a measure of how much face—like a wheel going over a rock. In noise affects the audio signal. It is no- both cases, the head loses traction. the picture. ticeable as hiss. Since all tapes are Dropouts caused by debris disappear as tested under the same conditions, dif- the “rocks” are pulverized or knocked Video S/N is a measure of the pro- ferences in S/N are caused by the tape. aside, so the dropout count lowers for portion of noise in the video signal. It Chroma AM S/N isa measure of the the first 10 to 20 passes. Potholes, on variation a tape causes in the color in- the other hand, may fill with debris, but looks like graininess or snowiness, and tensity of a field of a single color. The eventually get larger as the tape dies. variations are caused by noise affecting We classify them by the length in micro- is one of the most annoying deficiencies the amplitude of the color signal respon- seconds of the missing information. in a video signal. If you’re recording on sible for intensity. Over 15 microseconds, they are large; Chroma PM S/N is a measure of the between 10 and 15 microseconds, me- the Hi-Fi track, it is a reasonable indica- dium; and between 5 and 10 microsec- variation in the hue or shade ofa field of tor of the tape’s contribution to noise in a single color. The variations are onds, they are small. All VCRs have caused by noise affecting the phase re- compensation circuits to minimize their Hi-Fi audio. lationship that determines the hue of a color picture. The tape itself can’t effect, but when dropouts show, you Numerical data in the chart are in the change a phase relationship. Yet, since see annoying white or black streaks of there is variation, some of its variation units in which each characteristic is nor- must come either from the tape or the noise. cassette shell. We are continuing to Dynamic range is the difference in mally measured—in decibels for the search for its cause. decibels between the softest sound dis- S/N ratios, in Hertz for audio frequency Consistency between batches, tinguishable from background noise and the loudest that can be recorded with- response, and in actual count for drop- or dispersion, is the difference between out distortion. Crosstalk from the video the best and worst video S/N measured signal may occur at specific frequen- outs. Since the dispersion figure is a for each type of videotape. It indicates cies, but this measurement does not variation of numbers measured in deci- take into account such noise. Output loss at 2 megahertz is a bels, it’s in decibels, too. All numbers are presented as read directly off the measuring instruments, except for the output loss at 2 mHz, which is calculated. The circular graphs help you judge the balance between characteristics. An ideal tape would be perfectly balanced and appear on the graphs as a perfect hexagon. The closer a graph’s shape is to a perfect hexagon, the closer the tape is to being an all around high performer. You may want to add a column to the chart to take its shape into account. —LB Numerical Guide to the 8mm Test Rating Scale | TL Video S/N | Chroma Chroma Dropout Dynamic | eoaieaey Lee ceihaes over 46.6 Consistency’ | AM S/N’ | PMS/N' Count — __ Range’ | Response’ | Excellent 0, 0.1 | over 45.5 over 44.9 0to5 78.7 25 to 16k | Very good 47.410 47.6 | 0.2 | 45.3t045.5 | 44.7to 44.9 6 to 10 78.6 25 to 16k _ Good 47.1 to 47.3 0.38 45.0t045.2 44.410 44.6 11 to 20 78.5 25 to 16k Average 46.8to47.0 0.4 44.7to44.9 | 44.1 to 44.3 | 21 to 30 78.4 25 to 16k | Fair 46.5to46.7 0.6 | 44.410 44.6 43.8to44.0 31 to 40 | 78.3 25 to 16k | Weak 46.2to46.4 | 0.6 44.1 to 44.3 43.5to43.7 41 to 50 | 78.2 | 25 to 16k | Poor under 46.2 | over 0.6 under 44.1 under 43.5 over 50 78.1 | 25 to 16k 1. in decibels. 2.1n Hertz. Response is typicalof all8mmtapestested. ip : : cea le eee 62 Video April 1987

FUJI Fuji offers a TC-20 in only one grade, jvc JVC’s highest TC-20 grade is Super Pro. The test series shows a one Super HG TC-20 Super HG. It has a few great Super Pro TC-20 strengths with ratings of excellent grade increase on audio S/N, but Video S/N Video S/N ratings for all the other characteris- on dropout and very good on chro- tics slipped. We lacked samples ANAudio ‘onsistency ma AM S/N, but it has great weak- Audio Consistency from enough batches to rate its con- nesses, too, with ratings of poor on Frequency Between sistency. We'd choose JVC’s Super consistency and audio S/N. It rates Response Batches HG unless the Super Pro improves. weak on video S/N and average on audio frequency response. The overall balance is poor, making it best for occasions when only its strengths count. Bear in mind that the gap between excellent and poor is small on some characteristics. Dropout Count Dropout Count HG Super TC-20 JVC is the only manufacturer that HGX Gold TC-20 Maxell HGX Gold is an average or offers more than one TC-20 grade. Video S/N Its basic grade, HG Super, is aver- Video S/N above average performer in every age or better than average in most Audio Consistency Audio Consistency characteristic except video S/N, Frequency Between ways, but it is a poor performer Frequency which rates fair. It is strongest on Response Between the dropout count, which is very on video and chroma AM S/N. If Batches good. Chroma AM S/N and audio you’re aiming for the best possible S/N both rate good. The pictures this picture, you may want to step up to tape produces are quite good de- another of JVC’s tapes. Again, spite its slightly higher noise. though, the difference between the best and worst tapes for these crite- ria is small. Dropout Count Dropout Count Super HG TC-20 JVC’s middle TC-20 grade is Super MINOLTA Minolta’s TC-20 is called SHG on HG, which is very easy to confuse one part of the package and Super Video S/N with HG Super. It rates excellent on Super HG TC-20 HG on another. Although itrates just video S/N and the dropout count, fair on both audio characteristics, it Dropout Count two of the most significant picture Video S/N is average or above on all the video characteristics. Chroma AM S/N characteristics. It is excellent on earns a very good rating. However, Consistency consistency, very good on chroma Between AM S/N, good on the dropout count, it rates poor on consistency between and average on video S/N. It is not batches and that can contribute to recommended for applications in jumps in the video S/N if master which audio is critical. tapes are from different batches. Au- dio is average or slightly below. It is a very good tape if you don’t edit with different batches. Dropout Count April 1987 Video 63

pen 7-20 SHE | oes RCA RCA announced its TC-20 tape on MP P6-90 Canon's MP P6-90 8mm tape offers the same day as its Compact VHS a wide range of performances. It is Premium Quality TC-20 camcorder. Since only the first excellent on the dropout count and batch was ready for testing, there dynamic range, very good on video Video S/N is no rating for consistency. It is an Video S/N S/N, weak on chroma AM S/N, and excellent performer on the dropout poor on consistency. The poor con- Audio count and audio S/N, and good on Audio Consistency sistency rating may have been chroma AM S/N and video S/N. Au- Between Frequency WB dio frequency response is average. caused by test tapes that were ac- As with most other TC-20s, this is quired a year apart. Despite the wide Response 4, probably due to a machine limita- i differences, the video S/N average tion. It promises to be a very good remained very good. tape. Dropout Count Dropout Count Extra HG TC-20 TDK’s Extra HG rated average on 8mm Metal Tape P6-90 Fuji’s P6-90 8mm Metal Tape is a video S/N and audio frequency re- very strong tape with one weak Video S/N sponse, good on consistency be- Video S/N spot—the chroma S/N rates tween batches and audio S/N, and Audio Consistency excellent on chroma S/N. It’s a good poor. Three of its other ratings are Frequency Between all-around performer. TDK’s new excellent: video S/N, the dropout tape, HD Pro, which should just be count, and dynamic range. Signifi- available, promises to be even bet- cantly, it rates very good on consis- tency between batches. If you can ter. accept a chroma AM S/N 2 decibels below the best measured, it is a fine performer. Dropout Count Zenith offers one SHG grade in a 8mm Metal Tape P6-120 Fuji P6-120 8mm Metal Tape is its TC-20 cassette. On video character- thinner tape. Except for the dropout istics, it is the best we measured, Video S/N with ratings of excellent on video count, it measures lower on most Consistency characteristics than the P6-90. The Between S/N, the dropout count, and consis- tency between batches. Chroma AM dropout count is excellent, dynamic S/N is only one step behind at very range is very good, video S/N is av- good. The audio frequency re- erage, and both consistency and chroma AM S/N are poor. Fuji’s P6- sponse, which rates average, is un- 90 should be chosen whenever the surpassed, but audio S/N was only extra recording time isn’t required. fair. We'd still choose it above the others we measured because of its video performance.Itis only 1 deci- bel behind the best audio S/N per- former. Dropout Count Dropout Count 64 Video April 1987

Tape Tests KODAK Kodak’s 8mm P6-90 is an average or MAXELL Maxell’s 8mm MP P6-30 is the same as all its other 8mm lengths except 8mm P6-90 better than average tape with one 8mm MP P6-30 the P6-120. It is one of the best weak rating on chroma AM S/N. The Video S/N dropout count is excellent, dynamic Video S/N 10-micron thick tapes, with rat- range is very good, consistency is S ings of excellent on the dropout Audio Consistency good, and video S/N is average. Audio Consistency count and chroma AM S/N, very Frequency Between With a weak chroma S/N but an ex- Frequency Between good on video S/N and consistency cellent dropout count, it is an between batches, and good on dy- acceptable tape for most recording namic range. An all around best uses. tape, it is well-suited for most pur- poses, though some tapes rate high- er for specific characteristics. Kodak’s 8mm P6-120 is not as Audio Consistency Maxell’s 8mm MP P6-120 is weaker strong a performer as its P6-90. Itis Frequency Zo Between than its P6-30, as is true of the average on dynamic range and con- Response Za lengths of most other manufactur- sistency between batches, fair on ers. In this case, the weakness shows up in a poor dropout count, a the dropout count, weak on chroma bad area to show a weakness. Its AM S/N, and poor on video S/N. other scores are actually quite good. Whenever possible, use its P6-90 it rates excellent on consistency be- instead. tween batches, very good on chro- ma AM S/N, and good on video S/N and dynamic range. With such scores we would recommend it highly, but the poor dropout count negates that. Dropout Count Konica’s Super MP P6-90 is a MP30 P6-30 Memorex’s P6-30 tapes were all well-balanced tape, as all its im- from the same batch, and we could ‘Audio Video S/N Consistency not find samples from other sourc- portant characteristics rate good or Frequency Between es, so there is no consistency rating. higher. The dropout count and video Batches However, itis a top performer, earn- S/N are both good, dynamic range iNg a rating of excellentonthe drop- and chroma AM S/N are both very Out count and very good on video good, and the consistency between S/N, dynamic range, and chroma batches is excellent. Such overall AM S/N. We recommend it highly. good performance makes this tape suitable for most applications. Dropout Count Dropout Count April 1987 Video 65

Tape Tests — MEMOREX Memorex’s MP120 P6-120 is Like most 8mm tapes of the P6-120 among the highest scoring tapes of thickness, Sony’s Video 8 is not as MP120 P6-120 Video 8 P6-120 13-micron thickness. We did good a performer as the thicker and Video S/N not rate its consistency because, Video S/N shorter P6-90. It is best on the drop- again, all the samples were from the out count, which is excellent. Con- Consistency same batch. It rates excellent on the sistency between batches, dynamic Between dropout count, very good on dy- range, and chroma S/N all Batches namic range and chroma AM S/N, earned ratings of good, and video and good on video S/N. We recom- S/N rated fair. It is a reasonable mend it for all applications except choice when you need a P6-120. those on which video S/N is critical. Dropout Count POLAROID Polaroid’s 8mm P6-90 was its only TDK recently changed the formula- 8mm tape available for testing. It is tion and packaging of both its 8mm 8mm Video P6-90 an all-around good performer with tapes. The above picture shows the MP-90 tape without its outer wrap. Audio Video S/N strengths in the dropout count and which is similar to the MP-120. It consistency between batches, both Consistency rates good or higher on all video Consistency = Between characteristics, and is even a very Between of which are excellent. It rates very good match with earlier (pre- good on video S/N, and good on change) batches on video S/N. It is dynamic range and chroma AM S/N. recommended for general applica- It is good for most purposes, espe- cially for making masters for home tions. editing. Dropout Count Sony’s Video 8 P6-90 is a good per- TDK’s new MP:120 P6-120 is, like former in all areas except consisten- most thinner tapes, not as good as cy between batches, in which it is MP:120 P6-120 its thicker P6-90. Its ratings of very weak. Video S/N and chroma AM good on the dropout count and chro- S/N are both very good, and the Video S/N ma AM S/N, and average on dynam- i Consistency dropout count and dynamic range Audio Consistency ic range, are highlights, but vid- | Between | \\ Between both are good. It is a good tape for Frequency eo S/N and consistency between the | } most applications but for editing Response Batches earliest batches are weak. No doubt masters we recommend you use this will improve as production stab- tapes from the same batch. ilizes. It should be considered a gen- eral purpose tape with TDK’s P6-90 preferable whenever possible. Dropout Count Dropout Count 66 Video April 1987

ORDER TOLL FREE: 800-221-40 (ALL STATES EXCEPT NEW YORK. HAWAII. ALASKA) *ORDERS ONLY! ALL OTHER INFORMATION (212) 344-0011. OVER 30 YEARS OF CUSTOMER SATISFACTION—COAST T0 COAST “4 want you to know how extremely pleased | am with your exceptionally fine, prompt and swift service. Heartfelt thanks to your staff, especially the polite man who took my order on the phone. From now on | intend to be a steady customer.” $.W.S.—Detroit, Michigan |All with ageOLYMPUS Video |mace fro It’s like having a VCR in every wireless 307—Color Camera, room. . .without the expense. 3DPe0cSks—R3ea-mHoeatde Home VCRs MINOLTA onty 23999 VLP-800—Portale—-395—Remote 2-Hd 500-S—Portable 3-Hd TSM ,COBRA 2O2 NRE E Remote sSppecetrruumng e BADAR 31—1_0023hS/uVpiesrorhet sate VKP-170— Portable emote DolIbbyy-Stereo ony 37909 New ! 208\" DETECTORS FNOeXw Impulse 84s8 onty 3950° onty 39900 BEL Reemomte ote 3-3H-Heeaad RCAak (0—3-Hd Remote HQ | 844 Express 14995 MicroFox 17995 00 ONLY 379 __ RCMCRA300—Full Size |Ask about our : LZ LCaotmepsltetMeodOeultsf!its! | HEV VHS 7-Lux-Zoom _| Extended MINOLTA VIDEO ACCESSAORIES | +2:OuNtLyY 119900* Paar | et reia tCR8000—v8tamems r CALL Birttshe prices! PJrVi.cCe Leader! WSeO_NY—8Thmemm Altt GR-C7 VHS-C— CCD-V3 ide Tae Coe Sait) tae |iotteesned” =GAMICORDERS =—_——iCoonvertvmidoeoviteapseslide 39 SPECIAL i ‘ SLIK 322VF 149°° | Latest Model RCA OeUTFeIT 2TSitlat-rA-llDD59 8«6999955 oMmyy_A19e6900 PFrAi:cMeOLUeSader! * Case Fitters VIDEO LIGHTS VHS HO m2he-ehrranoreccioorgduinsg:, zoom OCoNmLpYlet1e08Ou9t0fi0t |CCCDD--1V180AF *« TErxtirpaod Video Tape VIDEO TRIPODS ACca-mc0o¢rdceormbvoideo lite hin en Ask For Kit Price Star-D 710 598° OnLy 4995 OLYMPUS onty 79990* FREE Latest Special! 801—Smallest, light, sold only with AC/RF BONUS! os —— VIDEO LENSES Sik 120vF 49° WIDEO easy-to-use adaptor & battery WAS Tee ONLY W.A. Lens ges SLIK 122VF 68° _AAAEegQRIES Tele Lens 2995 Video Lite AC 990s CALL 14990 *After rebate. Aux Lenses ELatesEt ModEels! WA Tele Kit 498° Video Lite AC-pc 4gss for low, low price! KODAK MVS MODULAR VIDEO =Wé have them! Filter Kit 2995 Stereo Simulator 1995 —Bu The Perfect Audio/Video Entertainment System G.E. Camera Ext. Cord _ They Last! MVS-3460 Autofocus Camcorder 7ages = VS-C -7810.7812- 25 ft. 3495 MMVVSS--3384040 StMearneuoalTunCearm,co8r-dEevrent 619999550 s7h-uLtutxer 1/1000 VC5R0 ftC.overs 49e9s5 | ZENITH Video Prop 3995 VM-6200 VHS-C— MVS-360 Tuner-Timer 169°° OUR PRICE Video Tape Eraser 3995 Complete Outfit MVS-5460 Autofocus Stereo Camcorder 11499° 00 MVS-550 AC Converter/Charger 12950 ~—s:{00 low to ONLY 959 MVS-80 Character Generator 11959 —_advertise! & ANSWERING MACHINES Code-A-Phone 3530 10695 WM-F200 16995 Phone Mate 8000 11495 sie de pee PRhecoonred-MAa-tCaell80520000 137789958 fiWirras : pel\\ a ler =fiwwm--FFai500Special 745 SONY — iIicCcrFr---2770661000000A SSRoeoncynoyrd-IIATT-AAC--a65l00l00 2020 11174124899955 11799 WALKMAN —-2167994999955 TENBA Panasonic 7549508 CASIO see EXTENDED Ten KKXXTT 23314355 : Musical SWPAERCRIAANL TY KXT 1422 Keyboards Buy a TENBA a Ale By Camcorder Bag Freedom Phone pages CrS-2000 Piano, FULLSIZE KEYBZOoAeRD MWIiNeIvKiE0Y”BOARfDa. cone tafwoirth$6p9u.r9c5hase of OernnebPaebe esASBEQNRS Fee Ppmeses8 caso 12998 NEWW!! CAZZ--11 CALL CT-550S0pectal S55* - —Specstaulper119drsum farented. Horranty CobraCP460S SHIPPING & INSURANCE (U.S.A.) Prices guaranteed until Mar. 20, subject to suppliers CAMERA EXCHANGE re iimnpcorretaseasn,d QauraentciotvieersedLimbiytedW.all SoStm. eCaimteermsa aErxecludisrievcet 82 WALL ST. WY. WY. 10005 wes 50¢ per Ib.; Air or C.O.D. add’! Warranty; rebates have been applied, where applica- t a A iy le ble HANDLING CHARGE: Min. $5.95 plus 2% of Order. For additional information, circle No. 24 on Reader Service Card.

BROOKSHLMS vss DAVID CRONENBERG aw THE FLY JEFF GOLDBLUM GEENA DAVIS JOHN GETZ WARD SHORE camsMUSIC BY MARC BOYMAN a: KIP OMAN vauwewar CHARLES EDWARD POGUE wo DAVID CRONENBERG rsx STUART CORNFELD sw DAVID CRONENBERG He was half man. cael Haif insect. aAnd aa A brilliant experiment goes slightly wrong in this update of the horror classic. Jeff Goldblum and Geena Davis star in this scary, suspenseful tale about a man who is transformed into an insect. Both a love story and an intense drama, The Fly boasts sizzling special effects that create a nightmarish film you'll never forget. Coming soon on Laser Videodisc orginalar Available on Varese Sarabande Records og Cas: vada CBS © \"907 C8S 8FOXConmpany.Al radeemaarkofS|Reaorg‘sCan nse CaN © 16 Te Cary Fox Film Corporation Le -§ All Rights Rese

VIDEO M AGAZINE GUIDE TO FILM REVIEWS ..........- ROP %| LABELS FOR. LESS. ........00. 0000. 77 NEW TAPES & DISCS............ 76 PROGRAMMING SOURCES. ....82 NEWS AND VIEWS SOOHSSHSSSSSHSSHSHESHOHSSHOHSHHSHHHSHEHSHHHSHSHSHESHSHEEE BY MARK FLEISCHMANN Tony Bennett’s heart may be elsewhere, but his songs are on video. Hammerstein’s musical has never sound- ed better than it does here in the hands of o most people, the music in music not considered cool. Short himself is the opera singers Jose Carreras and Kiri Te video is the funk-pop-a-roll of the Kanawa, Mandy Patinkin (on loan from star of Bobby Short and Friends (MGM/ Broadway and Hollywood), and jazz giant last 20-odd years. You know: youth cul- UA), where he shows what he can do Sarah Vaughan, all backed by the London ture, rebellion, crank-it-up-loud and an- Symphony. At $19.98, the vid is an af- noy your parents. Over the last few with Porter as well as Gershwin and Noel fordable supplement—maybe a viable al- years a trickle of pre-rock videos has Coward material. ternative—to the CD. begun to challenge this monolithic one- sidedness. The video industry—invok- MGM/UA is also responsible for the Other relatively recent items include ing and exploiting names like Frank Sina- Henry Mancini and Friends (unfortu- tra and Barbra Streisand—has been platinum tape that started the making-of nately, not a selection of the film compos- seized by the notion that music video is er’s best) and Tony Bennett Sings, both mini-trend within pre-rock music video: from Sony. An older item worth noting is for everybody, even our parents. Frank Sinatra: Portrait of an Album, di- What's New (Vestron), in which Linda Maybe even for us: one subtle cultural Ronstadt and the late Nelson Riddle con- rected by Saturday Night Live filmmaker certize the hits of the 30s and ’40s. And watershed came ina scene from Hannah Gary Weis. The concept took stronger then there are all those musicals—most and Her Sisters (soon an HBO/Cannon root with Barbra Streisand’s Putting It recently, The Music Man (Warner). But release). Woody Allen and Dianne Wiest that’s another song. Or another story. go to Cafe Carlyle, where Bobby Short is Together: The Making of the Broadway irst, the bad news: CBS/Fox will belting out some Cole Porter. We are Album (CBS/Fox), in which Streisand break new price ground when it re- brings her brassy artistry and neurotic leases Aliens at $89.98. Six of the label’s meant to understand this is considered charm to songs by Rodgers, Hammer- “A” titles will bear the new price in 1987. cool, and that ignorance of your culture is stein, Kern, Bernstein, and Stephen The good news is the bad news isn’t that important. When the word arrived late in Sondheim, who comes on-camera to say the 1986 year-end shopping season, tapes were being sold in unprecedented that if Barbra wants him to rewrite a lyric amounts and few were the kind to be affected by the CBS/Fox move. When or two, that’s swell by him. This video is was the last time you bought a video for delicious on digital LV disc. $79.95? Even if other major labels follow suit, The best yet is South Pacific: The Lon- the titles to groan under heavy pricetags don Sessions (CBS/Fox). Rodgers & will be the kind of top-rank material already priced at $79.95. To the average consumer, who sometimes springs for April 1987 Video 69

$29.95 but rents the pricier stuff, the change means next to nothing. Retailers buying rental stock will have to rent a few more before making back the invest- ment, but consider the alternative—not carry Aliens? CBS/Fox was only one label benefit- ting from consumer buying enthusiasm last Christmas season. The trend toward affordable video began in 1982 when Par- amount bravely offered Star Trek II at a then unheard of $39.95. CBS/Fox sub- eoeccccce sequently joined the game with its $29.98 “Five Star Collection,” and as top exec Len White pointed out when broaching the high-end price hike to re- porters, the extra sawbuck will facilitate At $89.98, ‘Aliens’ is the first tape to break the traditional price barrier. later price cuts. “We have baskets people can use, and and the numbers, it’s easy to lose sight of : tape flaking oxide into your pricey sev- sometimes the baskets are half full. Peo- the fact that you now have a wonderful : en-head VCR. The only conceivable dis- ple are buying 10 tapes at a time,” said Joe Lisaius, advertising director for Vid- opportunity to grab Casablanca or Psy- * advantage to renting videodiscs is that eo Shack in New York. Damion Smith, who monitors video stock for the gigantic cho or some other favorite film for the : you'll have to get up at least once per | Tower Records emporium on lower : price ofa fancy dinner. And if you choose ; hour to flip the disc. Broadway, gauged holiday sales about : not to buy—this time—it’ll always be : Videodisc renters have slightly differ- ) 25 percent ahead of the previous year’s. | waiting for you on the rental shelf, for the ent tastes than the tape-driven majority. .. Commtron, a huge video software and d. hardware distributor, took a sampling price of a cheap lunch. Goldberg says he rents a lot of opera and from a nationwide group of 1500 retail- special-effects films to customers who | ers. Some reported sales increases of 15 to 20 percent over the prior few months. START MAKING SENSE: are “more music-oriented and concerned : Commtron cited such bestsellers as RENT LASERVISION with the quality of the image.” He serves Sleeping Beauty (Disney), Indiana Jones | and the Temple of Doom (Paramount), about 340 people, half enrolled in a rental Ghostbusters (RCA/Columbia), and sev- | eral others, most $29.95 or less. ree cluyb, with a 1600-title library, nearly the | entire catalogue of laser releases. The urge to collect is hardly universal, hris Goldberg: “I have customers however. Rentals built the video busi- ness and the day will never come when who come in and take out six films a : Ron Panzica, proprietor of Videorama you must choose between buying a $100 day.” Who are these rapacious renters? in Burnham, Illinois, has Japanese im- video or not seeing it at all. According to Paul Lindstrom, vice president of the They’re laser users; Goldberg manages ports and other goodies among his 1450 Nielsen Home Video Index, ‘There videodisc rentals for New York Video. rental titles (“anything I can get my reeeecaseItsemcaekseesseosoeensse to rent LaserVision. Teerrrhands on,” he says). His for-sale group The image is sharper. The sound on old- numbers 1840 titles. His customers are a : er discs is better than on pre-Hi-Fi tapes; “generally educated, more professional ; some newer discs have digital capability group.” They may not be as numerous as : that beats Hi-Fiin both technological the- : the stampeding horde that made “VHS” : ory and real-life practice. And there’s no : synonymous with “video,” but they need to worry about a damaged rental < know what they want. would never be a point where more peo- : ple would be buying than renting,” evenif the dollar volume of sales surpasses : SCANLINES rentals. According to Nielsen’s figures, only 27 percent of households buy tapes “Tentative but secure’ is what a spokesperson says of Embassy’s April slot and 59 percent are aware that major : | for Alex Cox’s Sid and Nancy. Cox's next film, Straight to Hell, should be in films are available for $29.95 or less. : theaters by the time S&N starts wreaking anarchy in the video store. “Keep in mind,” says Lindstrom, “that Indispensable is the word for the venerable Tape & Disc Guide to Home awareness is greatly a function of inter- Entertainment from National Video Clearinghouse, now in its seventh edition. An est.” In other words, if some people don’t know affordable tapes are out 8mm index is included for the first time this year. The handy reference source, in there, it’s probably because they don’t softcover, costs $13.95 plus $3 p&h (100 Lafayette Dr., Syosset, N.Y. 11791). care. The study notes that households inclined to buy rose during the second Outer Limits is on the MGM/UA roster for March. Look for three episodes of quarter of 1986 to 27 percent from 22 the classic TV show to appear at $19.95. percent a year before, but that’s “still a relatively small percentage. What’s hap- Peter Jennings narrates The Fabulous Sixties, due out from MPI in mid- pening is that the frequency of purchase March. The CBC series devotes a 60-minute installment to each year in every- is increasing.” one’s favorite decade. Moviegoers always vastly outnum- bered the film buffs who paid huge sums Tiempo Para Amar, starring Julio Aleman, was one of Mexico’s high- est-grossing films. It’s a recent release from Viva Video, the Spanish-language eeweeceecrsedieveisseiosneeoefseUsneicsoern. The Sex and Violence Family Hour is this month’s best title for a video : | release. The program of stand-up and skit comedy arrives from a new company, : | Elite Home Video. to collect film prints. Amid all the jargon ° 70 Video April 1987

PRODUCED FOR THEATERS SSCHSSSSSSSSHSSHSHSSSEHSSSHSHSESESSSSSSSESSSEGSESSEHSESE teristic of modern-day horror films into the service of a profoundly moving story. It is often pretty disgusting; Cronenberg loves to fill the screen with blood, sweat, pus, and ooze. It’s a grisly, pustulating entertainment, not for the fainthearted, and its passion and intensity are riveting. Brundle is a classic Faustian character, transformed and destroyed by his ambi- tion and desire for knowledge. The Fly vividly examines our fears of either turn- ing into such a monster or of seeing our loved ones do so. —Louis Kesten Jeff Goldblum’s character remains sympathetic even as his flesh peels off. 1986. Wil Wheaton, River Phoenix, Corey Feldman, Jerry O'Connell; dir. Rob 1986. Jeff Goldblum, Geena Davis, John : device and genetically fuses with Brun- Reiner. 87m. Hi cc $89.95. RCA/Colum- Getz; dir. David Cronenberg. 96m. (R) dle, The Fly follows the scientist’s gra- bia. Image: excel. Hi St $89.98. CBS/Fox. Image: excel. dual transformation into a 180-pound in- Rob Reiner’s movies are so consis- Recent years have seen a steady flow tently humane that you almost forget of remakes of classic pulp horror films, sect. he’s made nothing but youthpix. You from Invasion of the Body Snatchers to It’s a simple enough story—after all, don’t care how old or young his charac- The Thing to Invaders from Mars. The ters are because he makes you care remakes have been generally the audience knows what’s going to hap- about them. In Stand by Me, Reiner superfluous, upping the special effects pen from the start—but Cronenberg fills handles the timeworn theme of spectacle at the sacrifice of the originals’ it out with suspense, terror, and heart- boys-growing-up-together with an un- tacky charm. The Fly, too, is a mutation rending pathos. Indeed, the director’s wavering, dry-eyed vision worthy of Jean of a campy ’50s shocker, but it merely idiosyncratic talent seems to thrive on Renoir. borrows the central conceit of the origin- this lean, taut tale. Cronenberg’s forced al as a metaphor for a much more pro- Four kids set off on a two-day odyssey found emotional issue. to follow Brundle’s inexorable decline, through the northwestern wilderness. They are ostensibly seeking the corpse Seth Brundle (Goldblum) is a nerdy and he brings a heretofore unseen emo- of a school chum, but self-discovery is physicist trying to develop a matter their real business. The setting, theme, transmitter. He falls in love with Ver- tional depth to the tale. and human McGuffin suggest Blue Vel- onica (Davis), a journalist following his The Fly also reveals new depth to vet, but Reiner has more on his agenda work, and one night, in a fit of drunken than mere titillation. jealousy, acts as a guinea pig for his own Goldblum, whose character transforms machine. After a fly gets trapped in the from a shy, self-deprecating whiz kid to The flashed-back narrative is seen an arrogant superman to, well, an insect. through the eyes of Gordie (Wheaton), For key to headings, see Legend on first Nonetheless, he remains sympathetic an aspiring writer. Balancing and cor- page of Directory section. rupting his white-collar attitude is Chris even as his flesh peels off. Davis’ per- (Phoenix), an aspiring hood. Comic relief formance is equally affecting, as she’s comes from the other half of the equa- tion: the self-destructive Teddy (Feld- torn between her love for Brundle and man) and the reviled fat kid, Vern her fear of the fly. Their scenes together (O’Connell). Balancing the lot of ’em is a pulse with emotional and sexual chem- crew of older hoods who race them to the istry. body. Reiner arranges the two age eSHHESHESEPPeeEHSEoEPHEeEEeePSOEEdEeEHe geSEreHoeEuEpeseeisneebeunecsheesseeeof four; the script fur- The Fly’s achievement is in pressing ther underlines the connection by having eePerereeesrtshseeensoe-sheoeledss-ebraersreeedsesmeaeyeheeemes charac- April 1987 Video 71

them share period slang. the book to follow the action (though a needed to seal their doom. What happens Like a good TV child in the promised brief rewind now and then might help). after the break-up conveys the moral land, Reiner composes in the center of The production is mournfully beautiful; that maybe the grass isn’t always greener. the screen, so his character quartets re- the dour abbey and its gargoyle-like in- “About last night...” presents both main unhampered by scanning problems. habitants are realized with the same male and female perspectives on the ro- mance, without taking cinematic sides. The adaptation of Stephen King’s novel- muck-and-mire intensity Annaud (The collaborative screenplay by Tim Kazurinsky and Denise DeClue may la, The Body, blows it only in the denoue- brought to the Neanderthal rat packs of have something to do with that balance.) ment, when a grown-up Gordie (Richard 1981’s Quest for Fire. Nonetheless, she shows far more love, Dreyfuss) sentimentalizes about boy- eeeSe eeEeT This sly genre-buster is well worth a strength, and generosity than he does; the conclusion that he’s the emotional hood friendships. But until the last min- look. Even for non-medievalists, it’s a failure is inescapable. The movie runs ute, Stand by Me transcends the guys-to- pleasure to watch the underrated Conn- gether genre with grace and humor. ery pile it on in a meaty non-Bond role, —Mark Fleischmann the best he’s had since Robin and Ma- rian. —Stan Pinkwas long, but there’s nothing patently extra- 1986. Sean Connery, F. Murray Abra- neous included, and the detailed rise- ham, Michael Lonsdale; dir. Jean- 1986. Rob Lowe, Demi Moore, Jim Be- and-fall account would have suffered Jacques Annaud. 131m. (R) Hi St cc eereeerrreesleuesshei,sceElizabeth Perkins; dir. Edward from cutting. Throughout, the dialogue is Zwick. 113m. (R) Hi St $79.95. $79.95. LV $34.95. Embassy. Image: ex- sharp, vulgar, and realistic without being RCA/Columbia. Image: good. cel. overly flip or jokey. Anyone expecting In attempting the impossible, director Warning: although it’s well worth see- the purity of Romeo and Juliet may be Jean-Jacques Annaud achieved the im- ing, don’t pop this in the VCR on a first quite upset by this meta-romance; those familiar with the urban dating ritual may, weeceececce probable: a compelling film version of date. Watching two cultural stereo- Umberto Eco’s magical mystery tour de types—Danny (Lowe) and Debbie for entirely different reasons, find them- force through the tribal battlements of (Moore)—grapple with the hazards of selves far more uncomfortable. medieval Catholicism. Connery plays modern mating (sex first, thought sec- eresswmeeesereerreseeresseeceseeeeseseesese—sIersaeseReoebbeienss William of Baskerville, a Franciscan ond, commitment never) would be a ma- monk asked to solve a series of deaths in jor downer. A social commentary in a brooding abbey with a labyrinthine lib- the guise of an offbeat love story, the 1986. Kurt Russell, Kim Cattrall, Den- rary of forbidden books. The deductive film’s shallow, narcissistic characters William must overcome superstitious seem depressingly believable; while the nis Dun, James Hong; dir. John Carpen- monks and papal intrigues to discover the screenplay rarely misses a cliche, unfor- ter. 99m. (PG-13) Hi St ss $79.98. CBS/ killer and his genuinely bizarre motive. tunately, neither do real people. Fox. Image: good. In streamlining the story for film, An- eeoreeeeseeeseeeTsheeeseesetsructure—based on David What can you say about a kung-fu com- naud ditches Eco’s discourses on 14th- Mamet’s play, Sexual Perversity in Chi- edy that pays cheeky homage to John century liturgy, theology, sectarianism, eoeeceacge o—is traditional boy-meets-girl, up- Wayne, comic books, and the films of dated into hollow singles-bar style. Howard Hawks? The hip, funny romp pharmacology, architecture, and other Through the medium of casual sex, two eeerebeeegeienes “on a dark and stormy night,” as recondite themes. Instead, F. Murray trucker Jack Burton (Russell) puts pedal Abraham stages an inquisition and a young Chicagoans discover to their sur- hearty bonfire for three would-be devils. prise that they actually like each other, to the metal hauling hogs from Sacra- mento to San Francisco. After he wins a eoececcece and endure the resentment of their re- But the film has surprising strengths, spective best friends to strike up a Mean- grand from a young restaurateur, Wang including shrewd detection, a Piranesian Chi (Dun), in an all-night Chinese domi- maze, and a script unafraid to retain ex- ingful Relationship. (Jim Belushi, fast be- changes—like a debate over the proprie- coming an indispensable sidekick, is ex- noes game, Burton finds himself involved ty of the Vatican’s wealth—a shallower cellent as Danny’s unregenerate pig bud- in a search for Wang’s kidnapped fiancee version would have dodged. Moreover, dy, Bernie.) The course of true love is in the underground caverns of the city’s unlike Dune, viewers need not have read eoereoecksyc,oeasnsdcemcoeving in together is all that’s Chinatown. Finding her is not as simple as tromp- ing around in basements and storm sew- ers, though. The underground empire is presided over by 2000-year-old David Lo Pan (Hong), who must marry and taste the blood of a green-eyed maiden to re- turn to life from the ethereal form he now inhabits. At Lo Pan’s beck and call is a virtual army of martial arts specialists, including a mystical trio, each of whom possesses certain supernatural powers. Okay, so this is a screwy film. But it’s enormous fun! The sets and costumes are exotic. The outrageous kung-foolish- ness is nonstop, and the special effects by Richard Edlund (Ghostbusters) are top-shelf. Best of all, Russell’s role is a real treat. Burton’s a swaggering blow- ie hard who’s seen too many John Wayne movies. He may think he’s in control of Sean Connery (right) is the medieval sleuth in ‘Name of the Rose.’ 72 Video April 1987

every situation, but is no match for Lo MY BEAUTIFUL only at the expense of tradition and family Pan’s power. We haven't heard dialogue LAUNDRETTE stability. Likewise, the success of the laundrette alienates Omar from his fa- as richly goofy as Burton’s since the 1985. Gordon Warnecke, Daniel Day ther, who wishes he were in college. Meanwhile, Johnny’s former gang—a Duke died. Lewts, Saeed Jaffrey; dir. Stephen Frears. group of skinheads who hover in the 93m. (R) cc $79.95. Karl-Lorimar. Im- background throughout the film—tries to Director John Carpenter—best known tear down what the two unlikely lovers age: good. have accomplished. As in life, their ulti- for the Halloween series and fantasies mate destiny remains unknown. Possibly the best film released in the like Escape from New York and The —Richard Gehr United States in 1986, My Beautiful Thing—doesn’'t always hit his mark, but Laundrette is certainly the finest film ev- THE TEXAS CHAINSAW er made about a homosexual Pakistani’s does take risks and work unconventional bid for upward mobility in contemporary MASSACRE, PART 2 Great Britain. Stephen Frears, working 1986. Dennis Hopper, Jim Siedow, Caro- genres. Big Trouble in Little China may line Williams; dir. Tobe Hooper. 101m. from a brilliant script by young Hanif eeeeeHeiseSetscccccscse$79.95. Media. Image: good. not have been the hit he has been looking Tobe Hooper shocked the world in for, but itis certainly a successful piece of 1974 with his low-budget horror classic, The Texas Chainsaw Massacre, a taste- filmmaking. —Timothy Onosko less tale of an insane family of mass mur- derers. A dozen years later, it virtually Kureishi, has constructed a film that defines most people’s idea of an exploita- tion film. That its reputation has only RUTHLESS PEOPLE manages to be deeply serious, funny, grown over the last decade was more emotional, and politically savvy all at the 1986. Danny DeVito, Judge Reinhold, than enough reason for Hooper to essay Helen Slater, Bette Midler; dir. Jim Abra- same time. a sequel. hams, David Zucker, Jerry Zucker. 94m. Omar (Warnecke) is the son of a eiiy e The Texas Chainsaw Massacre 2, (R) $79.95. Touchstone. Image: good. though, seems more like a remake, with eeeceficrcssts-cgcesneersation Pakistani immigrant, an Hooper expanding on the elements of the Disney has finally found a way to move alcoholic socialist whose British experi- original that made it a cult classic and ence has left him an impotent, bedridden discarding the weak points. Fewer vic- into the ’80s while still holding onto the cynic. (“The working class is sucha great tims (the family kills only three people) disappointment to me.”) Omar is taken allow Hooper to spend more time on the sunny view of life. Title and most of its comedic relationship between Chop- plot notwithstanding, Ruthless People is under the wing of his unabashedly capi- Top, Leatherface, and their father. Dad, about how nice guys don’t always finish talist uncle (Jaffrey), a good-hearted en- it turns out, is a cook who needs the flesh last. The stylish opening credits set the eeeeeeetrepreneur who wants to teach his neph- to make his prize-winning chili. Chop- ew how to “squeeze the teats” of the Top (the hitchhiker hit by a truck at the tone—people in this movie treat each end of ‘Saw 1) is a Vietnam vet who has a other like garbage, but manage to remain system. To this end, he charges Omar steel plate in his head and screams “Ho cute. with the resuscitation of a dumpy laun- drette, which Omar accomplishes assist- This vicious comedy of errors is chock ed by his lover, Johnny (Lewis), a tough, full of plot twists—so many, in fact, that cautious, lower-class youth (with previ- it’s hard to sort them out afterward. De- ous fascist inclinations) who discovers that working for “Pakis” beats standing Vito plays Sam Stone, a self-made and self-centered millionaire who wants to ee in dole lines. kill his wife Barbara (Midler) for her mil- Unlike Omar’s father, the uncle has lions. On the day he plans to do the deed, cosleearned to manipulate his environment however, she’s kidnapped by Kenny and through a combination of hard work and Sandy Kessler (Reinhold and Slater), the help of a drug-running business asso- whose fashion ideas he stole. The situa- tion escalates as Sam tries to get Barbara ciate. His success, however, has come killed by her kidnappers, not knowing that the Kesslers are so mild-mannered Chi Minh!” as he kills people. And Leath- they won’t even eat meat. When the po- erface becomes a case study of lice believe Sam has killed his wife, he psycho-sexual confusion. (“Sex or the tries to pay the ransom and get her back. saw,” snarls Dad. “Sex nobody knows, Too late! She’s joined forces with the ae) but tehe saw is family!”’) Kesslers, and the trio winds up with ‘Saw 2 also features a reprise of the Sam’s fortune plus some major revenge. eeeeee ee notorious dinner scene. Hooper doesn’t The situations are consistently funny, do anything new with that gag; indeed, and the pace even, allowing just enough it’s almost identical, with only different time for each twist to sink in before mov- camera angles and a more expensive set ing on. The plot unfolds almost geometri- (which, incidentally, looks awfully similar cally, as everything fits together perfect- eyeto ethe cavern in Hooper’s Invaders from ly with no wasted effort. Only the four Mars). The capper is a chainsaw duel main characters are defined well enough between the year’s two scariest movie to understand their motives at all. monsters—Leatherface and Dennis DeVito’s vulgar Sam Stone is not ap- Hopper, playing a fire-and-brim- preciably better than any of his other stone-spouting ranger—that’s worth the recent roles, and certainly not the equal price of admission. of his part in Head Office. Midler is a shrill This worthy successor matches the and funny (not to mention muscular) cari- original’s breathless pace, joyful cature of a spoiled heiress. The unsung tastelessness, and morbid humor, but hero of Ruthless People, though, is doesn’t up the ante for disgusto splatter Reinhold, whose efforts to be tough the way its predecessor did. ‘Saw 2 is a make Midler and DeVito seem all the lively and funny, if superfluous, coda to more horrifyingly funny. Daniel Day Lewis (I) and Gorden Warnecke (r) one of the most terrifying movies in film —Adam Philips in front of their ‘Beautiful Laundrette.’ history. —Louis Kesten April 1987 Video 73

out of retirement in a Florida beach THE STORY house with his wife and son to join the OF THE investigation. The premise is quite plau- sible. Graham interviews the incarcerat- WIL ele) ed psycho slasher-doctor whom he ; VENGEANCE caught a few years earlier to try and get into the head of a man who has ritually EVER slaughtered two families when the full moon appears. The problem with Mann’s movie, however, is not in his screenplay (taut), but in his direction (TV-quick), which de- pends too much on slick camera angles and thumping disco beats to move the narrative along. Had he told this same story in 80 minutes instead of 120, it might have been much better. Once you suspend the usual amount of TV disbelief—such as how the killer has a drop-dead architect-designed house on a (I-can’t-give-away-his-occupation)’s salary, how many cops and agents are involved in the case, and a few geograph- ical incongruities—it’s pretty service- TOUCH OF EVIL sympathetic; Touch of Evil reveals how able. Hey, thriller buffs, I give it an 80; 1958. B&W. Charlton Heston, Janet easily we can compromise our sense of you can dance to this baby. Leigh, Orson Welles, Akim Tamuiroff; justice in the face of our desire for re- —Doug Garr wr./dir. Welles. 108m. Hi $29.95. MCA. venge. TOP GUN Image: good. MCA is to be commended for bringing The last film Orson Welles made for a out the “long” version of the film. As with 1986. Tom Cruise, Kelly McGillis, Val Hollywood studio, Touch of Evil, stands Kilmer, Anthony Edwards, Tom Skerritt; not only as evidence of his genius for all of Welles’ Hollywood films, the end dir. Tony Scott. 109m. HiStss cc $26.95. making cinematic silk from the sows’ result is not entirely his, but this cut most ears of pulp literature, but of the tragic nearly expresses his intentions. What is Paramount. Image: excel. galling, however, is that this great film is When directors make propaganda to loss Hollywood was to Welles and vice coming out under the rubric of Gene Sha- agitate audiences into political action, it’s versa. Outside California, Welles was lit. He may be “America’s most beloved” called agit-prop. Top Gun, on the other never able to achieve the seamless pro- movie critic, but his ridiculous notes on hand, is gadget-prop, a breathtaking duction values apparent in even those blend of multi-million-dollar military the film, to say nothing of his face on the works most butchered by the studios. package, diminish this work of art. It is hardware, handsome flyboys, and patri- While its somewhat jumpy narrative not an easy film, and Shalit’s attempts to otic zest. The biggest money-maker of style was considered radical at the time make it so do neither the audience nor 1986, Top Gun is as slick as its stars’ of Evil’s first release, Welles’ relentless- Welles the justice central to Touch of haircuts. ly-paced, brilliantly confrontational direc- Evil's conception and design. Tom Cruise is Maverick, a crackerjack tion has informed every suspenser since, —M. George Stevenson flier sent to the Navy’s Fighter Weapons from Psycho to Miami Vice. A politically School (a.k.a. Top Gun). He’s cocky, and morally ambiguous tale of police cor- MANHUNTER clever, and drop-dead sexy, but suffers 1986. William Petersen, Dennis Farina, from a casual disregard for the Navy’s ruption in a town on the Mexican border, Kim Greist, Tom Noonan; wr./dir. Mi- airplanes and a tendency to place lives in Touch of Evil pits a high-level Mexican jeopardy. law enforcement official, Miguel “Mike” chael Mann. 120m. (R) St cc $79.95. Maverick’s emotional misfires play Vargas (Heston), against both the Karl-Lorimar. Image: excel. Grande crime family and Captain Hank Manhunter resembles something be- right into the hands of his ambitious rival, the steely Iceman (Kilmer). The compe- Quinlan (Welles) of the town’s police tween a Clint Eastwood cop flick and a tition to be top cat at Top Gun comes force. Ostensibly investigating a car- down to a battle of the wills and skills bomb murder, Vargas and Quinlan clash, decent Hitchcock thriller. No, let me between Iceman and Maverick, who ulti- personally and professionally, with Var- start over. It’s a cross between Crime Story and Miami Vice, only twice as long as either TV show, and a tad better than mately goes down in flames. gas upholding the rights of the accused their usual episodes. Feature-length Mi- Fortunately, an unnamed superpower and Quinlan a menacing figure of retribu- (hint: they fly MIGs) threatens to blow tion against those his “intuition” tells him chael Mann cinema isn’t all that bad, pre- cisely because he knows the 80s TV up a disabled ship that has floated into are guilty. formula (Crime Story and Vice are dis- enemy territory, and Maverick gets his In addition to style, what gives Touch second chance. In the movie’s best mo- of Evil its critical stature is the psycho- tinctly his): MTV, architectonica, wide- logical depth of Quinlan’s treatment and angle lenses, pastel costuming, one-day ments, the enemy, clad in smoky Darth the portrayal of the web of loyalty and growth, and the generous use of the Vader helmets, engages our boys in a circumstance that allows him to operate. word “pal.” spectacular fight to the death. Maverick So-called high ideals have blinded those What’s going down here is FBI agent pulls some of his stunts, and world peace around Quinlan to his moral bankruptcy. Will Graham’s pursuit of a crazed serial is secured, but not before an extended It’s uncomfortable to find the corrupt killer.0668adeSTuObsdoeol)'1L:i0e6(1'.00ap.ilbl©NSeeS9bRNs¥c6i.S5eb0s6'Di0bt/')!eM:le0Sane%060ea.i'.0a060l\\e0 An old associate coaxes Graham sequencee0ScOIwraoAbsCSWehT6ceepesroel'inOSyOrit1'aigeyioCYhe©rle,'om'6eo8shseEAOiAecterCmRtiE9e,lEbeswo0OepAb:/EesAiar8eecRsLcree'eTrelEieeSeaYv\\ieansee of beautifully shot, crisply 74 Video April 1987

edited dogfights. who care more about their families than aration with playboy Cary Grant, a va- Top Gun’s glossy action sequences global ideologies. grants’ tour of the South with her young and high-gear soundtrack are lots of fun, In the crosshairs are grisly depictions maybe even for liberals. This is a peculiar son, renewed stardom in Europe, and of contra atrocities: murder of civilian film, however. One of the flyboys keeps farmers, bombing of villages, rape, a nausea-provoking marital reunion. claiming to be sexually aroused by air- shanghaiing of “recruits.” Whatever planes, and if Top Gun’s commercial suc- your political stance, this dramatization What matters is not the sentimental jour- of like-it-or-not facts about the so-called cess is any indication, he may be onto ney but the snapshots Sternberg takes something. The film is certainly enthral- freedom fighters is troubling and loath- led with fighter planes, but it’s equally in some. I mean that in a positive sense. along the way: Dietrich as a bathing Ve- love with fighter pilots: Cruise, Ed- —Frank Lovece nus, destitute in cheap hotels and flop- houses full of threatening shadows, tak- ing a bucolic hayride. Her musical numbers explore a bizarre wards, Kilmer, and a host of other young fantasy terrain somewhere between cin- actors bask in a bronze haze throughout ema and cabaret, clothed in a gorilla suit the movie, as if their suntanned phy- siques were the source of light itself. 1932. B&W. Marlene Dietrich, Herbert one moment and a white tux the next. Marshall, Cary Grant, Dickie Moore; This passion for beefcake might help The infamous “Hot Voodoo” number has explain the film’s popularity with a lot of dir. Josef von Sternberg. 89m. $29.95. MCA. Image: good. her crooning, “The beat gives me a wick- ed sensation/My conscience wants to women and no small number of men. To take a vacation.” The plot trades on Diet- keep the male eroticism from getting out 1930. B&W. Dietrich, Gary Cooper, rich’s femme fatalism of course, but even Adolphe Menjou; dir. von Sternberg. of hand, though, director Scott and writ- 92m. $19.95. Kartes/MCA. Image: fair. that is only an excuse for Sternberg’s ers Jim Cash and Jack Epps Jr. include a Just when the Rambo displays were photo essay. The pictures don’t tell the female romantic interest for Cruise. coming down in your local video store and you thought it might be safe to go in story; the story frames and charges the Unfortunately, Kelly McGillis is treat- again—this. TV movie reviewer Gene Shalit has selected five old-time classics pictures. ed with an offhand contempt that neither to be decorated with his imprimatur for video release. Among the celluloid vic- The tape throws an extra layer of the actress nor her character deserves. tims of this mixed blessing is Blonde Ve- “Charlie” is a trained instructor with a nus, a fascinating if problematic speci- gauze over Sternberg’s lens and darkens Ph.D, yet whenever she gets within ten men of the great collaboration between slightly at scene transitions. The source feet of the irresistible Maverick, she be- Marlene Dietrich and Josef von Stern- comes a breathless, horny simp. Scott is clean and free of glaringly missing can’t reconcile women and male bonding, berg, a director who once said, “I care so he simply makes McGillis disappear nothing about the story, only how it is frames, which is amazing after 54 years. three-quarters of the way through the photographed and presented.” His florid The bathing scene, often absent from film. It’s a jolt when she shows up again vision—alternating romantic soft focus with expressionist shadow—is what broadcast prints, is uncut. for the obligatory clinch; nobody, not For a double feature consider Moroc- even Maverick, seems to have missed her. —Ed Sikov co. Dizzyingly improbable grand ges- tures punctuate this story of a romantic triad: Cooper, as Marlene’s French Le- eeESHmECEOESESHeEEHSeoEOSHRESEESHeOSmHESEESEeEEEEgSionnaire beau, is a charmless lout, but Menjou’s continental elan compen- sates. For their first American feature, makes Blonde Venus worth seeing. Sternberg endowed Dietrich with a re- The opening credits flash over a daring strained Garbo-like elegance barely hint- 1985. Robert Beltran, Annette Cardon- sequence in which indistinctly-clad bath- ing at the flamboyance that would reach na, Tony Plana, Luiz Torrentes; wr./dr. ing beauties frolic in a Black Forest lake eitsezenith with The Scarlet Empress. Haskell Wexler. 108m. Hi cc $79.98. and Dietrich meets young scientist Her- Kartes’ transfer looks adequate but CBS/Fox. Image: good. bert Marshall. The circuitous scenario would have benefitted from greater at- Contra-diction: with the financial back- takes Dietrich through married life in tention to the soundtrack. ing of all-American capitalist George Lu- New York, stardom, romance and sep- eeccecscce —Mark Fleischmann cas, Oscar-winning cinematographer Haskell Wexler (Bound for Glory, One Flew Over the Cuckoo’s Nest) has added to his string of self-directed small films critical of U.S. government policy. Ironi- cally, his drama of a conscience- stricken American military advisor in Honduras and Nicaragua seems right in line with the public’s wary mood regard- ing the U.S. role there. Latino almost boils over with grainy, documentary-style camerawork, au- thentic locations, and unsubtle compari- sons between the U.S.-backed contra war and Viet Nam—all of which initially suggest that the film is less fiction than political statement. But while Wexler’s sympathies are obviously not with the contras, neither are they with Nicara- gua’s Sandinista government. His heart and mind stay instead with the ordinary people who must live with the war, and HESESEHSEPEeoESoeEOTSEHEEOHEESHESHESOHSEEHSEEPEEEHEESESSEEHS April 1987 Video 75

NEW RELEASES ON TAPE AND DISC SHOSOSHSHSSESSSSSHSSEHSHHSSSEHSHSHHESHSHEHHEESE harvest. 101m. (R) B Hi V $79.95. by cannibal tribe. 98m. $69.95. with computer-enchanced memo- New World. Lightning. ry. 97m. Hi $39.95. MCA. Archer's Adventure. 1985. Brett Dawn of Victory. 1972. Lakis Kom- Mr. Mean. 1986. Fred Williamson; Vulcan God of Fire. Yr. n.a. Rob Como. Apprentice rides 600 miles ninos, Miranda Counelaki. Com- dir. Williamson. Mafia leaders Flash, Gordon Mitchell. Jupiter across Australia to enter horse in mando team attacks Nazi airbase in want their ace hit man dead. 90m. convenes tournament competition competition. 120m. B Hi V $69.95. Crete. 95m. (PG) $39.95. Adven- (R) $79.95. Magnum. to win hand of Venus. 76m. New World. ture. Ninja Thunderbolt. 1985. Richard $59.95. TWE. Armed Response. 1986. Lee Van Cleef, David Carradine. Vet and Doomed to Die. 1940. B&W. Boris Harrison. Martial arts: warrior Wagonmaster. 1950. B&W. Ben son seek revenge from mob. 86m. (R) $79.95. RCA/Columbia. Karloff, Marjorie Reynolds. Ship- foils theft of mystical jade horse. Johnson, Harry Carey Jr., Ward board mystery with Karloff as Ori- Avenging Force. 1986. Michael 92m. $59.95. TWE. ° Bond; dir. John Ford. Mormon Dudikoff. Retired CIA man takes ental detective James Lee Wong. . on terrorists who killed his friend. 69m. $29.95. Images. . wagon train en route to Utah at- 104m. (R) $79.95. Media. . The Ultimate Impostor. 1978. Jos- :. tacked by Indians. 85m. $19.95. The Big Sky. 1952. Kirk Douglas, Arthur Hunnicut; dir. Howard Earth. 1930. B&W. Wr./dir. Alex- eph Hacker, Keith Andes. Spy ° Fox. Hawks. Frontiersmen journey up . Missouri River into hostile territo- ry. 122m. $19.95. (RE) Fox. ander Dovzhenko. Acclaimed Rus- PROGRAMMING LEGEND sian feature: Ukrainian landowner Black Lemons. Yr. n.a. Antonio refuses to surrender property for Sabato, Peter Carsten. Mafia tar- gets convict for assasination. communal farm. Silent with DATE IMAGE QUALITY 93m. $59.95. Unicorn. orchestrial score. 88m. $29.95. Varies according to type of Images. For theatrical releases, this Blade in Hong Kong. 1985. Terry program. Films: original theat- rating refers to the transfer quali- Lester, Leslie Nielsen, Anthony Enforcer from Death Row. 1978. rical release. Made-for-broad- Newley. Failed TV pilot: investiga- Cameron Mitchell, Leo Fong. cast: first telecast. Made-for- ty and overall visual appearance. tor on trail of assassins. 94m. Price Martial arts: agent infiltrates spy nia, VOL: eccecweseeeerceeerieneg.se8s7em.eee$6e9s.e95s.eeLeisghetsnsinsge.eeses video: first release in any for- For non-theatrical programs, it mat. Compilations: production refers to overall visual quality. Bullies. 1986. Janet Laine Green, Game for Vultures. 1980. Richard of collected work. Dehl Berti. Mountain clan ter- Harris, Joan Collins, Ray Milland. excel.: exceptionally attrac- rorizes new family in town. 96m. tive and/or faithful to (R) Hi cc $79.95. MCA. the original Challenge. 1976. Earl Owensby. Cynical financier clashes with free- FORMATeereeweeeeeereeseseeeeeseseeeeesesseseseseseee good: adequate but Candidate’s anti-crime stance dom fighter. 113m. (R) $79.95. makes him unpopular with mob. All programs are available in unremarkable 90m. (PG-13) $59.95. Continen- TWE. tal. Beta and VHS unless noted. All fair: passable, but below The Cheaters. 1976. Dale Hadden. Golden Exterminators. Yr. n.a. | programs on disc are also avail- average. Gambler on spree with girl he won from boss’ son. 91m. (R) $59.95. Raymond Chan. Martial arts: bro- | able on tape unless noted. The poor: seriously flawed Prism. thers invade enemy strong- following abbreviations apply: ETCETERA Codename: Wild Geese. 1984. Er- hold. 86m. $39.95. Unicorn. B: Beta videocassette nest Borgnine, Lee Van Cleef, Official MPAA ratings (G, PG, Klaus Kinski. Commando group The Human Factor. 1975. George V: VHS videocassette PG-13, R, X) are provided when dispatched by Drug Enforcement Kennedy, John Mills. Computer available. All programs are in Administration to wipe out opium 8: 8mm videocassette expert tracks terrorists who killed LV: LaserVision videodisc, color unless noted. List prices his family. 96m. (R) $39.95. Ad- are not given for CED discs. | in either in CLV or venture. | CAV playing format. CED: CED videodisc anim.: animated Instant Justice. 1986. Michael B&W: black & white Pare, Tawny Kitaen. Marine jour- AUDIO FEATURES cas.: videocassette neys to Madrid to wipe out drug All available audio information comp.: compilation dealers responsible for sister’s ezd.: colorized death. 101m. (R) Hiss cc $79.95. is provided. Dolby noise reduc- dir.: directed by Warner. tion, which is used on virtually all VHS tapes, is not noted. The m.: minutes Jaguar Lives! 1979. Joe Lewis, following abbreviations apply: Christopher Lee, Barbara Bach. TTTT eSt: stereeo n.a.: not available Martial arts: cleanup of world’s nar.: narrated by drug capitals. 91m. (PG) $79.95. Hi: Hi-Fi pr.: produced by TWE. ss: Dolby surround stereo RE: reissue sub.: subtitled Massacre in Dinosaur Valley. cc: closed-captioned wr.: written by 1985. Michael Sopkiw, Suzanne CX: CX encoded Editors’ choices in the Directory are highlighted with red titles. escrePeecerreceercescCracercvscaelrl.essAemsaezSoeneesexepseedsietrioenerheavletoedseseeeooeeesrerreesccscrese 76 Video April 1987

You’re Jinxed, Friend, You’ve Met Johnny Shiloh. 1963. Brian Keith, LABELS FOR LESS Sacramento. 1970. Ty Hardin, Christian Hay. Cowboy’s travels. Kevin Corcoran. Drummer boy proves invaluable member of Un- 99m. $49.95. Unicorn. ion battalion. 90m. Hi $69.95. Dis- Special promotions and other pricing news ney. Kids’n’Crafts Vols. 1-9. 1987. In- @ CBS/Fox reduces a prime selection of 60 feature films to struction by Julie Abowitt: Fun $29.98 each in the “Five Star Collection III” promotion. with Clay, Make a Puppet, Paper Titles include Star Wars, Coming Home, Raging Bull, Exodus, Play, Egg Art, New Ideas: Crayons Norma Rae, 42nd Street, Zorba the Greek, Fiddler on the Roof, and Paints, Make a Print, Easy The French Lieutenant's Woman, The Good, The Bad and the Child of Glass. 1978. Barbara Bar- Bread Dough Sculpture, Paint Ugly, Marty, Elmer Gantry, The Verdict, The Pink Panther, rie, Anthony Zerbe. Ghost im- Without a Brush, Dip & Tie Dye. The Pink Panther Strikes Again, Mildred Pierce, A Thousand plores mansion’s residents to find 60m. ea. $14.95 ea. Morris. Clowns, Witness for the Prosecution, Inherit the Wind, Being his killer. 93m. Hi $69.95. Disney. There, From Russia with Love, The Man with the Golden Gun, King Solomon’s Mines. 1986 anim. Thunderball, and You Only Live Twice. A new batch of titles The Fabulous Fleischer Folio Vol. Big game hunter searches Africa 6. 1987 comp. anim. Color/B&W. for missing man. 60m. $19.95. will replace this one after April 30, although many stores may Car-Tune Portrait (’36), Barnyard Lightning. carry stock longer. Brat (39), King for a Day (40), 3 more. 41m. $49.95. Disney. rseeererereeesseeeeeseeeee @ Purchase any $14.95 title in HBO/Cannon’s “Children’s Matinee Series” and you're entitled to a $1 mail-in rebate, with Five Mile Creek Vol. 15. 1984. Little Women: Jo’s Boyfriend. a special coupon from People magazine or one of nine children’s Louise Caire Clark, Rod Mullinar. 1987. anim. Original stories featur- publications. The “Matinee” lineup includes all available vol- ing characters from Louisa May Alcott books. 30m. Hi St $14.95. Sony. Two episodes of series set in Aus- Mighty Orbots: The Dremloks. umes of Fraggle Rock, Paddington Bear, and Dangermouse. tralian pioneer community. 95m. 1987. anim. Characters based on Hi $49.95. Disney. popular toy line. $14.95. Viddy- @ Karl-Lorimar has repriced the award-winning children’s Oh! cassette Animal Alphabet to $14.95. ABC Fun Fit with Mary HBTV Music Videos. 1986. anim. Lou Retton trims down to $19.95. Clips of Hanna-Barbera cartoon Mighty Orbots: Trapped on the Pre- characters set to recordings by Di- historic Planet. 1987. anim. ®@ Unicorn Video lets you laugh all the way to the bank. ana Ross, Elvis Presley, others. $14.95. Viddy-Oh! They've slashed all eight volumes of the Your Show of Shows Four cas.: Old Time Rock & Roll, compilation series from $39.95 to $19.95 apiece. Top Rock, Rock ’n’ Soul, Country Mosby’s Marauders. 1966. Nick Rock. 30m. ea. $14.95 ea. World- Adams, Kurt Russell, Peggy Lip- @ Media discounts a group of feature films to $19.95 apiece vision. ton. Boyhood friends find them- in the “Family Film Series.” They include The Prince and the selves on opposite sides of Civil Pauper (77 version), TheAmazinMgr. Blunden, Dusty, Kavik The Hubley Studios Vols. 4-6. War. 79m. Hi $69.95. Disney. the Wolf Dog, and four others. 1987. comps. anim. Dir. John and Faith Hubley. Vol. 4: A Delicate The Peanut Butter Solution. 1985. @ Fox Hills Video adds five vintage Hollywood flicks to its Thread (60-76). Vol. 5: Urban- Boy explores deserted mansion in- scape (’57-'66). Vol. 6: OfStars and habited by spirits. 96m. (PG) B Hi catalogue of $19.95 titles: Macao, My Forbidden Past, Men (’62). Approx. 50m. ea. eeesrerereeeeeresrVeeeee$ee7e9e.9e5e.e New World. Wagonmaster, They Won't Believe Me, and The Ex-Mrs. Brad- $49.95 ea. Disney. Return to Treasure Island Vols. 1- ford, all listed in this month’s Directory. —Steve Daly Inhumanoids |l—Earth’s Darkest 3. 1985.’ Brian Blessed, Christo- Hour. 1986. anim. Scientists stave pher Guard. Serialized sequel to age reading. 30m. ea. $12.95 ea. Loy, Shirley Temple. Woman off alien attack. 45m. $12.95. Hi- Robert Louis Stevenson tale; 2 ep- Hi-Tops. judge tries breaking sister’s crush Tops. isodes per cas. Approx. 105m. ea. on playboy by keeping them to- Jeremy Around the World. 1987. Hi St $49.95 ea. Disney. SuperTed Vol. 6: SuperTed’s Glob- gether constantly. 82m. $19.95. anim. Journey to save kidnapped SESHHSePEmmEHeESEoeEeESEmeDSHHeESEEDaHlE Adventures. 1985. anim. Teddy (RE) Fox. friend. 90m. Hi $29.95. Sony. Storybook Series Vols. 1-4. 1987. Live action/anim. Host Hayley bear crimefighter faces trio of vil- Bachelor Mother. 1939. B&W. HBTV Music Videos Mills; voices of Mickey Rooney, lians. 48m. $49.95. Disney. Ginger Rogers, David Niven. reeo eeerrJeoehrneeeCaersreasdeisne, Michael York. Salesgirl finds abandoned baby. Morality tales designed to encour- The Transformers—The Movie. 82m. $19.95. (RE) Fox. 1986. anim. Voices of Leonard Nimoy, Robert Stack, Orson Wel- The Beachcomber. 1938. B&W. les.- Tie-in with line of robot toys. 86m. Hi ss $79.95. Family. Charles Laughton, Elsa Lanches- Tranzor Z: Devieen and Decapito ter. Drifter on tropical island in Duel. 1987. anim. Rival robot in- love with missionary’s prim sister. ventors. 60m. Hi $19.95. Sony. 87m. $29.95. Images. The Cheerleaders. 1972. Stepha- nie Fondue. High school football team’s amorous pep squad. 84m. (R) $79.95. Prism. All Over Town. 1937. B&W. Ole The Ex-Mrs. Bradford. 1936. Olson, Franklin Pangborn, Chic B&W. William Powell, Jean Ar- Johnson. Vaudeville team’s trained thur. Surgeon accused of murder seal act saves theatre. 53m. turns detective in an attempt to seeewreeeeeverer$ee2es4.e9s5e. seIemaegseess.eeeeeeeeeeeees prove his innocence. 81m. $19.95. Fox. The Bachelor and the Bobby-Soxer. 1947. B&W. Cary Grant, Myrna Girl-Toy. 1984. Gerry Sont, Lenita Psillakis. Young man kidnapped by erotic cult. 86m. $59.95. Light- ning. April 1987 Video 77

Laurel and Hardy Comedy Classics noted for unorthodox methods. Androcles and the Lion. 1952. Ecstasy. 1933. B&W. Hedy Vol. 7. 1987 comp. B&W. Short 108m. (R) Hiss cc $79.95. MGM/ B&W. Jean Simmons, Alan Young, Lamarr. Young bride bored with subjects: Below Zero (’30), Thicker UA. Victor Mature. Adaptation of Shaw middle-aged husband. Dubbed. Than Water ('24), Midnight Patrol play: lion spares man who once 68m. $29.95. Images. (33), Me and My Pal (’33). 80m. Ruthless People. 1986. Danny De- pulled thorn from his paw. 105m. $19.95. (RE) Fox. Vito, Bette Midler, Judge Hi $39.95. Embassy. The Emperor Jones/Paul Robeson: Reinhold. Kidnapped woman helps Tribute to an Artist. 1933/1979. Love at First Sight. 1978. Dan Ayk- kidnappers extort money from her Annie Oakley. 1935. B&W. Barba- B&W/Color. Film adaptation of royd, Mary Ann McDonald. Ro- unfaithful husband. 93m. (R) Hi ss ra Stanwyck, Preston Foster, O'Neill play starring Robeson, plus mantic spoof with Aykroyd as blind $79.95. Touchstone. Melvyn Douglas. Hollywood bio of award-winning documentary de- china shop clerk. 90m. (PG) female sharpshooter. 90m. tailing his political activism and act- $59.95. Continental. The Secret Diary of Sigmund $19.95. (RE) Fox. ing career. 101m. Hi $39.95. Em- Freud. 1984. Bud Cort, Carol bassy. Monkeys Go Home. 1966. Maurice Kane, Klaus Kinski. Tongue-in- Any Friend of Nicholas Nickleby Is Chevalier, Dean Jones, Yvette cheek biography. 129m. Hi cc a Friend of Mine. 1981. Fred Fool for Love. 1985. Sam Shepard, Mimieux. Heir to French farm im- $79.98. Key. Gwynne, Brian Svrusis. From Ray Kim Basinger, Harry Dean Stan- ports chimps to do harvesting. Bradbury story: visitor to Illinois ton; wr. Shepard; dir. Robert Alt- 89m. $69.95. Disney. The Spy with a Cold Nose. 1966. town claims he’s Charles Dickens. man. Cowboy confronts girfriend Laurence Harvey, Daliah Lavi, 55m. $59.95. Media. who’s run away from him. 108m. My Beautiful Laundrette. 1985. Lionel Jeffries. Soviet Prime Min- (R) Hi ss $79.95. MGM/UA. Saeed Jaffrey, Daniel Day Lewis. ister accepts bulldog as gift from As Is. 1986. Jonathan Hadary, Rob- Pakistani immigrant’s business Britain, unaware the pooch is bug- ert Carradine, Colleen Dewhurst. Gal Young ’Un. 1979. Dana Preu, venture gives him lesson in ex- ged. 93m. Hi $59.95. Charter. Cable-TV adaptation of play about David Peck, J. Smith Cameron. ploiting British economy. 93m. (R) AIDS victim. 86m. $59.95. Karl. Prohibition-era bootlegger swin- $79.95. Karl. Swing Time. 1936. B&W. Fred dles Florida widow. 105m. $69.95. Astaire, Ginger Rogers; dir. Bittersweet Love. 1976. Lana Academy. My Dog the Thief. 1969. Dwayne George Stevens. Quintessential Turner, Robert Lansing, Celeste Hickman, Elsa Lanchester, Joe team-up: dance partners in on- Holm, Robert Alda, Meredith Bax- Gangster’s Law. Yr. n.a. Klaus Flynn. Helicopter reporter’s mas- again, off-again romance. 105m. ter Birney. Newlyweds discover Kinski. Mobster becomes victim of cot snatches stolen necklace from $19.95. (RE) Fox. his brutal code. 89m. $69.95. thieves. 88m. $69.95. Disney. TWE. Topper Returns. 1941, czd. 1986. A Nice Girl Like Me. 1969. Harry Roland Young, Joan Blondel, Billie Georgia, Georgia. 1972. Diana Andrews, Barbara Ferris. Or- Burke. Third and final outing in se- Sands, Dirk Benedict. Interracial phaned English girl sets out to see ries: Topper helps woman’s ghost romance set in Sweden. 91m. (R) continent but gets pregnant. 91m. solve her own murder. 87m. $59.95. Prism. (PG) Hi $59.95. Charter. $29.95. Roach. they are blood relatives. 92m. Grown Ups. 1986. Charles Grodin, Pandemonium. 1982. Tom Smoth- ers, Judge Reinhold, Madeline Topper Takes a Trip. 1939, czd. (PG) Hi $59.95. Embassy. edeeeeee e eMeartein Balsadm, Marilu Henner; Kahn. Spoof of Friday the 13th- 1986. Constance Bennett, Roland type slasher films. 82m. (PG) Hi Young, Billie Burke. Follow-up to Born to Run. 1977. Tom Farley, wr. Jules Feiffer. World-weary $79.95. MGM/UA. Topper with ghostly Bennett spoil- ing Young’s Riviera vacation. 85m. Robert Bettles. Aging horse train- journalist shocks parents by an- Psychos in Love. 1987. $29.95. Roach. Made-for-video comedy of mur- er stakes hopes on colt. 87m. nouncing plans to quit job. 106m. derous couple. 88m. $69.95. Wiz- Up in Arms. 1944. Danny Kaye, ard. Dinah Shore, Dana Andrews. Hy- $69.95. Disney. $59.95. Karl. pochondriac draftee becomes he- Running Scared. 1986. Gregory ro. 105m. Hi $39.95. Embassy. Bouquet of Barbed Wire. 1976. Hard Traveling. 1985. J.E. Free- Hines, Billy Crystal. Chicago cops Frank Finley, Sheila Allen. Three- man, Ellen Geer. Depression-era farmer accused of murder. 99m. Monkeys Go Home part British soaper about wealthy (PG) B Hi V $69.95. New World. publisher and family. 343m. (3 cas.) Hi $79.95. Sony. The Hasty Heart. 1986. Gregory LEOSHSESOCooEeOESSHOSEHESSEOSCSESTOEEESESSSESOEOSSSOSEOCESSESEESSESHSHOChOilSdrHeHn HoOf CRHagOe.S 1974. Cyril Harrison, Cheryl Ladd, Perry Cusak, Simon Ward. Palestinian King. Made-for-cable adaptation of boy grows up in shadow of Arab-Is- John Patrick play: terminally ill pa- raeli conflict. 99m. (PG) $69.95. tient disrupts army hospital ward. Academy. 100m. $59.95. Karl. Coming Out of the Ice. 1982. John Heartburn. 1986. Mery! Streep, Savage, Willie Nelson, Ben Cross. Jack Nicholson; dir. Mike Nichols. TV docu-drama of parachutist Vic- Adaptation of Nora Ephron’s book about her marriage to philandering tor Herman, imprisoned in Russia journalist. 109m. (R) Hi cc $79.95. for refusing to renounce American Paramount. citizenship. 100m. (PG) Hi cc $59.98. Playhouse. Homeward Bound. 1980. David Deadly Companion. Anthony Per- Soul, Barnard Hughes. Divorced ~ kins, Michael Sarrazin, Susan man reconciled with estranged fa- Clark. Man resorts to blackmail to ther, dying son. 96m. $59.95. conceal identity of wife’s killer. Lightning. 90m. Price n.a. VCL. In Search of a Golden Sky. 1984. Death of a Salesman. 1985. Dustin Charles Napier, George Flower. Orphans run away when welfare Hoffman, John Malkovich, Charles officers declare uncle unfit to raise Durning; wr. Arthur Miller; dir. them. 94m. (PG) Hi cc $79.98. Volker Schlondorff. TV adaptation Playhouse. of Broadway revival. 135m. Hi James Dean. 1976. Michael Bran- $79.95. Karl. Diabolically Yours. 1967. Alain don, Candy Clark, Amy Irving. TV Delon, Senta Berger. Car accident docu-drama based on memoirs of leaves man amnesiac. 94m. Dean’s roommate. 99m. B Hi V 6bCUe628EOnv0O5EoOSTEC®9O.ECCS.1:ba0s'0o5cGC6Oe06KT60MPbR9©sOE5Oo0dp'609Ri.SElDFSs50l0eioC50.SCubSe6DOs5FSeWFe.06cS0uc.SCe0cH.0$b0ne0C95lwS9ei.w9i5e.cceUnicorn. erecmsdeeeeceecee$ee6s9s.ss9se5s. esNeesweeWsorslsd.eesseeresesese 78 Video April 1987

Jane Austen in Manhattan. 1980. Anne Baxter, Robert Powell; dir. James Ivory. Acting teacher and ex-pupil mount competing produc- tions of newly discovered Austen play. 108m. Hi $59.95. Charter. Justine. 1969. Anouk Aimee, Mi- American Anthem. 1986. Mitch . GRP All Stars Live from the Re- . radio version, commentary on chael York, Dirk Bogarde; dir. ceeeseeosscoeceGsaylord, Janet Jones. Drama. ° cord Plant. 1986. Jazz session e George Cukor. Wife of wealthy ° featuring Dave Grusin, Lee Rite- ry Egyptian banker and her lovers, in 100m. (PG-13) ss CX $29.95. ° nour, Carlos Vega, others. Disc . second audio track. CX. $99.95. 1930s Alexandria. 115m. Hi cc Karl. ° only. 49m. St CX $24.95. Pio- $59.98. Key. . neer. °; Criterion. American Ballet Theatre in San . . Katherine. 1975. Sissy Spacek, Art Francisco. 1985. Cynthia Grego- . Gun Fury. 1953. Rock Hudson, . Mercedes Benz: 100 Years. F oot- Carney, Henry Winkler, Jane ry, Natalia Makarova. 105m. St . Donna Reed. Action. 83m. . Wyatt. TV movie: pampered heir- CX $34.95. Pioneer. e $29.95. RCA/Columbia. * ess becomes radical activist. 98m. . e age of vintage cars set to score by B Hi V $59.95. New World. April Fool’s Day. 1986. Deborah . Half Moon Street. 1986. Sigour- Foreman, Griffin O’Neal. Hor- . ney Weaver, Michael Caine. Dra- . Private Music. Not avail. on cas. The Last Mile. 1932. B&W. Pres- ror. 90m. (R) ss CX cc $29.95. . ma. 90m. (R) $34.95. Embassy: e ton Foster, Howard Phillips. Killer Paramount. . . sentenced to electric chair leads * . ° 53m. St CX $34.95. Pioneer. prison riot. 69m. $29.95. Images. . . . ° .: Motown Time Capsule: The ’70s. . ° 1986 comp. B&W/Color. Music. ° . . . 50m. St CX $24.95. Pioneer. ° e e . . . 9 1/2 Weeks. i986. Mickey . . . Rourke, Kim Basinger. Drama. . 118m. (R) ss CX $39.95. MGM/ e . ° UA. ° ° Love with a Perfect Stranger. 1986. . One More Saturday Night. 1986. Marilu Henner, Daniel Massey. e Made-for-video Harlequin Ro- . Al Franken, Tom Davis. Come- mance feature: American widow in . . dy. 96m. (R) St CX $34.95. e« RCA/Columbia. ° ° love with Englishman. 98m. Hi Seeeereem reeseseerseeeseseeeeeseeseeee ry Psycho iil. 1986. Anthony Per- . $39.95. Paramount. ° kins, Diana Scarwid; dir. Per- ° Macao. 1952. B&W. Robert . kins. Horror. 93m. (R) ss CX cc Mitchum, Jane Russell, William . ° $34.98. MCA. e ° Bendix; dir. Josef Von Sternberg, ° Ran. 1985. Tatsuya Nakadai; dir. Nicholas Ray. American traveling ° Akira Kurosawa. Drama. 160m. ° ° in Far East helps capture gangster. . (2 discs) (R) ss CX $44.98. CBS/ 81m. $19.95. Fox. . Fox. . . A Man and a Woman. 1966. Anouk . . RIT Special/Lee Ritenour: Live . Aimee, Jean-Louis Trintignant; , 1986. Music. 74m. St CX $29.95. dir. Claude Lelouch. Widow and . Pioneer. » ’ widower meet while visiting chil- . dren at school, begin affair. Dub- » The Rod Stewart Concert Video. bed. 103m. Hi cc $24.98. Warner. Labyrinth ’ 1986. Compiled from ’84 tour. ° . * 80m. St CX $29.95. Karl. A Man and a Woman: 20 Years Atlantic Starr. 1986 comp. Music . Running Scared. 1986. Billy Later. 1986. Anouk Aimee, videos. 15m. (8” disc) St CX Horowitz in Moscow. 1986. Con- ° Jean-Louis Trintignant; dir. Claude $12.99. Pioneer. e Lelouch. Sequel finds still-single cert by pianist Vladimir Horo- . Crystal, Gregory Hines. Come- widow making film about her ro- eeCeererseeeseseBsileleyeJeoeele:esTeheeseVisdeeeoseAelbeusmeeVol. witz. 120m. St CX $29.95. Pio- e neer. . e dy. 107m. (R) ss cc $34.95. ° MGM/UA. e . Hot Rocks Vol. 2. 1985 comp. e Space Archive Vol. 6: Encoun- mance. 112m. (PG) Hi St sub. 2. 1986 comp. 50m. St $29.98. e Music videos featuring Thomp- . ters. 1986. Satellite photos from $79.95. Warner. CBS/Fox. . . space shuttles Voyager and Giot- Mother and Daughter: The Loving son Twins, Starship, Rodney . War. 1980. Tuesday Weld, Fran- ces Sternhagen. Unwed mother Blue City. 1986. Judd Nelson, Al- + Dangerfield, others. 28m. St CX ° to. Disc only. CAV format. estranged from daughter. 100m. . Hi $59.95. Charter. ly Sheedy. Action. 83m. (R) CX $16.95. Pioneer. . $39.95. Optical Data. ° My Forbidden Past. 1951. B&W. cc $29.95. Paramount. . Robert Mitchum, Ava Gardner, Joe Jackson: The Big World Ses- . Steven Wright Live. 1986. Come- Melvyn Douglas. Doctor spurns Carols for Christmas. 1985. Royal . advances of wealthy but disreputa- College of Music Chamber Choir. sions. 1986. Concert excerpts. . ble woman. 72m. $19.95. Fox. 60m. Dig. St CX $29.95. Pio- ° dy. 54m. St CX $29.95. Vestron. No Place to Run. 1972. Herschel neer. 50m. St CX $16.95. Pioneer. . To Kill a Mockingbird. 1962. Bernardi, Scott Jacoby, Larry . Hagman, Stephanie Powers, Tom Cinderella. 1964. Lesley Ann . Bosley. Ailing elderly man fights to Warren, Ginger Rogers. TV mu- The Karate Kid Part Il. 1986. e B&W. Gregory Peck. Drama. retain custody of grandson. 78m. sical. 77m. St cc $34.98. CBS/ Ralph Macchio, Pat Morita. Ac- . 131m. (2 discs) CX $39.98. Fox. tion. 113m. ss CX $29.95. . MCA. . RCA/Columbia. . . ° . Touch of Evil. 1958. B&W. Charl- . Kenny and Dolly: Real Love. . ton Heston, Orson Welles; dir. . 1985. Kenny Rogers, Dolly Par- . Welles. Drama. 108m. CX ° Desert Bloom. 1986. Jon Voight, ton. Concert. 60m. St CX Y $29.98. MCA. . JoBeth Williams. Drama. 103m. $24.95. Pioneer. . (PG) $29.95. RCA/Columbia. ° Video-a-Go-Go Vol. 2. 1986 . Labyrinth. 1986. David Bowie, . comp. Music videos by Ashford . $59.95. Vidmark. Echo Park. 1986. Susan Dey, Jennifer Connoly. Fantasy. . and Simpson, Gap Band, others. . On Valentine’s Day. 1986. Hallie Tom Hulce. Drama. 93m. (R) CX 101m. (PG) ss cc $34.95. * 27m. St CX $16.95. Pioneer. Foote, William Converse-Roberts, $29.95. Paramount. ° Embassy. . . Windham Hill in Concert. 1986. ° Matthew Broderick; wr. Horton Garry Shandling: 25th Anniversa- The Magnificent Ambersons. . Music of William Ackerman, Foote. Wealthy parents refuse to ry Special. 1985. Talk show 1942. B&W. Wr./dir. Orson Wel- . Scott Cossu, Michael Hedges, ° ° condone daughter’s marriage to spoof. 57m. CX $24.95. Para- les. CAV format; includes story- ° Shadowfax. Disc only. St CX young man of modest income. HHSHHoSEeCHHEEEEHoSEHSHeEHSHEHOESECEEEbeDSHoEard, original shooting script, . $29.95. Pioneer. mount. . 106m. (PG) $79.95. Karl. ESSPeeEeEEHoeeEEeSeoeEEeEEeEsEeeeEseEEEEEEE April. 1987 Video 79

. . The Quiller Memorandum. 1966. To All My Friends on Shore. 1971. . Mary, Mary, Bloody Mary. 1976. Back in Shape: The Complete Back George Segal, Alec Guiness, Max Bill Cosby, Gloria Foster, Dennis . Pain Prevention Program. 1987. Von Sydow; wr. Harold Pinter. Hines. Father learns son is ter- 6 Christina Ferrare, John Carradine. American agent assigned to defuse minally ill. 74m. $59.95. Saturn. . Doctor hosts program illustrating neo-Nazi movement in ’60s Berlin. . Family disease with bizarre symp- 103m. Hi cc $59.98. Key. Westinghouse Studio One. 1950- . exercises, relaxation techniques. . tom: thirst for human blood. 95m. 60m. $19.95. Karl. The Rise of Catherine the Great. . 1934. B&W. Douglas Fairbanks, . (R) $59.95. Continental. Jr., Flora Robson. Stormy mar- . riage of 18th-century Russian prin- . cess to mad duke. 88m. Hi $39.95. ’53. B&W. Installments of CBS- . Nightmare Weekend. 1986. Dale Boarding Schools: The Video. Embassy. . TV omnibus, all broadcast live. A . Midkiff, Debbie Laster. Profes- 1986. Info program aimed at par- Road to Salina. 1971. Robert ° Walker, Ed Begley, Rita Connecticut Yankee in King Ar- ° sor’s crazed female assistant lures ents considering private educa- Hayworth. Wanderer plays along . with woman who mistakes him for thurs Court (’50): Thomas Mit- ° students into cruel experiments. tion. 30m. $11.95. Nat. Assoc. of missing son. 96m. (R) $59.95. chell, Boris Karloff. Mark of Cain . Indep. Schools (mail order only: Charter. . 86m. (R) $79.95. Lightning. . Say Goodbye, Maggie Cole. 1972. (50): Warren Stevens, Everett . Boarding Schools Program, 18 Susan Hayward, Darren McGavin. Sloane. Wuthering Heights (’53): . Phantom of the Opera. 1943. Tremont St., Boston, Mass. TV movie featuring Hawyard’s fi- Charlton Heston, Mary Sinclair. . 02108; 617-723-6900). nal performance as dedicated phy- . Claude Rains, Nelson Eddy, Hume sician in Chicago slum area. 78m. The Nativity (52): Robert Shaw . Bujones in Class. 1987. Ballet in- $59.95. Vidmark. . Cronyn. Disfigured composer struction by Fernando Bujones. Chorale, Miriam Wolfe, Paul Trip. 31m. Hi St $39.95. Kultur. Second Chance. 1981. Susannah Approx. 60m. ea. $24.95 ea. Im- . lurks beneath Paris Opera House. York, Ralph Bates. BBC mini- ages. . series: 18-year marriage breaks . up. 270m. (3 cas.) Hi $79.95. . 93m. Hi $39.95. MCA. Sony. . . Scream Greats Vol. 2: Satanism Seize the Day. 1987. Robin Wil- ° Cheerleading Routines. 1987. liams, Jerry Stiller, William Hick- . ey, Tony Roberts. From the Saul Westinghouse Studio One Summer . and Witchcraft. 1986. Documenta- Members of Nat. Cheerleading Bellow novel: man’s midlife crisis Theatre—The Human Barrier. Assoc. demonstrate kicks, splits, 93m. Hi $79.95. HBO/Cannon. . ry on real-life devil worshippers. jumps, routines. 30m. $14.95. 1957. B&W. Skip Homeier, Patri- . Morris. A Shriek in the Night. 1933. B&W. cia Smith. Live TV drama: jet ° Ginger Rogers, Lyle Talbot, Lou- ° 58m. Hi $39.95. Paramount. ise Beavers. Rogers as reporter crash leaves test pilot shaken. out to crack murder case. 92m. . $29.95. Images. . Terror at Red Wolf Inn. 1972. Janet . Spirit of Youth. 1938. B&W. Joe . Wood, Margaret Avery. Missing Louis, Edna Mae Harris. Fictional- . The Coleman Guide to Camping. ized bio of heavyweight champ . Louis. 68m. $29.95. Images. 60m. $24.95. Images. . hotel guests show up on menu. Stranger on the Third Floor. 1940. . 90m. (R) $59.95. Academy. 1986. Host Bruce Jenner offers B&W. John McGuire, Peter Lor- ry re. Reporter discovers innocence ° tips on tent set-up, packing cooler, of man he identified as murderer. . The Texas Chainsaw Massacre poisonous plants, more. 45m. Hi 64m. $19.95. (RE) Fox. . St $19.95. Twin. . Part 2. 1986. Dennis Hopper, Car- Sylvia Scarlett. 1935. B&W. . Fit for Life. 1986. Diet program Katharine Hepburn, Cary Grant, . hosted by Harvey and Marilyn Dia- Edmund Gwenn; dir. George q Horror 2 . oline Williams; dir. Tobe Hooper. Cukor. English girl masquerades as boy in order to accompany con- . Texas ranger rounds up family of man father to France. 94m. . $19.95. (RE) Fox. . . killers. 101m. Hi ss cc $79.95. Tchao Pantin. 1985. Coluche, Richard Anconina, Agnes Soral. . Media. mond, based on their bestselling Ex-cop befriends drug pusher. . 100m. Hi sub. $59.95. Embassy. . book. Includes meal diary booklet. . 80m. Hi St $24.98. Warner. Teenager. 1974. Andrea Cagan, . Reid Smith. Young actress exploit- . ed by film director. 91m. (R) B Hi . V $59.95. New World. Aliens. 1986. Sigourney Weaver, . Gymjazz. 1986. Sandahl Bergman. ° They Won’t Believe Me. 1947. Paul Reiser; wr./dir. James . Aerobic workout designed to pre- B&W. Robert Young, Susan Hay- Cameron. Sole survivor of encoun- . vent injury. 30m. $29.95. ward, Jane Greer. Husband’s in- ter with deadly creature joins res- . Magnum. volvement with three mistresses’ cue mission to infested planet. . makes him prime suspect in mur- 138m. (R) Hi ss cc $89.98. CBS/ e The Hawaiian Martial Art of Self der trial. 95m. $19.95. Fox. . Defense. 1986. For women. Fox. . $29.95. Philmor Prods. (Suite 214, . . . . Ace the SAT. 1986. Study tips for ° . The Ape Man. 1943. B&W. Bela ° each section, test strategies. 80m. 2035 Westwood Blvd., West- Lugosi, Wallace Ford, Louise Cur- . $59.95 plus $2 s/h. Intermedia wood, Calif. 90025; 213-475- . . rie. Serum turns scientist into . (1600 Dexter Ave. No., Seattle, 0755). beast. 62m. $29.95. Images. . Wash. 98109; 800-443-0100). How Can | Tell if I'm Really in . . . The Art of Sensual Massage. 1986. The Corpse Vanishes. 1942. B&W. . Love? 1987. Justine Bateman Bela Lugosi, Luana Walters. Sci- . Instruction in techniques ranging hosts program on teen dating; with . . from therapeutic to erotic. 37m. entist rejuvenates aging wife with . blood of young brides. 62m. . $19.95. Karl. $29.95. Images. e . The Texas Chainsaw Massacr e Part2 The Curse of the Werewolf. 1961. . . . . . Oliver Reed, Clifford Evans. Girl . raped by vagrant gives birth to . . . werewolf. 91m. Hi $39.95. MCA. . Deadly Darling. 1985. Warren Chan, Fonda Lynn. Rape victim stalks her attackers. 91m. $49.95. Unicorn. The Evil of Frankenstein. 1964. Pe- ter Cushing, Peter Woodthorpe. Hapless doctor revives frozen monster, which promptly runs amok. 98m. Hi $39.95. MCA. Friday the 13th, Part VI: Jason Lives. 1986. Ron Palillo, Thom Mathews. More gore. 87m. (R) Hi ss cc $79.95. Paramount. Junior. 1984. Suzanne De- laurentis, Linda Singer. Landlady depends on son to evict undesira- ble tenants with chainsaw. 80m. Hi $79.95. Prism. weerreerceeerseesseeeeeeesseseeseeee 80 Video April 1987

Manon Lescaut. 1980. Renata element he believes will cure all Scotto, Placido Domingo; cond. disease. 80m. Hi $39.95. MCA. James Levine. Puccini opera taped at the Metropolitan. 135m. Hi St Osa. 1985. Kelly Lynch, Peter sub. $59.95. Canto. Walker. Girl on blighted planet searches for scavengers who mur- Montserrat Caballe—The Woman, dered her family. 94m. Hi $79.95. The Diva. 1987. Tribute to opera HBO/Cannon. tenor; excerpts from La Boheme, Barber of Seville, more. 62m. eRadioeactive Dreams. 1986. John $39.95. Kultur. Stockwell, Michael Dudikoff, George Kennedy. Two young men Motley Crue Uncensored. 1986 emerge from bomb shelter 15 comp. Heavy metal videos: “Live years after nuclear explosion. Wire,” “Looks That Kill,” “Too 94m. (R) Hi $79.95. Vestron. Young to ‘Fall in Love,” 2 more. 45m. V only Hi St $19.98. Elektra. Kiss: Exposed Reggae Sunsplash—A Tribute to Bob Marley. 1981. Memorial con- cert featuring Third World, the Wailers, Black Uhuru, others. 104m. Hi St $29.95. Sony. Jason Bateman, Ted Danson, Dr. Dokken. 1986 comp. Rock videos We Like the Blues Parts 1 & 2. 1987 Going for It. 1986. Surfboard Sol Gordon. 51m. Hi St $29.95. “Breaking the Chains,” “Into the comp. Fabulous Thunderbirds, stunts, dirt bike racing. 30m. Paramount. Fire,” “Just Got Lucky,” 4 more. Alexis Korner, Bill Wyman, Char- $14.95. Morris. 45m. V only Hi St $19.98. Elektra. lie Watts, others. 60m. ea. Hi St The Joy of Talking. 1986. Five $19.95 ea. Sony. The Greatest Whitetail Hunt. 1987. cas.: instruction in basic French, 42nd Street. 1933, czd. 1986. Ru- Thompson Temple. Hunters use Spanish, Italian, German, and He- by Keeler, Dick Powell, Ginger Wham! The Final. 1987 comp. Vid- variety of approaches on quarry. brew. Programs include audio Rogers. Understudy in Broadway eos “I’m Your Man,” “Freedom,” 60m. $49.95. Sportsmen. tape, phrase booklet. 60m. ea. musical replaces injured star. 89m. “Edge of Heaven,” more. 25m. Hi $39.95 ea. Vidmark. Hi $59.98. CBS/Fox. St $19.98. CBS/Fox. Massage, the Touch for Health. Francesca da Rimini. 1984. Renata Humanoid Defender. 1985. Ter- Alberto Moravia. 1983. Conversa- 1986. Instruction by licensed ther- Scotto, Placido Domingo; cond. ence Knox, Gary Kasper. Govern- tions with Italian novelist, readings apist Michael Levi. 60m. $26.88. James Levine. Metropolitan pro- ment agency plans to put android from his work. 53m. $39.95. Continental. duction of Zandonai’s opera. 148m. to evil use. 94m. Hi $39.95. MCA. Home Vision. Hi St sub. $59.95. Canto. Richard Hittleman’s Yoga Video The Invisible Ray. 1936. B&W. Ben Nicholson: Razor Edge. 1985. Courses 1 & 2. 1986. Elementary Further on Down the Road. 1986. Boris Karloff, Bela Lugosi, Fran- Observations, reminiscences by and intermediate workouts. 90m. Guitarists Albert Collins, Lonnie ces Drake. Scientist driven mad by abstract painter’s friends. Approx. ea. Hi St $39.95 ea. Clear Lake Mack, Roy Buchanan in concert at 60m. $39.95. Home Vision. Prods. (Box 3007, Santa Cruz, Carnegie Hall. “Oreo Cookie Calif. 95063; 408-425-7940). Blues,” “Master Charge,” “Green oHOESOEOOEESPeSL®ELEeOSEEOSEeOSeHEPESOSSERE Onions,” more. 90m. Hi St $19.95. Tax Attack ’87. 1987. Robert Klein. Barznton Prods. (mail order only: Fit for Life Humorous explication of new tax 18 Marshall St., S. Norwalk, law. 43m. B Hi V $19.95. New Conn. 06854; 203-866-6666). World. The Gibson Jazz Concert. 1982. Your Beautiful Garden Vols. 1-7. Dick and Maddie Gibson host one- 1987. Ed Hume. Success With In- time group appearance featuring door Plants, Grow Your Own Vege- Clark Terry, Budd Johnson, Phil tables, Annuals and Hanging Bas- Woods, Shelley Manne, others. kets, Basic Gardening, Ground 60m. Hi St $29.95. Sony. Covers, Your Beautiful Lawn, Pruning. 60m. ea. $19.95. Mor- Hansel and Gretel. 1982. Judith ris. Blegen, Frederica von Stade; cond. Thomas Fulton. Children’s opera at Metropolitan. 104m. Hi St $39.95. Canto. _ Bujones: InHis Image. 1987 comp. Howard Jones: Last World Dream. Career highlights of dancer Fer- 1986. Concert performance. In- nando Bujones. Interviews, ex- cludes “What Is Love?,” “Things cerpts from Le Corsaire, Swan Can Only Get Better,” “Dream in- Lake, more. 62m. Hi St $39.95. to Action.” 58m. V only Hi St Kultur. $24.98. Elektra. Davidsbundlertanze. 1981. Janet Baker—Full Circle. 1987. George Balanchine ballet featuring Profile of opera singer: interviews, Suzanne Farrell, Jacques D’Am- excerpts from final recitals. 75m. boise, Peter Martins. 48m. Hi St Hi St $39.95. Kultur. $39.95. Home Vision. Kiss: Exposed. 1986. Concert foot- age, interviews, video excerpts. PeCOSCOHSEOESOOCECEOESHEOEeOEOeHCSEHCOESOEeoECSO9E0eme.EEHeieeSet.rEPereieceesno.ea.soPcooleycGercacml.ocecCHeHeHeEESHESHPOEOeEEeHeEESEREePEEeCEetEESemeEESeESHeeEeCDEeEErCHeE m4

Tsarko Selo, Catherine II. 30m. Color. 1984. Consideration of ea. $19.95 ea. Gems. painter’s work focusing on Paris exhibit. Approx. 60m. $39.95. Inside the CIA: On Company Busi- Home Vision. ness, Parts 1-3. 1981. Overview Private Conversations: On the Set and interviews with ex-agent Phil- of Death of a Salesman. 1986. lip Agee. Approx. 60m. ea. $19.95 Dustin Hoffman, Arthur Miller. ea. MPI. Making of TV production. 82m. Hi $59.95. Karl. Inside the Labyrinth. 1986. The Theodore Gericault: Men and Wild making of the Jim Henson film. Horses. 1982. French painter as 57m. Hi $19.95. Embassy. viewed by contemporaries. 60m. $39.95. Home Vision. Laurel and Hardy: Rare Home Movies. 1932. B&W. Stan Laurel, Vanishing Wilderness. 1973. Nar. Oliver Hardy. Trip to Scotland and Rex Allen. Endangered North England. Silent, with organ score. American species, habitats. 90m. (G) $19.95. Media. 25m. $19.95. Images. Video from Russia. 1985. Inter- Vanishing Wilderness Eduardo Chillida: A Portrait of the Martin Luther King, Jr.: “1 Have a views with Russian citizens, shot Basque Sculptor. 1985. Nar. Chilli- Dream.” 1986 comp. B&W. 1963 by American crew. 45m. $29.95. Clint Eastwood’s Mayoral Inaugu- MPI. ration. 1986. Includes look at cam- da. The artist at work and in speech plus story of civil rights paign, music video “Don’t Mess Egypt. 60m. $39.95. Home Vi- movement. 28m. $14.95. MPI. Vietnam: A Television History. with the Mayor.” $19.95. United, 1983. Emmy-winning PBS docu- Video Marketing (Box S, Eighth & sion. Once Upon a Wheel. 1974. Paul mentary series. 6 cas. 120m ea., San Carlos, Carmel, Calif. 93921; 1 cas. 60m. $195.65. Sony. 408-373-3090). If These Walls Could Speak. Host Newman. Program on race car Vincent Price tours palaces with driving. 60m. $39.95. Magnum. colorful histories. Two cas.: Pal- eer ace dof Peterhof, Peter the Great; seeecwcesecceccrecrcrePecireerereseBeosnensaereds:seIsneSreeasrscehceocfsPrure PROGRAMMING SOURCES Academy Home Entertainment, HBO/Cannon Home Video, 1370 408-0600. 1600 N. Fairfax Ave., Hollywood, Box 788, Pinehaven Shore Rd., Sixth Ave., New York, N.Y. Calif. 90046; 213-850-0525. Shelburne, Vt. 05482; 800-972- 10019; 212-977-8990. Morris Video, 413 Ave. G #1, Box 0001. 443, Redondo Beach, Calif. 90277; Sony Video Software, 9 W. 57 St., Hi-Tops Video: see Media. 213-379-2414. New York, N.Y. 10019; 212-371- Sybil Danning’s Adventure Video: 5800, 800-847-4164. see IVE. Home Vision, 5547 N. Ravens- MPI Home Video, 15825 Rob Roy wood Ave., Chicago, Ill. 60640- Dr., Oak Forest, Ill. 60452; 312- Sportsmen on Film, 5567 Reseda Bel Canto: see Paramount. 1199; 312-878-2600 ext. 336. 687-7881. Blvd., Suite 300, Tarzana, Calif. 91356; 818-342-5555. CBS/Fox Video, 1211 Sixth Ave., Video Images (Video Yesteryear), New World Video, 1440 S. Sep- New York, N.Y. 10036; 212-819- Box C, Sandy Hook, Conn. 06482; ulveda Blvd., Los Angeles, Calif. Touchstone Home Video: see Dis- 3200. 800-243-0987. 90025; 213-444-8100. ney. Charter Entertainment: see Em- IVE, 21800 Burbank Blvd. #300, NFL Films Video, 330 Fellowship Trans World Entertainment, 6464 bassy. Woodland Hills, Calif. 91365-4062; 818-888-3040, 800-423-7455. Rd., Mt. Laurel, N.J. 08054; 609- Sunset Blvd., Los Angeles, Calif. Continental Video, 2320 Cotner, 778-1600, 800-NFL-TAPE. 90028; 213-461-0467. Los Angeles, Calif. 90064; 213- Karl-Lorimar Home Video, 17942 477-8055, 800-821-3427. scwereeerCeeoewsacnesArvee.s,eeIervrienes,esCealsief.ee9s2e71s4e; Optical Data Corp. (formerly Video Twin Tower Enterprises, 12345 Vision), 66 Hanover Rd., Box 97, Ventura Blvd., Suite R, Studio The Criterion Collection, c/o The 714-474-0355. Florham Pk., N.J. 07932; 201-377- City, Calif. 91604; 818-761-0932. Voyager Co., 2139 Manning Ave., 0302. Los Angeles, Calif. 90025; 213- Key Video: see CBS/Fox. Unicorn Video, 20822 Dearborn 475-3524, 800-446-2001. Paramount Home Video, 5555 St., Chatsworth, Calif. 91311; Kultur International Films, Ltd., Melrose Ave., Los Angeles, Calif. 818-407-1333. Walt Disney Home Video, 500 S. 121 Hwy. 36, West Long Branch, 90038-3197; 213-468-5000. Buena Vista St., Burbank, Calif. N.J. 07764; 201-229-2343. VCL Communications: see Karl- 91521; 818-840-1111. Pioneer Artists, 200 W. Grand Lorimar. Lightning Video: see Vestron. Ave., Montvale, N.J. 07645; 201- Elektra Entertainment, 75 Rocke- 573-1122. Vestron Video, 60 Long Ridge Rd., feller Plaza, New York, N.Y. Magnum Entertainment Inc., 9301 Box 4000, Stamford, Conn. 06907; 10019; 212-484-7200. Wilshire Blvd., Beverly Hills, Playhouse Video: see CBS/Fox. 203-968-0000. Calif. 90212; 213-278-9981, 800- Embassy Home Entertainment, 824-2921. Polygram Video, 810 Seventh Viddy-Oh! for Kids: see MGM/UA. 1901 Ave. of the Stars, Los Ange- Ave., New York, N.Y. 10019; 212- les, Calif. 90067; 213-553-3600. MCA Home Video, 70 Universal 333-8000. Vidmark Entertainment, 2450 Wil- City Plaza, Universal City, Calif. shire Blvd., Suite #1, Santa Moni- Family Home Entertainment: see 91608; 818-508-4315. Prism Entertainment, 1875 Centu- ca, Calif. 90403; 213-829-4359. IVE. ry Pk. East, Suite 1010, Los Ange- Media Home Entertainment, 5730 les, Calif. 90067; 213-277-3270. Warner Home Video, 4000 Warner Fox Hills Video: see Media. Buckingham Pkwy., Culver City, Blvd., Burbank, Calif. 91522; 818- Calif. 90230; 213-216-7900, 800- RCA/Columbia Pictures Home Vid- 954-6000. Video Gems, 731 N. LaBrea Ave., 421-4509. eo, 3500 W. Olive Ave., Burbank, Box 38188, Los Angeles, Calif. Calif. 91505; 818-953-7900. Worldvision Home Video, 660 90038; 213-938-2385. MGMIUA Home Video, 1350 Sixth Madison Ave., New York, N.Y. eesmweeerereeerArrvee.e,seNeeewesYoerske,reN.sYe.se1s00s1e9e; e212- Hal Roach Studio Films Classics, erecweereereee1se0e0s2e1s;es2e12s-e8w3e2-s3e8s38e.seeeeeeeeeseserese | a2 Video. April

N Vv agar aes iwPsUB2saaEeSNaeRp=meaGa||In|E|N) TRa=|2peaNBSTeSeeRareeA,raIeTGSGHeoeEeeVw!Y WSE8EE8 c* SoGe8reee e A ' feata| me pra April 1987 Minolta CR-8000S AF 8mm Camcorder Radio Shack Hi-Fi HQ VHS VCR with MTS Tuner Canon VM-E2 8mm Camcorder Magnavox VR8297AV01 Compact VHS Camcorder Minolta lens cap when you're shooting. Over the recorder. 8mm Camcorder front of the grip is the fixed unidirectional microphone. The cassette hatch on the camcorder’s Minolta is the only left side raises upward and pops out. A company marketing camcorders in Just behind the grip is acompartment for secondary control panel houses buttons for three of the four the clock with buttons for setting the date date, mode (which changes the viewfinder competing formats: full-sized VHS, and time. Further back on the right side are displays), memory, reset, and review Compact VHS, and 8mm. The 8mm a slide-off panel, with a release catch, cov- (which shows the last few seconds of the CR-8000S AF was Efoleead a few months ering the contacts for the AC adapter, the previous take in the viewfinder). Beneath after the other models. The test results amazed us. The best car battery adapter, or the 2-hour battery the buttons are mini-jacks for external mic, 8mm camcorder we had seen was Sony’s CCD-V110 Professional Video 8 (which is too big to fit in the slot on the earphone, and camera remote. Below the (“Videotests, ” December 1986) with quali- grip). The rear panel houses loops for the jacks are auto/manual slide switches for ty surpassed only by SuperBetamovie’s 970+ lines af harizantal racalitinn Mina! carrying strap, a covered jack for A/V in- white balance and iris operation with rotary Every Month put/output, and a rubber-cushioned hood controls for manual adjustment. What’s New, for the electronic viewfinder. The textured Further forward on the lens support is a What’s Good, slide switch for auto/manual focus. When What’s Best bottom plate has only the tripod socket. shooting with the manual focus, a press of in HomeVideo! The top panel sports an accessory shoe and the main control panel, with the switch gives one-shot autofocus. At spring-loaded slide switches for power and the front of the lens support is the window eject, a two-position slide switch for VCR for the autofocus sensors. The lens itself or camera operation, and buttons for re- has two adjustable rings for manual focus mm, and the zoom ring has y lever with the release for Every month, VIDEO e set into its tip. delivers the facts you For basic operation, sim- need to buy right, the ery, select camera or VCR information you need to enjoy your invest- ment more. Have VIDEO home- delivered every month—and know what's what! SO l——— —— S ea []Send me a full year of VIDEO (12 Name oe Zip monthly issues) at the low basic sub- adieiia [_] Bill me later scription price of $12.00. I save City State $11.40 (almost 50%) off the cover [_] My payment is enclosed price of $23.40. For Please allow up to 60 days for delivery of first issue. For Canada, add $4.00, U.S. funds. 47405 f horizontal resolution. foreign orders, add $25.00 for Air Mail delivery, U.S. funds. Foreign orders must be prepaid. April 1987 Video 85

Tsarko Selo, Catherine II. 30m. Color. 1984. Consideration of ea. $19.95 ea. Gems. painter’s work focusing on Paris exhibit. Approx. 60m. $39.95. Inside the CIA: On Company Busi- Home Vision. ness, Parts 1-3. 1981. Overview Private Conversations: On the Set and interviews with ex-agent Phil- of Death of a Salesman. 1986. lip Agee. Approx. 60m. ea. $19.95 Dustin Hoffman, Arthur Miller. Making of TV production. 82m. Hi ea. MPI. $59.95. Karl. Inside the Labyrinth. 1986. The Theodore Gericault: Men and Wild making of the Jim Henson film. Horses. 1982. French painter as 57m. Hi $19.95. Embassy. viewed by contemporaries. 60m. $39.95. Home Vision. Laurel and Hardy: Rare Home Movies. 1932. B&W. Stan Laurel, Vanishing Wilderness. 1973. Nar. Oliver Hardy. Trip to Scotland and Rex Allen. Endangered North England. Silent, with organ score. American species, habitats. 90m. (G) $19.95. Media. 25m. $19.95. Images. Video from Russia. 1985. Inter- hing Wilderness Eduardo Chillida: A Portrait of the Martin Luther King, Jr.: “I Have a views with Russian citizens, shot Basque Sculptor. 1985. Nar. Chilli- Dream.” 1986 comp. B&W. 1963 by American crew. 45m. $29.95. Clint Eastwood’s Mayoral Inaugu- da. The artist at work and in speech plus story of civil rights MPI. ration. 1986. Includes look at cam- Egypt. 60m. $39.95. Home Vi- movement. 28m. $14.95. MPI. paign, music video “Don’t Mess sion. Vietnam: A Television History. with the Mayor.” $19.95. United_ Once Upon a Wheel. 1974. Paul 1983. Emmy-winning PBS docu- Video Marketing (Box S, Eighth & If These Walls Could Speak. Host Newman. Program on race car mentary series. 6 cas. 120m ea., San Carlos, Carmel, Calif. 93921; Vincent Price tours palaces with driving. 60m. $39.95. Magnum. 1 cas. 60m. $195.65. Sony. 408-373-3090). colorful histories. Two cas.: Pal- ace of Peterhof, Peter the Great; eserePeseoeeemePsmeieeeereree eBsosnensasrde:erIenseSeeaerecshesoefePeuere PROGRAMMING SOURCES Academy Home Entertainment, . HBO/Cannon Home Video, 1370 408-0600. 1600 N. Fairfax Ave., Hollywood, Box 788, Pinehaven Shore Rd., . Calif. 90046; 213-850-0525. Shelburne, Vt. 05482; 800-972- . Morris Video, 413 Ave. G #1, Box 0001. . Sixth Ave., New York, N.Y. 443, Redondo Beach, Calif. 90277; Sony Video Software, 9 W. 57 St., . 213-379-2414. New York, N.Y. 10019; 212-371- Sybil Danning’s Adventure Video: . 10019; 212-977-8990. 5800, 800-847-4164. see IVE. . MPI Home Video, 15825 Rob Roy . Dr., Oak Forest, Ill. 60452; 312- Sportsmen on Film, 5567 Reseda Bel Canto: see Paramount. . Hi-Tops Video: see Media. 687-7881. Blvd., Suite 300, Tarzana, Calif. . 91356; 818-342-5555, CBS/Fox Video, 1211 Sixth Ave., . New World Video, 1440 S. Sep- New York, N.Y. 10036; 212-819- . Home Vision, 5547 N. Ravens- ulveda Blvd., Los Angeles, Calif. Touchstone Home Video: see Dis- 3200. . wood Ave., Chicago, Ill. 60640- mau . . ° 1199; 312-878-2600 ext. 336. . . Y Video Images (Video Yesteryear), . BoxC, Sandy Hook, Conn. 06482; Charter Entertainment: see | bassy. Continental Video, 2320 Coti NO POSTAGE NECESSARY || Los Angeles, Calif. 90064; 2 IF MAILED 477-8055, 800-821-3427. IN THE i The Criterion Collection, c/o ' UNITED STATES Voyager Co., 2139 Manning A’ Los Angeles, Calif. 90025; : BUSINESS REPLY MAIL 475-3524, 800-446-2001. FIRST CLASS PERMIT NO. 3494 NEW YORK, NY Walt Disney Home Video, 50: Buena Vista St., Burbank, C 91521; 818-840-1111. Elektra Entertainment, 75 Ro POSTAGE WILL BE PAID BY ADDRESSEE feller Plaza, New York, } 10019; 212-484-7200. uideo Embassy Home Entertainm P.O. Box 52255 1901 Ave. of the Stars, Los A Boulder, Colorado 80321-2255 les, Calif. 90067; 213-553-36' Family Home Entertainment: IVE. Fox Hills Video: see Media. Video Gems, 731 N. LaBrea / Box 38188, Los Angeles, ( 90038; 213-938-2385. i

April 1987 Minolta CR-8000S AF 8mm Camcorder Radio Shack Hi-Fi HQ VHS VCR with MTS Tuner Canon VM-E2 8mm Camcorder Magnavox VR8297AV01 Compact VHS Camcorder Minolta lens cap when you're shooting. Over the recorder. 8mm Camcorder front of the grip is the fixed unidirectional microphone. The cassette hatch on the camcorder’s Minolta is the only left side raises upward and pops out. A company marketing Just behind the grip is acompartment for secondary control panel houses buttons for camcorders in the clock with buttons for setting the date date, mode (which changes the viewfinder three of the four and time. Further back on the right side are displays), memory, reset, and review competing formats: a slide-off panel, with a release catch, cov- (which shows the last few seconds of the full-sized VHS, ering the contacts for the AC adapter, the previous take in the viewfinder). Beneath Compact VHS, and car battery adapter, or the 2-hour battery the buttons are mini-jacks for external mic, 8mm. The 8mm (which is too big to fit in the slot on the earphone, and camera remote. Below the CR-8000S AF was Eeuletedd a few months grip). The rear panel houses loops for the jacks are auto/manual slide switches for after the other models. carrying strap, a covered jack for A/V in- white balance and iris operation with rotary The test results amazed us. The best put/output, and a rubber-cushioned hood controls for manual adjustment. 8mm camcorder we had seen was Sony’s for the electronic viewfinder. The textured CCD-V110 Professional Video 8 bottom plate has only the tripod socket. Further forward on the lens support is a (“Videotests,”” December 1986) with quali- slide switch for auto/manual focus. When ty surpassed only by SuperBetamovie’s The top panel sports an accessory shoe shooting with the manual focus, a press of 270+ lines of horizontal resolution. Minol- and the main control panel, with the switch gives one-shot autofocus. At ta’s CR-8000S AF is equal to the Sony spring-loaded slide switches for power and the front of the lens support is the window Video 8 in picture quality, with over 260 eject, a two-position slide switch for VCR for the autofocus sensors. The lens itself lines of horizontal resolution. or camera operation, and buttons for re- has two adjustable rings for manual focus Its other attributes are a bit more mod- cord, play, stop, rewind (search), fast for- and manual zoom, and the zoom ring has est and less confusing to the novice video ward (search), and pause/still. All of the the usual stubby lever with the release for maker. It offers autofocus, auto iris, auto controls except stop, eject, and cam- the macro mode set into its tip. white balance, review, date and time im- era/VCR have indicator LEDs, and the printing, macro focusing, and a battery- power indicator blinks if there is dew in the Operation. For basic operation, sim- powered adapter that delivers both video ply insert a battery, select camera or VCR and RF output at the same time. That last feature is usually achievable only with AC Minolta’s CR-8000S AF 8mm camcorder boasts over 260 lines of horizontal resolution. adapters. April 1987 Video 85 Description. The CR-8000S AF is black with touches of color on controls and logos. It is 5-3/8 inches high by 5 wide by 12-1/8 deep, and weighs 3.2 pounds with- out its 6-ounce battery. It is a stepped box with a handgrip molded to its right side, parallel with the lens. The battery slides into the front of the handgrip, with a battery release catch nearby. The tele/wide angle rocker is on top of the grip and the run/pause button is at the back, under the thumb. An adjusta- ble strap runs around the back of your hand. The cap is attached to a string at the front, with a snap under the grip to hold the

Videotests DATA Test Report: Auto rewind: no Minolta CR-8000S AF Date of test: January 1987 Linear audio: none Suggested retail price: $2165 8mm Camcorder Hi-Fi audio, AFM: mono Accessories: supplied—1-hour battery, Weight: 3.2 pounds VCR controls: all, unitized AC adapter/charger, charger base, clock Dimensions: 5-3/8 x 5 x 12-1/8 inches Microphone: fixed electret condenser battery, earphone, A/V cable, 60-min. (h/w/d) plus external mic jack cassette, audio/video/RF adapter, 75-ohm Cable length: none used antenna cable, antenna transformers, car- Power requirements: 7.2 VDC rying handle, and carrying strap; option- Power consumption: 6.5 W Plug: none used al—extra 1-hour battery, 2-hour battery, Image sensor: 2/3-inch solid state MOS remote controller, video/audio output Lens: f/1.2, 6x (11.5 to 69 mm) power Jacks: external mic, earphone, wired cord, unidirectional mic, 60-min. and 120- zoom with macro capability remote, and multi-pin audio/video min. cassettes, hard case, and soft case Filter diameter: 52mm input/output Minimum focusing distance: 4 feet Tape format: 8mm RESULTS & RATINGS Field at closest focus: 4-1/4 x 5-2/3 Tape speeds: SP, 14.3 mm/sec; LP Horizontal resolution: measured—270 inches, tele; 25-1/4 x 33-2/3, wide angle, (play only), 7.2 mm/sec lines, camera; 260 lines, recorder Play speed select: automatic S/N, video luminance: measured—48.6 approx., not including macro range Still frame: yes, with slight noise dB, unweighted; 49.9 dB, weighted, 55 Minimum illumination: rated—7 lux; Frame advance: no dB weighted with sag compensation measured—9.2 lux for 50 IRE units Slow motion: no S/N, chroma AM: measured—44.6 dB Auto focus: yes, switchable to manual Speed play: no S/N, chroma PM: measured—43.2 dB White balance: auto, switchable to man- Rapid search: see Cue and review Audio frequency response: 31.5 Hz- ual with continuous rotary control Cue & review: 5x, approx., with 3 small 20 kHz, +2.5/—3 dB, down 4.4 dB at 20 Iris: auto, switchable to manual with con- noise bars tinuous rotary control Visible FF and Rew: no Hz Fast forward/rewind time: rated 6 min S/N, audio: 60 dB Sensitivity: single range for P6-120; measured 5 min. 35 sec. for Audio distortion: less than 0.4 percent Viewfinder: fixed B&W CRT with on- P6-120, 4 min. 4 sec. for P6-90 Overall picture quality: excellent screen indicators for battery condition, Audio quality: excellent, 8mm counter/time remaining, counter memory Remote pause: yes Remote: wired pause standards on, date, and time, plus an LED indicator Separate eject: yes Ease of operation: very good/excellent for recorder running that flashes when the Counter digits: 4, switchable to time Overall performance: excellent remaining battery is low Auto fade: no Counter memory: yes Program start locator/index/cue: no Audio dub: no Video dub: no operation, turn on the power, and insert a eyes, especially ifother people also use the it into the back of the camcorder when camcorder. needed. Ease of operation is rated as very cassette. To check that all the auto sys- good/excellent only because we find tems are on, point and zoom for the correct If you want to record from another camcorders with shoulder rests more com- composition, and press run/pause. The source or play back through a TV, you fortable, especially for extended shooting. transport controls can be used to play back must use the supplied adapter. You might The controls must be learned by position tapes through the viewfinder. Remember even want to leave the adapter permanent- rather than by texture, as with some other to adjust the viewfinder magnifier to your ly attached to your other gear and only plug OVnEoRwNIGaHvTaiDaEbLlIeVERY 6.1 ORDERS ONLY S0Q-223-7974 PHOTRON WILL BEAT ANY LEGITIMATE PRICE! TO ALL 50 STATES N.Y., ALASKA OR INFORMATION CALL (212) 221-1011 ) AND PUERTO RICO CAMCORDERS Panasonic. SONY VIDEO ACCESSORIES CAMCORDER ACCESSORIES aa ia 3 5 AMP HOUR BATTERY VIDEO TRIPOD 69.95 40 AMP HOUR BATTERY CAMCORDER CASE 39.958&UP NEW AG 1950 #|SLH 1000 CALL! CALL THE CAMCORDER SPECIALISTS! SHOURNI-CAD VIDEO LITE 59.95&UP AG-A95 EDITOR !|BMC 1000 CALL! * BEST PRICE ANYWHERE PV1364 FOR TAPE'REWINDER WIDE ANGLE OR TELE. LENS 49.95 PV1360 249.95 ‘ CALL PRICES! TELE CINE CONVERTER 2 HRBATTERIES 49.9&5UP * FASTEST DELIVERY PV1364 299.98 vise2349.95 PV1461 GENE@@R) EALECLTRIC CHARACTER GENERATOR CALL! P1560 * EXPERTS TO HELP YOU . 299.95 PV1562 Rereeniie gaves|. CALL FOR PRICES! ON YOUR SELECTION PANASONIC PV-100 ACCESSORIES FOR GE CONTROL CENTRAL CCR 500 $ 89.95) CREATIVE RESULTS REMOTE CONTROL IF YOU REQUIRE ASSISTANCE IN SELECTING A |pCA CPR 100 (7) | MINSLA 5 CALL! ASPMYBISCCOOPESUPER DUPER ‘ Canon CAMCORDER CALL (212) 224-1011 AND ASK |HiTACHI VMC 50 299.95 VMT390 CALL! MV 60S C;ALL HIDEANGLE LENS PERSONAL FOR CAMCORDER SALES ADVISER. YOU WILL |GE 9740 RECEIVE COURTEOUS EXPERT ADVICE. MAGNAVOX 8297 451799..9955. VVMMTI5S9750HF .! @PelyY COPIERS 744.e95 1) IVC GRCT 459.95 vMT400 569.95] MVS ~|SPECIAL EFFECTS KIT VHS ays (| | UVC GRCY 5 feet SS ZENITH VM 62000 Jvc MODULAR VIDEO SYSTEM MINOLTA CR 3000 S 509.95, HROS7O !| CALL FOR PRICES! TOSHIBA SK 60K ! Renae SecEe VIDEO VENTURES, PANASONIC PV 220 Hot 888.95 |NEW SONY 8MM LOWEST PRICE! rses LOWPMEICES#T50069 SUNPAK289.95 HRD170 ~ |SREEGN.TACLRETAAPTEORSTABILIZER PPAANNAASSOONNIICC PAVG 310505 HHQO 11112999..9955 CCD-110 SEG. COLORIZER AUDIO VIDEO PROCESSOR PANASONIC AG 160 CALL! |SONY CCD V8 AFU NEC VIDEO LIGHTS SCPOELCOIARL PERFOFECCETSSSOCRREATOR PERSONAL COPIERS CCAALLLL!! 9D6x1 2000 1] SUNPAK 3001 WORLDS OLYMPUS VX 403 1169.95 | SONY CCV3-AF CALL! |FIRST AUTOMATIC SPECIAL 11]] PPCC--S5L 544999..9958 PPCC--2205 567899..9955 ZENITH 7100 LOW, LOW PRICE |CANON VME-4 HITACHI VM 5000 1069.95 |CANON VME-2 TOSHIBA TAMRAC BAGS SHOWMAKER AMPLIFIER ! Canon RCA CMR300 PRO-WONDER 1079.95 |KYOCEPA FINEMOVIE CALL! DX7 FAXPHONE 10 ——_—589.95| GALL! Lt |SHOWMAKER SWITCHER ULTRA LOW PRICE CALL! PENTAX PVC 55A CALL! |KODAK 3460 aes HITACHI ‘ KIWI BAGS MINOLTA CR 1200 AF HQ. LOW PRICE |KODAK 5460 CALL VT 1570 CALL WE ARE THE NATION'S FOREMOST VIDEO TRIPODS GE VC 9610 CALL |OLYMPUS VX 804 VT-A400H.Q 344.85 VT-1310A H.0339.85 DEALER IN KIWI BAGS CALL! _ _}SLIK 142V 59.95 SLIK 212V IVT-1400A H.Q364.85 VT-1720H.Q 549.85 LOWE PRO QUASAR VM 20 HQ. 1149.95 |MINOCLRT80A00 S BOGEN 3124 FLUID HEAD 89.95 |NEW POLAROID SPECTRA MAGNAVOX 8293 CALL! |PENTAX PVC 800A 439.95 |MINOLTA MAXXUM \\VI-A450A H.0.429.85 VT-1800A H.Q CALL! |ACTION PAK NEC V30 PRO CALL! |NEC EM A8U BOGEN 3140 FLUID HEAD wars . ]} | FOR SAME DAY SHIPPING SEND CERTIFIED CHECK OR MONEY ORDER SHIPPING BUSINESS HOURS: MON, TUES, THURS. 9:00AM-7PM — Photr2o56n WeMstar3k8tehtiStnrgee,t Inc. /| || CHHAANNDGLEISNGF&ROIMNS SUAPDPDLI'ETRS L_NFORTEERESOFPFOENRSSIBLMEUSTFORBE TRYEPQOUGERSATPEHDIC ATERTRIOMERSOFORORPDREIRCE WFREID.. 9:90:00A0MA-M2-.60P0MPM SUN. 10:00AM-5:00PM c& New York, N.Y. 10018 NY CONS AUFSFA #W8A0R0R4A5N4TY SOSLMIEGHTPLRYICEASDDNINLCLOUNDESOMREEBAMTOEDSELS RETAIL & INFORMATION SERVICES C.LOSE 1 HA. EARLIER C1SRcNiaFoaieone2dnr.rfda6cdvoidl.irteecmireaotniaoln, 86 Video April 1987

Videotests FREE camcorders. track is 31.5 to 20,000 Hertz, +2.5/-—3 VIDEO STORAGE CASE Performance. The CR-8000S AF de- dB, and drops only 4.4 dB at 20 Hertz. TO BEAUTIFY AND Audio S/N is 64 dB with an additional 8 dB livers one of the most detailed pictures of headroom for a total dynamic range of 72 PROTECT YOUR available from consumer camcorders. Hor- dB, and total harmonic distortion is less VALUABLE TAPE izontal resolution is 260-plus lines from the than 0.4 percent. Such performance is ex- recorder and a smidgen more from the cellent by 8mm standards but a little lower Your Imprint Here Soft camera section. The video signal-to-noise than Beta or VHS Hi-Fi standards. Vinyl ratio, too, is among the best available from 4\\ines oF \\ess Construction consumer equipment: 48.6 decibels, un- Conclusion. The Minolta CR-8000S weighted, 49.9 dB, weighted, and 55 dB, AF carries a suggested price of $2165. We Available With Gold Foil Imprints weighted with sag compensation. Chroma were prepared to look elsewhere until we @ .35¢ Per Line Per AM S/N at 44.6 dB and chroma PM S/N at saw its astounding picture quality. Then it or Without Case Additional 43.2 dB are also at or near the head of the became a matter of deciding whether the \\mprint class. Picture quality is unquestionably ex- extra level of performance is worth the Min. Order 6 Cases cellent. extra cost. We recommend it highly, but Clear Vinyl @ .35¢ Price. Less you'll have to decide whether its price is window for Than 6 Case Min Audio quality is just a step behind. Audio justified. $2.00 Per Line. frequency response from the mono AFM Easy Labeling Video Tape Is Nested Securely inside Radio Shack Hi-Fi VHS VCR Radio Shack, with the scan sequence. The Model 42 features Made Strong The Suggested a simplified set of controls, and lacks more to Last Long Att more than 7000 sophisticated options like on-screen pro- Retail Price of gramming. These Deluxe |) ANZIPAE @)_\\ | stores in the 50 Description. The Model 42 is a slim, Case are black machine measuring 3-5/8 inches high $3.95 Each (771777| || states, may have by 17 wide by 13-5/8 deep and weighing just 16.3 pounds. At the top left of the front | | SST /| the most popular panel are the power and eject buttons and the cassette hatch, which has an audio in- X12.)7 VCRs in the US. put level/Hi-Fi tracking display. Near the middle of the panel are indicators for auto Sg One of its newest play and auto repeat, and the main display. decks is the Model Underneath are buttons for TV/VCR, Dust and quick timer recording, clock/counter swap, Moisture Tight 42, a VHS Hi-Fi machine with HQ circuit- Made inU.S.A Snaplock Closures counter reset, counter memory, and chan- ry, MTS and SAP sound, and a 14-day/4- nel down and up. Transport controls are in SATISFACTION GUARANTEED OR FULL REFUND three rows at the top right. event timer. It’s similar to Radio Shack’s NEWEST SUPER DELUXE VIDEO CASES The lower half of the front panel, from earlier Model 41, a deluxe VCR that also left to right, has a stereo headphone mini- Made of attractive leather-like 10s0oft%vinyl. The jack, a rotary control for the headphone, a ultimate in quality, design, workmanship. These has stereo sound, a sophisticated music sensor for the infrared remote control, indi- Cases are not to be confused with hard plastic, less cators for Hi-Fi, stereo, and SAP, and a expensive cases on the market today. *Free Case search system, and a more complete re- slider for Hi-Fi volume. given with every order placed from this magazine. mote control. An adjacent compartment has most of CUSTOM MADE FOR VHS OR BETAMAX the remaining controls, which include The Model 42 has a few unusual fea- Color Code Your Titles, Five exciting decorator colors... Brown Leatherette, Light Blue, Red, Black tures. In auto play mode, the VCR auto- and White matically plays any cassette with the safety ORDER TODAY! OFFER LIMITED SATISFACTION GUARANTEED OR FULL REFUND tab removed. At the end of the tape it SAVE © $3.95 Retail Value © SAVE rewinds automatically, ejects the tape, and 6 @$1.98EA. © 12@$1.88EA. © 24@$1.78 EA. © 46@$1.73EA. © 96@S$1.68EA. e turns off the VCR. Auto repeat rewinds the 192 @$1.63EA. © 240 @$1.60EA. © 300 @ $1.56 EA. tape and automatically repeats play. The 32-preset, cable-compatible tuner picks up cable channels Al to A5 and A to W, memorizes channels in any sequence, You May Mix Colors Of Deluxe Video Cases and deletes unused preset positions from O) VHS C) BETA # Red A Blue 8 Black # Brown # White Place imprint instructions on separate sheet Cases @ Each =$ Foil Stamp @ =§ Shipping Charge Only $2.00 Handling Charge C.0.D. $2.00 IL Res. Only add 7% Sales Tax Outside Cont. USA add 20C per/cs. = $ TOTAL $ DIACO SALESDealer Inquiries Welcome — Very Competitive Prices 1000 OAKTON BOX 1937M_ Des Plaines, || 60018 oar -CA1-L8L00T-O75L2L-7F7R7E7E §=—7pays ADay in tit. (312) 966-0044 A Week Please Rush (_] Order {_]More Information Name us Address City State Zip Phone Payment Check ©) C.0.D. $2.00 Extra OD Mst.Cd./Visa Am. Expr. Exp. Dt. ‘9UJB“/1UPO0Ia/eZION4UIp9ENONe9DeIaAJUSYIUPOPJeU! Radio Shack’s Model 42 is a less sophisticated version of the popular Model 41. Card No. $3.98 VALUE LOW AS $1.56

DATA Test Report: RESULTS & RATINGS Date of test: January 1987 Radio Shack Model 42 Horizontal resolution: 230-240 lines, Suggested retail price: $600 VHS Hi-Fi HQ VCR with MTS Stereo Weight: 16.3 lbs. measured Dimensions: 3-5/8 x 17 x Counter memory: yes S/N, video luminance: rated—45/44/43 Program start locator/index/cue: no dB, SP/LP/EP; measured—46. 3/47. 3/46. 2 13-5/8 inches (h/w/d) Audio dub: no dB, unweighted; 47.7/48.5/47.6 dB, Power requirements: 120 VAC, 60 Hz Video dub: no Auto rewind: yes weighted, SP/LP/EP Power consumption: 26 W Linear audio: mono S/N, chroma AM: 45.2/43.2/40.2 dB, Tape format: VHS Hi-Fi HQ Hi-Fi audio: stereo SP/LP/EP Tape speeds: SP, LP, EP Tuning method: 32-preset frequency S/N, chroma PM: 44. 1/41.9/39.7 dB, Play speed select: automatic synthesis SP/LPEP Channel selectors: up/down rockers on Audio frequency response: rated—20 Still frame: yes, somewhat noisy both VCR and remote Hz-20 kHz, Hi-Fi, all speeds; 80 Hz-10 Preset method: select/skip from 32- Frame advance: no preset memory, set display number kHz, SP linear; 80 Hz-5 kHz, LP and EP; Slow motion: no separately Speed play: no Broadcast tuning range: 2 to 13, measured—20 Hz-20 kHz +1.3/—2.5 dB, Rapid search: see Cue & review Hi-Fi all speeds; 80 Hz-8 kHz, —3 dB, 14 to 83 SP; 80 Hz-5 kHz, —3 dB, LP; 80 Hz-4 Cue & review: 5x/7x, SP and LP; 9x/ Cable tuning range: 2 to 13, Al to A5, kHz, -3 dB, EP A to W S/N, linear audio: rated and meas- 15x, EP AFT: no, manual fine tuning during preset ured—40 dB, SP; 38 dB, LP and EP Visible FF and Rew: no selection Dynamic range, Hi-Fi: 78.2 dB, Fast forward/rewind time: 4 minutes Channel lock: yes approx. for T-120 Timer: 14-day/4-event (including every measured day or every week) Audio distortion: less than 0.4%, Hi-Fi; Remote pause: no Auto channel-change: yes Remote: IR wireless with buttons for Accessories: remote control with batter- less than 2.1%, linear ies, 75-ohm antenna cable with built in Overall picture quality: very good power, TV/VCR, channel up/down, re- transformer, 300- to 75-ohm transformer, Audio quality: very good/excellent, cord, pause/still, stop, play, rewind 300-ohm twin-lead Hi-Fi; average/good, linear (search), and fast forward (search) Ease of operation: very good Separate eject: yes, with auto eject at Overall performance: very good end of auto play and during power off Counter digits: 4 switches for the audio level/Hi-Fi tracking are the SP/LP/EP recording speed switch tions from the scan sequence. meter, auto repeat/auto play, audio and a rotary tracking control. In addition to selecting channels with the Hi-Fi/regular (linear), and the left and right audio channels. A tuner mode switch has The top of the Model 42 houses the tuning buttons, you must set the channel positions for mono, main/stereo, and SAP. tuning compartment. Inside, a tuning display separately. Buttons set the left and A pushbutton selector cycles between the switch with positions for UHF, VHF, right digits of the channel display and mem- tuner, simulcast, and auxiliary inputs. At CATV, and off allows you to reset the orize chosen channel settings and display the top of the compartment are buttons to channel numbers. Plus and minus buttons numbers. For cable channels, an additional set and program the clock. At the bottom let you fine tune the channels, while the button lets you illuminate or extinguish the skip buttons let you remove preset posi- CATV designation on the display before THE DIRECT LINE TO SU PER DEALS 1-800-524-1596 24-HOUR PROCESSING. ..24-HOUR SHIPPING SUPER FAST DELIVERY RED LABEL 1-day delivery, extra charge WE SELL VCR's, Video Cameras, TVs, Monitors, BLUE LABEL 2-day delivery, extra charge Answering Machines, Telephones and Accessories, 24-hour processing/shipping on Red Label and Blue Label Car Audio, Industrial Equipt., PalSecam-NTSC, 110/220. 88 Video April 1987 Super Low Prices on Panasonic. SUPErR ah INC., 245 Paterson Plank Road, Carlstadt, New Jersey 07072 For additional information, circle No. 26 on Reader Service Card.

Videotests to-noise ratio was above its rating at 46.3 RGA VCRWHY YOU SHOULD BUY decibels at SP, 47.3 dB at LP, and 46.2 dB pressing the memory button. at EP. The overall result is a very good VV; The small black remote, powered by picture with little noise. DISTRIBUTORS two AAA batteries, carries only the most The Hi-Fi audio was very good with a COMPLETE LINE of RCA recorders & basic controls: power, TV/VCR, record, frequency response of 20 Hertz to 20 kilo- camcorders as well as lights, tripods, battery pause/still, stop, play, rewind (search), Hertz, +1.3/—2.5 dB, with a 78 dB dy- packs, and other video accessories. fast forward (search), and channel up/ namic range, stereo separation over 65 FAST SHIPPING 24 hrs (in most cases) down. dB, and a total harmonic distortion of less NO SALES TAX ADDED (except in Va.) than 0.4 percent. The linear audio was MAIL-OUT SPECIALS for previous Operation. Few controls help make slightly below its audio frequency response customers only! operation simple, but simplicity can be tak- rating at —3 dB but within it at 4 dB. At 3 VIDEO SPECIALISTS - We help before en too far. We question the unprotected dB, the SP response was 80 to 8000 Hz. and AFTER the sale. record button, which makes it easy to acci- dentally record over a tape you want to LP response was 63 to 5000 Hz, and EP RCA RECORDERS keep. At least on the remote the record response was 80 to 4000 Hz. Audio S/N VMT385 VMT390 VMT395 VMT400 button is partially recessed. Setting the was measured as 40 dB at SP, and 38 dB at VMT590 VMT595 VMT630HF VMT670HF tuner and programming the timer are LP and EP, with a total harmonic distortion slightly irritating as well. We’ve used sim- of less than 2.1 dB. Linear audio was aver- pler systems. age to good. The convenience of auto play and auto Conclusion. Radio Shack’s Model 42 repeat is worthy of high praise, as is the simplicity of the mono/main-auto ster- has fewer features than the Model 41, eo/SAP tuner switches, input selection, and playback. SAP, when selected, is re- which it replaces, yet it carries the same corded on the right Hi-Fi track while the suggested price of $600. Nevertheless, it main channel (mono) is recorded on the left provides pleasing picture and sound quali- Hi-Fi track and on the mono linear track. ty. You'll also have the service support of the huge Radio Shack chain. It will even sell Performance. The Model 42 offers you a three-year extended service con- about 240 lines of horizontal resolution, tract and provide an extended payment and HQ circuits provide detail and sharp plan. That sweetens a package we can rec- edges. Overall, the pictures are clean and ommend for all but the feature-crazed. crisp. Unweighted, the video signal- Canon 8mm Camcorder |I Canon is introduc- inputs and outputs, a video/RF output switch, and a line/camera input switch. mas ing its third genera- tion of 8mm ma- Options include a wired remote with an BhdereLWIDEQD)| chines and its sec- LCD display and complete transport and TES) T |] | ond camcorder, the RCA CAMCORDERS Smee, Canovision 8. Its counter controls, a character genera- CMR300 and... . NSIT many accessories tor/clock/stopwatch with 10 pages of mem- RCA SMALL 2EE WONDER CAM- will make it one of ory, a super directional microphone, and a CORDER CPR100 variety of accessories. NOW AVAILABLE! the most complete 8mm systems. Included The camcorder has very simple controls To place your order with a company who with the machine are a 100-minute battery, offers CUSTOMER TECHNICAL ASSIS- with wide angle/telephoto buttons on the TANCE before and AFTER the sale, AC- AC and charging adapters, a strap, and a side, instead of the handgrip. This depar- CESSORY SUPPORT for their products and ture discourages zooming, the overuse of who specializes in. . . compact RF adapter with video and audio relax»EXCLUSIVELY CALL fx: 1-800-368-5020 In Virginia 1-804-595-2572 MEMBER Hours (E.S.T.) : Bank Ref: Mon-Fri f Bank Of Virginia Virginia Peninsula Chamber of Commerce a) C0 D a VISA ‘MasterCard VIDEO DIRECT DISTRIBUTORS ‘aGJU4PO/UdZ0aeIlNIO4UpUeNOeIaI}DaaZeySIWPOpJeU) 116 Production Drive 10) o/c 0103 The Canovision 8 is a flexible recording system with good picture and excellent sound. April 1987 Video 89

which plagues many homemade tapes. The with the electronic viewfinder (EVF) but place. At the front is a jack for the EVF. other side controls are well-spaced and dif- without its 0.7-pound battery. It is 6 inches The optional character generator goes be- ferentiated by texture. The playback con- high by 5-3/4 inches wide by 11-3/8 inches tween it and the EVF. The lens has a man- trols on the top panel are closer together. deep, minus the clip-on battery. It has a ual focus ring and a lever sticking through a As you may have gathered, the Canovision stepped profile with a viewfinder sitting slot in the cowl that is the only access to the 8 emphasizes ease and flexibility. across the top step, and a molded grip on zoom ring. Pulling out the lever shifts the the right. lens into the macro-focus range. The pro- Description. The VM-E2 is black and trusion below the lens houses the auto fo- The grip has a run/pause control under cus mechanism; the auto-focus sensor is grayish blue with cheerful touches of red, the thumb. A strap holds your hand in green, blue, and gold. It weighs 3.5 pounds DATA Test Report: 100-min battery, AC adapter/charger, Date of test: January 1987 Canon VM-E2 8mm Camcorder Kit charging coupler, 30-min. cassette, au- dio/video/RF adapter, and carrying strap; Suggested price: $1699 Auto fade: yes optional — 100-minute batteries, car bat- VCR controls: all, unitized tery adapter, remote control, super direc- Weight: 3.5 pounds, without battery; 0.7 Microphone: fixed electret condenser tional mic, character generator/clock/ plus external mic jack 10-page titler, EVF extension arm, chest pounds, with battery pod, mic boom, lens kit, tele and wide an- Jacks: external mic, earphone, multi-pin Dimensions: 6 x 5-3/4 x 11-3/4 inches wired remote, and multi-pin audio/vid- gle converters, filters, 15-min., 30-min., eo/RF input/output 60-min., 90-min., and 120-min. cassettes, (h/w/d) : hard and soft cases Tape format: 8mm Power requirements: 6 VDC Tape speed: SP, 14.3mm/sec RESULTS & RATINGS Power consumption: 7.5 W. approx. Play speed select: fixed Horizontal resolution: measured — Still frame: yes, with slight noise 270 lines, camera; 240 lines, recorder Image sensor: 1/2-inch solid state CCD Rapid search: see cue & review S/N, video luminance: rated — 47 dB; measured — 40.8 dB, unweighted; 43.4 Lens: {/1.2, 6x (8 to 48mm) power zoom Cue & review: 5x, approx. dB, weighted, 45.4 dB weighted with sag Fast forward/rewind time: measured with macro capability + 5 min. 35 sec. for P6-120, 4 min, 15 compensation Filter diameter: 46mm sec. for P6-90 S/N, chroma AM: measured — 42.7 dB S/N, chroma PM: measured — 42.4 dB Minimum focusing distance: 3.9 feet Remote pause: yes, through wired Audeo frequency response: 31.5 Hz- remote 20 kHz, +0.1/-3 dB, down 6.0 dB at 20 Field at closest focus: 4-1/4 x 5-2/3 Remote: optional, with LCD coun- ter/function display and buttons for power, Hz inches, tele; 23-1/4 x 32-1/3, wide angle, record, stop, pause/still, play, counter re- S/N, audio: 64 dB Audio distortion: less than 0.4% approx., not including the macro range set, tape return, and a fast forward/re- Overall picture quality: good wind rocker (search) on a 13.1-foot cord Audio quality: excellent, 8mm Minimum illumination: rated — 8 lux; Separate eject: yes standards Counter digits: 4 Ease of operation: very good/excellent measured — 15 lux for 50 IRE units Counter memory: yes, return to zero Overall performance: very good Auto focus: yes, switchable to manual button Program start locator/index/cue: no White balance: full auto, switchable to Auto rewind: yes Hi-Fi audio, AFM: mono one-touch auto for indoor or outdoor Accessories: supplied — EVF with mic, ranges Iris: auto (at center click stop), switch- able to manual using rotary control with on-screen indicator Sensitivity: dual range Viewfinder: clectronic—detachable 0.7-inch B&W CRT with on-screen indica- tors for iris, recorder running (orange), white balance (green), and low battery or tape TRi STATE CAMERA CALL1T-O8LL0F0R-EE221-O1RD9E2RS6 ONLY 160 Broadway New York, N.Y. 10038 (Between Liberty St. & Maiden Lane IN THE HEART OF THE FINANCIAL DISTRICT) FREE SUNDAY PARKING (212) 349-2555. For Alaska, Hawan. NY Orders Open Weekdays 9-7. Sundays 10-4 Fr information call (212) 349-2555 Camcorders (HQ) PANASONIC (HQ) RCA (HQ) 4VC (HQ) SONY CANON ee oe COPRMalaiCnynnACSCpPoPvmoMvCne2MVtpR3L2.T2a2u00RR.000HsU2.I00QH0.O0...q811Ve81799998oMd959989984Eg9999990.g-.......e9@19999999.5.s5555558 VVVVVVWVVVVEMLMMMMLLKKTTTTTTTTTPPSO263336299OO82899S095GO55505”O005HH....H...FF....F...2.....................312344B6563225914Y88428.9999M99999.9...N.....9999G99999555555*5555 Pentax HO CALL PPPPPPPPPvVVPVVPVvVVAV1V1I11111GI353377315ES663446446SG2000200544R.R|2........3................8.,.......U.i9Li2.32a6652a6245978s9Ct9994999SpA.......5.L9999:999955L855558 VLP300.... 289.95 HHHHGMHHHGGRARXRRXnRRXDNDDSoDNDSN-5-52786860T1111.05.608904...0..002o....................e......... .)256643453T238a2458176,A9999999999..........A9999999999G5555555555s: SSSSCSo2SSHLLLraCLLL2MHHHnDHXHHFCFFpdV3F748FFOoy0558IR450500ce-0...05a0eA.0..m00K...F0-..8.........34.73.4277889(1990484793408.9999999.9.9....,..998.999999955595555555)5 VVRR--G400 454809..0955. T1C0HE uae VVLLPP990500........ c5a8l9l.95 VVCC--5400 911599.,9955 MAGNAVOX Sony CCDV8 GXN-90 .... 719.95 BMC660K .. 919.95 VLP970HF.. 649.95 GZReCn-i7th.6.2.0.0....1193899..9955 CCCO0V-1310....1199C.A9L5L TVVVoCRRs-HHh2FiE0-bS0a7PO2E0CD0XI0-A7L:S. 449.95 VVVVVVRARARR9EGG995RS55S2SI9560SS080 ....229.95 468489..059)5» .».+. ........... 4e2259T7869h884...-8999e8555e VVVMMMTTT566937500.HH.FF..5.. 156386.99.9.99555 Fisher ahd mts agg.g5 yeOOD CALL PV5800 .... 289.95 VMT590.... 419.85 199,95 OLYMPUS =Co1m517218D./.D..... 129099..9955 Pv8500 ........ 399.95 oe 41, Kodavision-MVS sys. VC105 349.95 HRD470.... '499.95 pvg600 449.95 cone ee ae Pvg6u0 .... 609.95 '' Sony BMC-660 ............... 673338999...999555 Zenith51400I.T..ACHI CALL | SFeoocnurys tCUanpdesruwl—aetera-ny8HoAuusteto-o || cCoamnpolnetPpeCc1200 495696499...999555 VVVXCX331000876..... 42.479939.9..999555 919.95 PPKK995890 CCCP0R31000.....959899..9955 Sony CDV110 PK450 VTBP 399.95 | PC25 .679.95 VX 403 CALL 1199.99 NEC PKAS2 ial 309.9 VT 87A..... 479.95 5 veers on iit All items subject to slasats iosmenecioniee tee ati may be additional. Mail cua Wie oy oe Bone! Pecan itachi peo and phone orders COO Master Charge. VISA. S&H extra Everything Factory Fresh 10 sae ‘ ;' VVMM25100000A .. ....1,084599..9955 Day Money Back Guarantee S&HNonotn-rreestupnodnasbilbele for ny ta anal errors 9Dx6210H0O01on....... . 667349..9955 —PV100 999.95 For additional information, circle No. 28 on Reader Service Card.

For Visa or MasterCard Order VIDEO Division of D.B.M. International Dial Toll Free (Orders Only) $19.95 For Information/Local 800-223-6119 ys) (212)695-0697 RECORDERS ACCESSORIES CD PLAYERS GE CONTROL PANASONIC 1000W Video Light . 39.95 ‘ive BONEER 2000W Video Light 1 129.95 CENTRAL PV 1360 199.95 PV 1564 434.95 Azden—-WMS-1 0 ah! 4 XLV440 189.95 PD-7030 259.95 PV 1361 239.95 PV 1642 574.95 XLM700 339.95 PD-M60 289.95 PV 1363 CALL PV 1742 729.95 eae SONY TECHNICS PPYV13169485 25B4A.L9C5P ePVy E8660000 4s5o4s.o9,5 JSIMA .. Pe: Sony HSJ-600 129.95 SLP100 179.95 § PPVV 11456610 324949,9955 AAGG 26440000A 1532999.9955 |PAVE LENS AMBICO Eee PV 1563 399.95 AG 1950 929.95 eu liped IE BepUSL aad Assis $AA107h9.9S5ah PANASONIC INDUSTR. MAGNAVOX 8293 VV--00117000::AACC-DC.. 46.95 V-Bu. .DAMP.... 59.95 WALKMANS SONY 59.95 V-0806 Kit 99.95 AIWA * CCD IMAGE DEVICE RCA V-0180/AC 29.95 V-0810 Decat... 76.95 Aiwa HSJ-600 .129.95 WM-F 100 179.95 ¢ BATTERY CHARGER V-0817 Kit ° BATTERY MT 385. 279.95 VMT 590 Maes AG 39.95 VV--008B1179Kiktit 109.95 HSJ-600A 149.95 WM100 94.95 * CARRY STRAP VMT 390 319.95 VMT 595 115359..9955 ¢ RF CABLES Control VVMMTT 349050 330799..989.5’ VVMMTT_667300 V--00210900//ADCC-DC. 4649..9956 SVu-p0e68r0 Duper... CALL HSJ-500 97.85 WM-F75 94.95 V-0820, V-0821. V-0822 aTele Slid ; CCAALLLL WM-F 200 149.95 °° RAFV CONVLERLEn 2344..9955 GALL WM-D6C BiGhe Central VVo-l0t 35me3ter 45196..9955 V-0614 e AIC ADAPTER Remote. JVC Hes57.95 SE HRD 180 284.95 HRD 570 VTeolesCsi en p27i.a9l5 VIDEO TAPE T120/L-750 MIQUASAR VMz0 ......1250.00 RALIITIES54 1s sireV-0612 vase39.95 Somytisp. 339 Hosts. 82sSony L500 .. «In Stoc! HRO S4o7.0. 9.98 HAO 100 39.95 3.39 FujiT120. 3.95 + FULL REMOTE CAPABILITY SONY Tripod V-0516 179.95 Tripod V-0516.. 11495 L500 UHG 4.49 HRX451....... 8.39 V-0530 89.95 V-0525 71.95 L750 UHG 4.79 Maxell T-120 EX... 4.10 8 Vid SL-HF450 409.95 SL-HF-T7 V-0602 59.95 V-0604 42.95 PRO L500 .....7.25 1-120 HGX 4.95 SL-HF550 CALL SL-HF900 tV-0670 6d.05/° v-osgu, 74.95 8mm-90 .. 6.79 1-120 Gold 5.85 SL-HF700 CALL SL-HF750 V-0686 119.95 V-0692 9995 8mm-120 . 7.79 RX PRO T-120, .7.20 SL-HFR9O 334.95 SL-HF1000....1049.95 \\.ggg7 9995 TOK-T120Hi-Fi...6.29 TDK 7-120 4.35 v.0691 69.95 TDK-T120 Pro..7.59 1-120 EHG 5.50 FISHER 1160 Tape CALL Konica. CALL mm iaeo FFVVHH-4900060 CCAALLLL FFVVHH 995400 CCAALLLL ZWioroemlessMicMriocprhoopnheone 5599..9955 SCOTCH—Tt20/T-750 FFVVHH 991290 CCAALLLL FFVHHV 999800 CCAALLLL CFliossheeyeup Wide vie4w4.95 Macro 31910.5500 CCD Auto Focus $ PPPVVV---TTT331055AA0A THeleerLbensst(1.5GXe)re 89.95 Tele Lens (2X) 125249.59)5, eEGapus 4a.o3n9 EEXRGG-HIC-uFre PENTAX 1100737999..999555 _ W2_UST5lipetedlreceaeixatLlWeAinncdsgoeerlfdef.ecTteTsleelekiLteL23ne94ns..s0000KiKtit WS5i0deextLecnosrd.....115222494459...0099000550 95 =x° Mae Are* 432873C999...A999555NOPPPNeVVn--tCCaB5xO50AAc.ase... 8QG —UU_DDXSSLIIIIII--6-09600.. AUD111I...144O555 MMTTXXDA--K96P00SEA-60 Se 494699..9655 VVRR--HHFF 771200 + OLYMPUS-VX-801 VVCRS-OAH,F.600 ZCAELLNITSPH10 ..C.6A99L.L95 XaLrII-90Pea Be1.65 ApTtDiK-sSA-e90de P*EHNaTMAXOSPV-C5$5A1079.95 ELMO ECR-8 229.95 BESCOR AT&T PhoneRes 20 ; |.CSAhLeL Unidenee a GCAALLLL *¢ RBFATATEDRAYPTER _—— NIKON UN-800 VME-I! 259.95 VR 3220 ione-mate onair CHINON 534276579494....99995555 VVVVRRRM 4536113200000000. MINOLTA CR 8000 ForPrice ab sano PENTAX PVC-800A MAGNAVOX KLYOCERA KD-20100 VR 1810 239.95 9560 539.95 NC-2 59.95 WA-50 Lens 69.95 ¢ A/V CABLES VVVVRRRR 2211238820270000 san pitas 652621799999..9995555 Ha4PMeS-;S ¢ CARRY HANDLE 399.95 8278 999.95 vPeRsB.-o612 ti VViFO-eW35 S pone isa PANASONIC TELEPHONE & 7499.89.5 4499..9944 ANSWERING MACHINES Se SA/UCCUALDOAEPTHESRTAAR 233771994...999555 898254869575 PRB-10 CALL pais Tripod 2901 CCAALLLL EUFW1A-5L8ight 4599..9955 VVAA--88017200 3369..9955 KKXX--T2T13251..3.1_. 8732..9955 MINOLTA CR-a1200S.. .in Stock 599.95 TAP-25 CALL VL-100 44.95 VA-8200 39.95 KX-T2345 54.95 PENTAX PV-C55A 1139.95 84.95 Tripod VTR-90. 9995 VA-B205 54.95 KX-T2622..... CALL 59.95 VTR-F2 104.95 VKKXVAX-A--T-38T8143640008.501..5......612776932....99995555 KKKKXXXX----1TT12T14442222206.1.2....0............. 10C77563A...L999L555 hci RECOTON 89.95 1 379.95 V-622 89.95 V.615 CAMCORDE R é 377C99A8.L95L5 _VV--660[145AAVIDEO 13899E..9955NHV_V-A-68102N0 CERS14949..9955 KX-T3831.....93.95 KX-T1426 96.95 BATTERY Phone Mate Record A Call 4 AMP — 4 HOUR CAMERAS MFJ 1425 IN MFJ 1450 5000 61.95 690 79.95 PV 100 661755 5766..9955 $69.95SAFETY FUSE MFJ 1442 STOCK MFJ 1452 stock CC89070000 115144..9955 ee aPANASONIC VIDICRMFAF1T480 PK 959 679.95 PV-300. 1050.00.95. MFU 1445 CALL IVE-100 144.95 CALL 16795 K 980 CCU-120 Proc. AMP 219.00 Cc . 999.95 Detailer |i! 254.00 AV Process ...279.00 CANON COPIERS AMCORDER FOO CALL Stereo Syn... 149.95 PC-10 484.99 PC-14 539.95 Detailer V AV Switch VIDEO LITE \"| WV 3250 729.95 WV 3260 1089.95 IVE-200 CALL SEG-200 329.95 PC-20 539.95 PC-25 669.95 ZENITH 509,95 e AC/DC Calon.) RCA SANSUI VX 99 .. BEA< LL: | *PCl-:rereanessro10n9n.9e5 PC-5L BATTERY CHARGER ¢ Includes tecbon) Grnei00. faeanaes yten say Gabt TRIPODS ber leeagTAPE 250 Watt A/C lamp Jvc Surround Sound.......CALL} HeYaevbyo Duty Dolly DUB. CABLES 100 W$a6tt9.9D/5C lamp SONYGAcXcNe-s8sUories in St5o2c9k.95 GGRR--CC79UU 89C9A.L9L5 KIWVI-TENBA-LOWE PRO eee SUK HtAaNeDLeE ke pRBeMee-aE1ol0e0V 881468999...899555 1CCCCCODDO--NVMS191U0.....71951999999..99555 TACRrMeaicBmpoIeordCrdOae,BraBgasBBgaEsgSsCOR FFrroomm C334A4.L00L¢0 121212022VVVFFF “7464449..99555 333111313185 VIDEO TRANSFER TELE CINE 12.95 322VF 124.95 3127 oGroeks 2Caml “WE THANK OUR SATISFIED CUSTOMERS’ SAME NOT ONLY DO | VALUE YOUR HONESTY, BUT | DAY RFEOCREIMVEiD RTEHFEUNCDAMEFRRAOMIN 3ANDAOYTSH.ERI'M SMTAILILL WOAIRTDIENRG SHIPPING MOST SINCERELY ELMO A.C. -MARION, MASS SERVICING NEW Transvideo R8 New York Camera sonday-Friday9AM.-7PM. CONSUMERS NEW Transvideo S8 131 West 35th Street =Swe 04M-sPw. Pay hahaa eg TeCL-TGS BLADED) WORLDWIDE New York City 10001 (opposite Macy’s' St 160ETC SUPER 8 PCriAceLL c OSNENPDECRESROTNIAFLIEDCHCEHCEKCSK OSRHIPMPOINNEGY &OHRADNEDRLIFNOGR NIOMNME-DRIEAFTUENDSAHBILPEMENNTOST PRLEESAPSOENSAIBLLELF3OO0RWDATY'YSPOFGORRAPBAHNIKCACLLEEARRRAONRCSE aBuhl iBipnlexeMrultiplexer SOME PRICES MAY REFLECT REBATE CASE QUANTITY ONLY PRICES GOOD TILL 3rd OF MONTH ALLLPERICES 8 AVAILABIL! Buhl Adj. Proj. Stands SE HABLA ESPANOL TY SUBJECT TO CHANGE WITHOUT NOTICE CONSUMER AFFAIRS # 8000831 Pictures Tor Ills. Purposes Only. For additional information, circle No. 29 on Reader Service Card.

VARSS on the front. sensitivity switch, an auto fade button, and tilts, has a focus magnifier, and slides to the side for left-eyed viewing. An extension is The left side of the camera has controls arotary iris control which is automatic in its available. It has on-screen indicators for on a bulge near the front. They include center position. Behind the panel are the the lens opening, recorder running, auto buttons for the power zoom, record re- cassette hatch and the battery release. white balance, and low battery/tape end. view, and white balance. Further back is a The carrying strap loops at the top and white balance selector with positions for On the top are an accessory shoe and a automatic, indoor, and outdoor. When in- playback control panel with an LCD coun- bottom of the rear panel, and a tripod sock- door or outdoor is selected, the operation ter and function display. There are also et’s on the bottom. buttons for power, eject, pause/still, stop, is automatic. record, play, fast forward (search), rewind Operation. Shooting is a breeze be- A vertical slide switch has positions for (search), reset, and tape return. cause of the simple controls. But you'll have to get accustomed to two-hand shoot- autofocus, manual focus, and one-shot auto Across the front is the EVF with a mic on ing to use the zoom. The auto fade feature gives clean transitions to in-camera edit- focusing. Further back are a gain up on/off the right and an adjustable viewing hood. It ing. The optional tele and wide-angle lens- es and filters add flexibility, and special-ef- Orders Only: (800) 372-3700 fect filters can add multiple and star-like Ssm |ile P h oto babsini a 644-1998 ; images to your videos. The titler with 735 Lexington Ave., 3rd Fl., New York, N.Y. 10022 Hrs.: Mon.-Thurs. 9-6; Fri. 9-2; Sun. 10-5; Sat. Closed scrolling adds a professional touch, and the or1 140140 E. 59 St. opp.PP.Blooming0dales remote control lets you do everything ex- seen ke aT OF Write For Our Master Charge, Visa & COD's accepted. Credit Card accounts cept pan and zoom. It’s almost a one-cam- A, Ambico & Tee Gee Catalog!! charagtteidmeororder. Add shipping, handl&iinsnuragnce. Price PAL/SECAM SYSTEMS subject to change without notice. We are not responsible for errors. era mini-studio, a versatile system that can = canVeIbDEeOien&s: | nGENeERAL ELECTRIC VIDEO ACCESSORIES) VIDEO LIGHTS help you expand your creativity. Ease of PPVV--§11336605..P....A22379N9,.0A.000°SOPPVVN-i-11t3I46611C, ...235795,.50000 VR7120........269 eae ideo Light 300w 30O01MEG.A.....-.,56R.95 E3F002L..E. CT8A7-50 a operation rates very good/excellent. PV-1462...479.00 PV-1560...315.00 VR7150........320 ; at Video Camera Strap ..............14. 11000000ViFdCeo .‘.L.i.g9h5.t9.5 . 1002F $09..9058 Performance. The VM-E2 produces PV-1562...449.95 PV-1563...439.95 VR7215........299 Video Filter Kit ...... 2000 FC...104.95 500 P......264.95 VVRR7725302.0...4\"93895 VR7245........329 VViiddeeoo RHeeacdordCelreanBearg ..:.. 29, 100 FC......69.95 800 P.....:“661199..95 VR7400....625 VVRR737520.7..0...........457499 Video Telecine Adapter Light Stand os SLO po 24.rf50 good pictures with 240 lines of horizontal After Rebaate VR9610.....4050 Video ‘oPwoweerr PakPal ... .......... VVViiidddeeeooo ATWeCildeeLpighhtAontgol..e.. Le SUNPAK Reng 3000 (Manual 300W, AC)..... PPPVVV---181557604402..,......447689995...000000 PPPVVV---18B661401900.........544995949...000000 PVT30......,P.CEALNL TAPVTX35A.....CALL 3001 (Auto 300W, AC resolution and an unweighted video sig- 6001 (Auto 600W, AC)... PV-9600...699.00 PK-452 ....399.00 PVT150 CALL PVC11A ...949.95 Video AC-DC Light. nal-to-noise ratio of 40.8 decibels, a bit Extra Bulb..... PK-959 ,...699.95 PK-980 ....799.00 PVC33A ...999.95 PVC55A. CALL Azden Wireless Mik.e . #C1 OIOn LVid-eoLULiXght below its rating. Chroma AM S/N is 42.4 PK-975 ....499.95 PV-200 ....899.95 PVC800A ....CALL New Azden WMS-20 i CrC-4p444g6400 MlMiienniia--CkCooeoollreSAtCa/nDdCar = OLYMPIC PV-220 ....995.00 PV-300...1225.00 CANON Video Camera Ext. Cord... 9.9! a PV-100 2... + 1099.00 VVMMEE21..............949C.A5L0L VHRF-7i420y0...........6.8C9A.L0L0 MVViidedooeobFCiarmoerna Wide Tele Kit .....34.95 ==L, dB. Overall picture quality is good. : PRO VIDEO VC200 ...S....P..4E95CIVRA-10L..........349 ate eee It outperforms its published frequency AWWGVV23F42205.0.0.........,......CCCAAALLLLLL AAAGGG119A52Q09.5.5..........9.39.89C9.A.9L55L0 SCSiimmMaaounSCtoopuynCdakmiCteartcahAdapter’... WY2170. 698.957 WWRZB0BAFCALL , VHS Tripod/Dolly/Caddy ...... 99°95 14: response on audio and is flat from 31.5 to AG6R40C0.A....R.CEALCL OARG5DO0ER.S.....-CA|LL CAMOCNOLRYDER PVCeR eRasbbitAN.. ProsNe ‘607.:98 (044449946 2rtoaatmhpa,geBtEdLrT e2. ' 20,000 Hertz, +0.1/-3 dB. Audio S/N is a Vmt285....279.00 VMT295 995.00 Bunnies.. 279 C-4499 6.5amp. PACK ...........64.95 measured 64 dB, with a dynamic range of > VVMMTT39358.5....4.2.350.90.000 VVMMTT349000. 3..5.59290,.950 MSuclotticvhisi4o5n003.B1a.t.te.r 69,00 AMBICO 72 dB, and less than 0.4 percent total tee 429.00 VMT595 ...519.00 Scotch 2010 Batterry .. weve sad is ap Wate ee harmonic distortion. Audio is excellent by VLP900....359995..0000 VVLMPT967700.......7.1.9C.A0L0L AZDEN WIRELESS V-b0190....+..67.M56. 0 Ve-0i200..v.ee...48. 8mm standards. VNCLEMPWR8!20000.C.P..R..1.802099.99....9.0.50....CC.LM.C.R.032000...-.....19.195C90A..L00L00 FISHER g Microphone for Camcorders TRIPODS Conclusion. Canon’s VM-E2 is not just ACVDO16840..B.a.t.t.a.rCyALPLack..C.D.1.8..8.............1.0C4A.L5L0 sabi Saif sho kot - AMd. T&woVidCehoanCnaelmserafsor a camcorder but a video recording system. CWhiarrealcetsesr MGikeen ; “49998:.0000 | \"\"s TOS: HI a IOnpteerrafteiroennc,e, upFrteoe ‘ 9.95 122V1 63.9! MLuelntsi EVxotletnadgeer..A.C...A.dapter vi.,...8.5.1.080.000 4 1S0p0eciFaolot PRraicneg!e SviOdeOoVEV-70049D0o°ll0y8 M..3..2...2........ \"5098..95 It produces good pictures, excellent MM22133340..........225655..0000 5DX9-070..............651445..9005 722F Flow MotionVideo Head...59.95 4M4432000...........C..A30L9L.95 SDKX-630.......,....1304590..9050 = BOGEN :Batt. Connector srerseenee ne00 SANYO Tri od wilt d sound, and is easy to use. Accessories, HITACHI 1250........295.00 1900 .......549.95 3116 M 9 3131 ie Sa 95 VC1600....599.95 VT1570........529 B18 20998 3132 nase especially the remote, enhance its useful- Var 450-09 vriaso. 1 365 KODAK 33112220............,.,.91982..9955 33114305..............114649..9955 ay 33112243..............,1.0B98..9505 33114520.............1.91949..9955 ness and flexibility. Its suggested price of 909 3125.........99.95 3170.........69.95 $1699 makes it not much more expensive VVbTIc1Q14h0A0 HO236458.-0000 aVVTT1Ie381100 2 i822e099 AMBICOva than models without Canon’s creative aids. oe BO ns rei: o 585 VIDEO TAPES33115465 CDaoldldyy..8149..9955 33112575 SDoplrleya.de3r9.9.519 Given all the options, it is defintely worth 3126 Head .44.95 3063 Head. .69.95 HRD756 ..,.CAJLL Sag MeHGXRND6S370......4.47859..0905 |SS? au ANS HSEMMVVSS 35436800 ......9.4.8999 MMVVSS 53444600...,.1.0.79999 Decathlon NiGad Pak serious considerations. MVS 5360 ....790 MVS 5380 ....879 PMaaxnealsloVn1iI-c1D2T0E-1HO2G0.G.oTldAPES 3.9493 Bae SEHRD180...309.00 HRD570 .....CALL vs GALL M nthae |tec Come: IMNeGmoTre1x 2T0-1820 PsROe»ars. HRD470 669.AL9L8 T5Fei0lsieh6cpeih9yoe0teSuen iti HRD170....299.00 OLYMPUS )G Magnavox HRrS I1nd0us0tr.oiaal .iH8 VHS Camcorder ZENIT7 H ‘yOleympus HCelmoisesuppherWiicdeLvenisew.. . Vx-g01 SpecialEffects Ki Camcorder ele Slide Coverter . Son) TDK T-120 .......... VX402 .....999.95 VX403....1145.95 Super Duper Enhanci TOK tT120 EG +.. Super Duper Stereo » VX801 Rteiserarisree era cee Camera Power Supply. eee PRO Ede eet MAXXUM RCA T-C 120 HtGie. VR4100 . VR3100. ...474.95 PRO A5U00T0O/F7O0C0U0S/90S0Y0STEM Si‘gapneal BColeoasntinegr ..Syste Scotch 7T--112200.E.G. VR2300.... VR1810....279.00 3S3p°eciCaalmeErfafectEsxt,GeCnoerrda.t. Kodak World's most advanced SLR Magnavox has join- VR2220... ihe4 VR1820....299.95 TS Stereo Tune. Kodak VCR Care Kit... ed many of its col- leagues in the VHS M6200 ...949.95 VC-1100.....CALL Maxxum af lenses Tele Print Converter Polaroid T120..... camp with its re- lease of a Compact i a 4 Hai POC page)Ss EE a ES vidaeo SLioo Amy Ver. PolaroiPd90T.1..20HG .. VHS camcorder. “560.SONY 589.s9i5 Video Light Stand Sony P120 .. The new model 8MM VR8285AV01, dub- SSSLLLH11E0070O00..\".....9C.9.A.9..2L599.L595 SBCCLMDHCFEV7G15O100.......18..29.9C9A9LL | C AsmMn CCOamcRorDdeEr RS ...45.00 | WUFlniuisivdelrosHsaelasdtHarTrradinposCdaiite . ia SUNS bed the Video Escort, is the first of a new breed of camcorders with high-speed shut- SLHF-17...44-9A.A9Q5 PAK8...J.A.F.U.76.9....99599 Kyocera Wireless RMicEroCphiOTON COPIERS ters that virtually end blurry still frames. NEilkmoon E8CmRm 8mCma.m.c..o.r.der . V-622 MTS Stereo Decoder.......99.00 (VR8297AV01 designates the Escort kit). S9L5H1F0i.9.O.0.M...A.2.55G99.9.9N955 AC9VC5D20O.V.3X.........929499..9050 ||Aiwa CV-B0A . 999) Canon rsrsom The development is a major step in con- SHOWTIME red Ill. Si «cPC1}) cover’ sumer camcorders. If you’ve ever seen a still frameSLLLLHLeeMMeeLULLLLUUMUULOUULLTeLUUSeUT ee from a normal tape of fast action, . 9o5i5e5..:. E39y9.M00H 93556500... s5a50e.0H0Y VAWideoPrCoocleorssoPrro.c. ......... CCAALLLL MV-iS61I5SAMoStneoreoPrPorcoecsessosror. .. 1 you know the image shows as much move- GSA RR |Ganyae9525 289-00 8293... iga.00 |—System Switches RE | eavo GALL | V-612 Master Controller V-634 Fred SP- -C— ANON Video Writer .. “299.95 DOWER: cacti sdaasstrt Crear SOUS V-632 Fred SP-| 3 549.95 PC-10 “NEC Rests Stabilizer sien OALL \"549.95 PC-24.... 9t954e8n9aeve,.n9tABB e196r1y.9.e..2.e..8-.769419-.9165 TRR-,80700000 RVecCiReRveMAru..tB.i.B.y.i.I.n.gT..Sytem 68.95 esata AlBMe-lE$S5CROBRG.5: rBeUalTl pcerpeeteedAa V-30.00020.G9A9L9L5 0DXX-21000000......-...CCAALLLL VID CRAFT Lvs +10. ea Gosenn, : 7A NOL’ PC Cabinet... CR1100HQ999.00 CR1200HO..CALL 8%X11 Paper...... r MV 20S..,...CALL MV 60S......CALL 269 Steen Canon Fax Phone.......... AN Switch ....219 ours n....159 = MV 40S......CALL CR8000SAF .CALL SEG-200...329.95 AW Process 289 SANYO SFT-600.....CALL SFT-605.....CALL BO CR3000SAF...975 CR1000....899.95 Le ian ILSrn DnbnMebneeuntby TOM eM MMM eM MMMM eM MM MoM Mien Mitre niiia iii eH ULL SLL For additional information, circle No. 30 on Reader Service Card. 92 Video April 1987

Videotests small bar, rather than under your thumb at For playback in the viewfinder, press the back of the grip. It works well there. stop, rewind, and play, using still and The tracking control and the submini-jack search to help analyze your work. For play- for the remote control are in the rear. back on a TV, connect the RF adapter to the front jack. For playback on a monitor or Operation. The Escort is easy to use to dub to another VCR, connect the cord to but a little different from most other the same jack. The remaining operations camcorders. When you turn on the power, are equally easy. the camera is in stop mode rather than record pause. Select record speed, auto- Performance. The Escort has no in- focus, auto white balance, and press the puts for external video signals, so we con- record button to go into record pause. To ducted two series of tests: with video start shooting, press the run/pause. signals from recordings made directly Magnavox’s Video Escort GRAND CENTRAL CAMERAS ment as is in the sixtieth of a second it NEW YORK CITY, NEW YORK takes to capture one field. With the high- CALL TOLL FREE FOR MAIL ORDERS ONLY: speed shutter, you see only the movement 1-800-237-9971oyO“RNnNS that occurs in a thousandth of a second. 1 Wl7° IN NEW YORK CALL: 212 986-2270 FOR INFORMATION The fast shutter can make a speeding racecar stand still. It makes the dream of BEST PRICES ON COMPUTERS «: SLR CAMERAS : PORTABLE TVs :: VIDEO analyzing fast action available to consum- DECKS +: WALKMEN +: BINOCULARS ;: LENSES «: COMPACT CD PLAYERS! ers. It does, however, require more light to record. Normal daylight presents no ALL CAMCORDERS HAVE FULL USA WARRANTY problem, but supplementary lighting may be necessary indoors. Fluorescent lighting Panasonic CAMCORDERRS en Pro Wonder is not recommended. OMNIVISION Description. The Escort is a black and gray machine, weighing just 3.1 pounds 12 Pc. Pkg without battery and measuring 6-1/4 inch- es high by 5-1/4 wide by 10-1/4 deep. Itisa Camera 10. Lens Kit PV 100 CMR 300) CPR 100 Corry Handle boxy recorder with a molded grip on the Charger 11. Filter SI 048 ai . Lens Shade right side, and the lens springing from the Battery 12. Tripod 10. Lens Kit front of the grip. Blank Tape ANV Adaptor i fees2 tim11. Filter The main control panel is on the front of Dub Cables the recorder. At the top are switches for Corry Handle high-speed shutter on/off, SP/SLP record- ing speed, and power, anda record review Lens Cop button that shows the last two seconds of a ROBWLenRsRShadeD previous take. Along the right side are a switch for auto/manual focus, a button for PV 300 VHS-C AG 160 Pro one-shot autofocus that also changes the $1048 $998 focus zone, a switch for sunlight/auto/in- $1298 candescent white balance, and a backlight compensation button. In an indentation on JV VideoMovie yew’15 Fc. Camcorder the left are buttons for stop, pause/still, GRC-7_VSHS-C record, fast forward, play, and rewind. A \"Package multi-pin adapter jack is on the bottom of Weighs 2.9 Ibs 1.Camera the front panel. with power zoom, . Battery Full Playback & . Charger 12 Pc. Pkg. The left side of the recorder houses the HQ Circuitry Strap eject button, an LCD display with counter, $8981. Camera7. AN Mogi S1108 battery, and dew symbols, buttons for Camcorder Filter 8. Dub Cables counter reset and memory, and the cas- . Blank Tape 2. Battery9. Lens Shade sette hatch. The electronic viewfinder is 12 Pc. Pkg. . Lens Cap 3. Charger molded into the top, with screwdriver ad- . AN Adaptor 4. Strap10. Lens Kit justments for EVF brightness and focus. Camera 9. Lens Coy . Lens Shade 5. Blank Tape11. Filter The back has a focusing ring for the magni- Battery 10. Lens shade . Microphone ‘6. Handle1 Tripod fier, and a rubber eyecup. The battery Charger 11. Handle slides onto the back, with an eject button Strap 12. Tripod Lens Kit on the left side of the EVF. Removing the Blank Tape . Tripod battery gives you access to the jack for Head cleaner 13. Head Cleaner external power. AN Adaptor . Dub Cables wCnrND—ubBCRables . Handle The molded grip fits the hand well with Lifgtweight Autofocus Camcorder its support strap. The tele/wide angle features CCD image sensor, auto MINSLTIA rocker is in its usual place under the index white balance & 2 hour recorder and middle fingers, but the run/pause but- VHS-C ‘Comtortior ton is behind the rocker, separated by a Rated #1 by 1 Video Features VHS format with compact cassettes, HO city icioied auto- focus. Minolta f/1.2 zoom lens, continuous auto white allance, sharp High Band Saticon tube, instant replay & full-size VHS playback adaptor. TOO LOW TO ADVERTISE! 42A0T 4V4LItSEhA,XSITMNRAEGSETTTEORINCNARNDEA,WVEAY.MOERRKOIPCCEAINTNY/IENX7PRNEDYSASC,YASLLDIN29E1R2’AS9M8C-6L-U82B270PM 7 DAY RETURN POLICY/ALL RETURNS MUST BE PHONED IN FOR PRIOR AUTHORIZATION/ALL PRODUCTS MUST BE RETURNED IN ORIGINAL FACTORY PACKAGING CLEAN, UNSCRATCHED AND WITH BLANK WARRANTY CARDS/DO NOT DEFACE MANUFACTURER’S CARTONS/SHIPPING, HANDLING AND INSURANCE CHARGES ARE NON-REFUNDABLE/QUANTITIES ARE LIMITED /AVAILABILITY 1S NOT GUARANTEED ON ALL ITEMS/IN STORE PRICES MAY VARY/PRICES ARE SUBJECT TO CHANGE WITHOUT NOTICE For additional information, circle No. 40 on Reader Service Card. April 1987 Video 93

THE PERFECT « CHOOSE YOUR FAVORITE ry o} {feo SUPER STARS STACY DONOVAN NICOLE WEST KARI FOXX AMBER LYNN a TAIIA REY Wat CARA LOTT MINDIE RAE Sf a] SUBST CLIMACTIC ‘|| Featuring over 60 climactic endings to the best sex scenes ever filmed CLIMACTIC SCENES ing another 60 clim, GIRLS, GI 2 1th) Six beautiful girls sample h other in every conceivable way {) E OFT “{ 0 Six beautiful girls whose huge breasts are the erotic center of their bodies. | Black guys and blonde girls. \\ oo) These girls like it one way- BIG. NULL wus Amber Lynn and a bevy of gorgeous blonde girls. CHRISTY CANYON KIM CARSON LANA BURNER OUND THE WORLD WITH CHRIS ON (0 These are the newest, most famous, adult film stars that have ever graced the pages of popular men’s magazines in (SUN) Probing therapy and // recent months. Each one of these gorgeous ladies appears totally uncensored in explicit action with the most international intrigue. dynamic supermen in adult films today. Featuring every — of swingin’ and swapin’ to scorch the silver screen E PHONE S Ever wonder what those phone sex ever girls are doing on the other end. WHAT KIND OF GIRLS DO YOU THINK WE ARE And at less than the:price of most rentals. Lots of kink .S ) ReANROeeRRe Gorgeous girls. Searing hot Each tape is recorded in high resolution video full color E . This blonde sex goddess with complete musical score and shrink wrapped in their own boxes brand new from the factory. experiences sex in all forms! MONEY BACK GUARANTEE You must be completely satisfied or send back for a Each title is approx. 30 min. in length, brand new, ifnull prompt and courteous credit toward future purchases color, complete with original soundtrack & musical Prices: ANY ONE @ $10, ANY score. Completely Uncensored. [SEND ENTIRE AD TO ORDER. Send to: AT HOME VIDEO Dept. H47 P.O. Box 12007, Merrillville, IN 46411 RUSH: Items indicated. | enclose $ & $3 p&h. O cashO Money OrderL] Check as payment in full. Canadians remit in U.S. funds. No foreign C.O.D.s. OO Send C.O.D. | enclose $5 extra, plus $3 p&h. Please specify. O VHS orL) BETA. NAME (Print) ADDRESS/APT.# CITY/STATE/ZIP Signature/Age/Date , —— | am over 19 years old and request this material.

Ch) ADULT VIDEOS *S each oltonorelwaned Coresrellll cMIUTAALATAIDLA@) NEW ONE- TIME- 20 full length hardcore videos for 1¢ each pius postage and handling! Nobody undersells ONLY American Home Video and we want to prove it! We are looking for active buyers of genuine hardcore sex L Jalareiwater aumclinticomss products—so we're making this truely exclusive offer to NEW customers only. This offer comes with no Suid corsa om iis amKosta Mena SCE R) strings attached, no obligation, and no threatening TJ OxOOeratedsmloopenss letters in the future. We're convinced that once you see the great products and low prices we have to offer SeViideoswoshnseltotallsewsers t4ao)5) you'll order again & again. We've assembled the hot- DsBraiBbustens: test video collection ever filmed featuring the newest most famous sex stars doing truely unspeakable things— SiNideos *oehrs=Motala. 914.95) and all for the price of 1¢ each. C) ThesWettapess: All videos we sell are satisfaction guaranteed, 5 Videos’ 5 hrs; Motaly > $14°95, uncensored hardcore with full length scenes and come factory fresh shrink wrapped in their own boxes. So start your collection today and enjoy regular savings on the newest hardcore releases and porn classics! Aadde AW TELEVIDEO Dept. H47 P.O. Box370 ¢ New Buffalo MI 49117-0370 Rush items indicated. I enclose $ plus $3 p& h. O Cash O Moneyorder O Check... as payment in full. Canadians remit in U.S. funds. No foreign C.0.D.’s O Send C.O.D. I enclose $5 extra, plus $3 postage & handling Please specify OY” VHS or OW Beta Nam Send to: VIDEO LIQUIDATORS Dept. H47 NAME (Print) P.O. Box 12007, Merrillville, IN 46411 Address ADDRESS/APT.# RUSH: Items indicated. | enclose $ City. State/Zip. 0) cashO) Money OrderL] Check as paymentin full. CITY/STATE/ZIP Canadians remit in U.S. funds. No foreign C.O.D.s. Signature/Age/Date Sig./Age/Date I certify that I am over 19 years of age. O send C.O.D. | enclose $5 extra. 1am over 19 years old and request this material. Please specify:L] VHS orL] BETA.

Videotests ————$£__ _ ——_—_—_—_—_—__—_—_——— ei me_ Test Report: Magnavox VR8297AV01 AC adapter charger inches, tele; 18-3/4 x 25 inches wide angle Video Escort Camcorder Power consumption: 8 W (11 W with RF adapter), camcorder; 30 W, AC adapt- Minimum illumination: rated — 7 lux; DATA er/charger Date of test: January 1987 Image sensor: 1/2-inch CCD measured — 9.2 lux Suggested retail price: $1899 Lens: f/1.2, 6x (9-54 mm) power zoom Autofocus: switchable to manual with Weight: 3.1 pounds without battery Dimensions: 6-1/4 x 5-1/4 x 10-1/4 inch- with macro range one-shot AF and zone focusing es (h/w/d) Filter diameter: 49 mm White balance: auto switchable to in- Power requirements: 9.6 VDC, cam- corder; 110/120/220/240 VAC 50/60 Hz, Minimum focusing distance: 4 feet ex- door or outdoor Iris: automatic with backlight button clusive of macro range Sensitivity: single range Field at closest focus: 3-1/4 x 4-1/4 Viewfinder: fixed electronic using 2/3- inch B&W CRT with on-screen indicators for recording, recording speed, tape end, white balance, high/normal/low light level, focal zone, high speed shutter, and low battery Viewfinder controls: magnifier focus, electrical focus, and brightness Auto fade: no VCR controls: all Microphone: electret condenser Tape format: Compact VHS Tape speeds: SP, SLP (EP) Play speed select: automatic Still frame: yes Cue & review (search): 3x, SP; 7x, SLP, approx. Fast forward/rewind time: | min. 15 sec. for TC-20 Remote pause: yes Remote: wired pause Separate eject: yes Counter digits: 4 ENTER THE WORLD OF DIGITAL THROUGH MULTIVISION 3.1 Counter memory: yes TC-20 cas- ALLOWING ANY COLOR TELEVISION TO BECOME “DIGITAL” YET Auto rewind: yes THIS AMAZING DEVICE FROM THE SILICON VALLEY CAN DO A Linear audio: mono MULTITUDE OF FUNCTIONS. VIDEO MAGAZINE (2-87) SAYS: “IF Hi-Fi audio: none YOU’RE FASCINATED BY THE FEATURES ON CURRENT Accessories: supplied — ‘DIGITAL’ TVs AND VCRs, THE MULTIVISION 3.1 COULD BE ALL YOU REALLY WANT.” sette, cassette adapter, 1-hour battery, Picture-In-Picture Capability AC adapter battery charger, wired remote control, audio/video output cable, RF Watch Two Live Broadcasts on Your TV at the Same Time adapter, VHF cable, 300-75 ohm trans- former, and carrying strap; optional car Two Built-in, 139-channel Tuners Combine Inputs from your VCR, Video Disk, Video Camera or battery cord, hard case, soft case, and re- placements for most supplied accessories Satellite Receiver 4 Different Sizes of the Inset Picture Available RESULTS & RATINGS Position Inset Picture Anywhere on Screen Horizontal resolution: 240+ a. Swap. Inset and Full-Screen Pictures S/N, video luminance: 30.9/36.4 dB, SP/SLP, unweighted; 36.4/40.4 dB, SP/ = Freeze-Frame the Inset Picture SLP, weighted; 42.8/41 dB, SP/SLP, with = Scan the Inset Picture Manually or Automatically While sag compensation Watching the Full-Screen Picture S/N, chroma AM: 42.8/42.3 dB, SP/SLP = On-screen Channel Display S/N, chroma PM: 38.9/39.4 dB, SP/SLP Audio frequency response: 100-9000 Remote Control Hz, +1/-3 dB, SP; 100-4500 Hz, +0.3/- = Direct Access to 139 Channels in Inset and Full-Screen Pictures = Gontrol all of your Audio/Video Functions 3dB, SLP = Lightweight Remote with Unique 45-Degree Design (patent S/N, audio: 36 dB Audio distortion: 2.3 percent pending) Overall picture quality: average/very MTS Stereo Sound with dbx Noise Reduction - good Audio quality: average = Receives and Decodes Broadcast TV Stereo Sound S Ease of operation: excellent = Internal Audio Amplifier Drives Ordinary Speakers Directly ws AS«* AT THI Overall performance: good = Simulated. Stereo Feature. Enhances Monaural Broadcasts ECc NM = AVuodliuome-ACmoplnitfrioelrled Output Jacks Provided for External Video Switching through the lens and with the best tapes we = Switch. to..2 External Audio/Video. Sources. recorded on other machines. Horizontal by Remote Control resolution was 240+ lines in both cases. The chroma AM signal-to-noise ratio was = Switch to 2RF Sources by Remote Control 42.8 decibels on record/playback, and 43.4 = Combines Inputs from MultiVision's 2 Built-in Tuners with dB on play only. Chroma PM S/N was 38.9 dB onrecord/play and 40. 1 dB on play only. your VCR, Video Disk, Video Camera, or Satellite Receiver However, the difference between the > avideo S/N measurements in the two tests 1-800-542-8811FOR MORE INFORMATION 31800 PLYMOUTH, LIVONIA, MI 48150 313-261-8004 For additional information, circle No. 189 on Reader Service Card. . 96 Video April 1987

GE 97350 BELOW DEALER COST mie * 4-HEAD HQ HIFI * HQ CIRCUITRY * FULL STEREO SOUND * 35 FUNCTION REMOTE *& WIRELESS REMOTE * REMOTE PROGRAMMING $269 BELOW DEALER COST =GE HIFI KENWOOD * HQ VHS HIFI KRV 75 * 35 FUNCTION REMOTE * REMOTE PROGRAMMING * 70 WATT/CH AUDIO/VIDEO RECEIVER * 20 RANDOM PRESETS WITH PRESET GE COMMA$N9D7 CREENMTORTAEL SCAN COMBINES UP TO 3 REMOTES * 7-BAND EQ WITH 5 MEMORIES INTO ONE KOSS JCK 2005 $97 x WIRELESS HEADPHONES Qu «ADVANCED TECHNOLOGY JVC PCW35 JVC DISC PLAYER $9 9 PORTABLE DOUBLE CASSETTE Confidence Checklist The CALL 800-356-9514 “'Competition’’ TOLL Factory Sealed Full U.S. Warranty @ FREE 7-Day Repair Service 2 Credit Card Surcharges No OR CALL 608-271-6889 Hidden Charges Yes WDS Shipping Rates Never Yes WISCONSIN Inflated DISCOUNT STEREO RC/VMPTSDE/TVIAETROACU’TDEROCTNDMSFREJOEIAaCEOcERRTtOOoCDSOrRyTERDIRTSEOrSaRNinSed Sales Staff None No 2417 W. BADGER RD. 2 Extended Warranties Reasonable MADISON, WI 53713 VR/DCPMETIIVEARQOAS’DCROU‘NMSEOTJAICORELTODICORDEZTRDGERISEROSSRNS Pg Pg SOME ITEMS CLOSEOUTS, SOME LIMITED QUANTITIES For additional information, circle No. 31 on Reader Service Card.

Videotests u——_ me] was vast. Unweighted video S/N was 30.9 trast). That sounds like a lot by today’s Hertz, + 0.3/-3 dB at SLP. Audio S/N is 36 dB on record/play and 42.8 on playback standards but it was reasonable as recently dB, and the total harmonic distortion is 2.3 only. Weighted video S/N was 36.4 dB vs. as 1978. It’s not a bad sacrifice to get the percent. We rate audio as average by linear 46 dB. With sag compensation, it was 42.8 frozen motion the camera delivers. It’s dB vs. 52.3 dB. However, the pictures great for analyzing rapidly moving objects, track standards. and still frame no longer has to look so Conclusion. Magnavox’s Video Escort still look quite good. We rated picture qual- fuzzy. The developers of this feature merit ity as average/very good to reflect this is typical of the Compact VHS camcorders special praise. we've seen on both picture and sound qual- discrepancy. Like other Compact VHS camcorders, ity, but its high-speed shutter opens up When using the high-speed shutter new territory for the home videographer. the Escort only has a mono linear track. Its Its suggested price of $1899 is a bit steep, to get that extra sharp look, you'll find audio frequency response is 100 to 9000 but ifyou want that action-stopping feature about 15 times as much light is needed, 150 Hertz, +1/-3 dB at SP, and 100 to 4500 it’s worth it. We recommend it highly. lux for 50 IRE units (at 50 percent con- EMPIRE STATE CAMERA GALAXY OF GEAR continued from page 47 FOR VISA OR MASTERCARD ORDERS HONESTY, EFFICIENCY the smallest and lightest of the new crop. It DIAL TOLL FREE (ORDERS ONLY) AND LOWEST PRICES FOR INFORMATION CALL weighs 1.65 Ibs., minus tape and battery, 1 800 VID TO GO 1 718 448 8600 and a mere 2.2 lbs. with them. Like Sony’s Handycam, the GR-C9 is a WELCOME TO THE JVC GRC-7 PANASONIC record-only camcorder, with an optical PV-300 Camcorder REALREAL WORLD OF MAIL ORDER (eC DPREILCIEVSERY viewfinder and a fixed-focal-length lens. CHARGES . nan focus + auto focus {tlh.k= JVC is hoping the new machine will find NO EXTRA CREDIT CARD FEES | y‘cemuncuser29:be + fade contol Say UNBEATABLE PRICE widespread appeal as a “video instamatic.” VIDEO RECORDERS RCA-MOS VHS-C It uses a half-inch CCD field storage pickup * low 7 lux + 8:1 zoom + autofocus CCl * lightweight *7luxCCD........ CALL FOR GE 9610 CC! with 10-lux sensitivity, and has continuous Olympus CCD. BEST PRICE Panasonic AG-155.... ged auto white balancing and an automatic shut- TOSHIBA 221PANASONIC ter. RCA’s CPR-100 and Hitachi’s black VM- = ZENITH “sitronton nce ESas mes WIACH CANON tetWW SONY = C50 are similar to each other, but Hitachi’s : pees) igital ... BEST M SHARP more closely matches its VM-5000 cam- WZ NEC WM RCA WM JVC corder, which uses full-size cassettes. PRO AUTOFOCUS SYSTEM Both use two-thirds-inch MOS pickups raurTarers) sensitive to within 10 lux and have /1.4 VIDAECOCESSORIES VIDEO TAPES power zoom lenses that range from 11.5 to including MAXELL * TDK eg greg arte 69mm. LEN»SBAETTESRIES SONY * FUJI hchante Aen es Panasonic’s PV-100, GE’s 9-9710, Qua- AMBICO PAVELIGHTS « TELECINE KONIwCeAnaverie vYAeR atl SPOaRiEn sar’s VM-50, and Magnavox’s VR-8295 STAR-D LOWEST PRICES ON TAPES are all, apart from cosmetics, similar ver- sions of the same Compact VHS camcord- seonicer hE er manufactured by Matsushita. Features include a half-inch CCD pickup sensitive to PPpVVi131e63))64 PRRoIECAwELS PpEVDyI1TiO5gR45 PHOTO EQUIPMENT —C cacko. 0...\" oF 7 lux, a 6 to 1, f/1.2 power zoom lens ©CAMERAS-LENSES-FLASHES with macro close-up autofocus, and auto iris capabilities. Nis SUS senPV 1560 PRICES PV 8500 QI ALWAYS IN STOCKAUTO FOCUSES AD ay oh oh All four machines offer a new feature—a Savcebinw super-fast 1/1000 second shutter speed SPECIAL EFFECTS TRIPODS Elmo ECR 8mm .......... S that can be used instead of the regular 1/60 EQUIPMENT second shutter to sharpen the camcorder’s MFJ ENHANCERS SLIK + auto focus perception of rapid motion. With the fast VIDICRAFT * power Zoom SHOWTIME BOGEN * camera recorder shutter feature, for example, the image of REDI-TILT + CCD image sensor RCACMR-200 ........+ c TV CALL FOR LOW PRICE a golf club moving through its arc is crisp WIRELESS Sharp VCC-10. . MONITORS VIDEO and clear during a still-frame or slow-mo- HMiitnaoclhtia V1M20-05MO0S.0.0.. .. . RASBITE tion playback. The same image shot at the NEC V-20HQ.......... EST Pentax PV-C55 HQ..... conventional 1/60 speed appears blurry. a eRATeen ZSEONNITYH ++NJEVCC Send your VIDEO * 2 hour recording “& However, the fast shutter requires PICTURE to any IN STOCK LITE & BATTERY T.V. in your home more light. The difference amounts to four KIT AC/DC f-stops, which means you'll need 32 times ALL MERCHANDISE FACTORY SEALED w/FACTORY LISTED ACCESSORIES the light level of a well-exposed scene at Empire State Camera + 450 Targee St., S.I., N.Y. 10304 VISIT OUR SHOWROOM « 1910 HYLAN BLVD. » STATEN ISLAND, NY 1/60 for an equivalent exposure at 1/1000. MAHOENVIDEO TAPES REPAIRED + CALL FOR MORE INFORMATIONSs\\ SDDACAVEAHBANYALIDSRELG.AEBFC.IEONLRROITTTSIYFOBRIMAEEANESDRKPEOCPNCSHRSLUEIIEBCCBAJEKLRESEACTNOCRFMEOATRYOMOOTCNNRYHEEPAYFONPLGGEEROERCARSTPDOWHENIIRARTCLEHABOFLAUOTCRTEHE.ERCINRKMOOSTMCR.IEASCDS.EIE.ASRTHEIEWQPTEUPUAISRNONHNTGFISIFPTMEY&ERSNUTHBFSAOJO.NNERLDCYLT.PISLNAETLGAOAESLLERNUEOSSNAPAT-RLORIL&CCEOKEFGWSIURNNA-G3Y0& On the 8mm front, Canon is introducing the VM-E2, a sleek, well-designed cam- corder that features a half-inch CCD pickup sensitive to within 8 lux, a flying-erase head for precise editing, and an EVF that SC3RiaFNcoaieond6enr.rfdacdvoidl.irteecmireaotniaoln, can adjust for shooting at any angle. > 98 Video April 1987

WES ELECTRONICS ORDERS SHIPPED IN 24 HRS. \"1F0 ITVVXCSREIIDMAIUCDRISOOHWIACVPOEMPSP-.I-'N\"51G5 ALCLCAMOOCSTOTHRESDR:ER! NO CREDIT CARD FEES e evP ni WHY WE'RE BEST! “waense sSonoyn My 0) Ms *Guaranteed lowest prices wane *No hidden charges FMgett VYRVREGeS68OaNWORO OO *All merchandise factory fresh U.S. goods Mse29.a7) d *eAll brand names with manufacture warranty at lowest price possible °38 years in the electronics business 4 million sales transactions a year, over *150,000,000 sales volume *Publicly traded on NASDAQ Exchange VCR’'S Coy\\ ygti fe) DIGITAL VCRS IN STOCK j & SPEAKERS ‘C HRDI80U AV X 3000 AV X6B6 RCA VMT67C ( CRAIG V510 RCA VMT400 EPI ALL MODELS é AWE5. 96 IVC K . WONe |g,SP IMC wots 0. ~ Mi IMC og vc IVC KSA2 1 PIONEER GM123 SANYO VHR2 ( r PIONEER KEIITI PIONEER CAMCORDERS :KE4141 GE VHSC99710 1095 HITACHI VMS Vi IVC RC Cal Call all Call For additional information, circle No. 37 on Reader Service Card. PANASONI 1 1 NORTHWEST'S LARGEST VIDEO & CAMCORDER DEALER ligi|Sfeyegl*e}. aS vac CALL FREE 1-800-222-1557 CAMERA WORLD BUILDING BIGGEST BRAND NAMES-NO RCA SALES TAX (OUT MD) Customer Inquiries 500 S.W. 5th 503-227-6008 Portland, OR 97204 COMPACT DISC PANASONIC \\VHSTy 9 ML id AT a 110\" CASIO CWI (VHSTR : All products carry U.S.A. PANASONIC RKH500 Manufacturer's Warranty HNIC Cal NIC KXR200 TECHNICS SLP3 30 199\" PANASONIC RKT36 TOSHIBA MAGNAVOX ‘ VIDEO TAPES RECEIVERS VST CR: AL 7120 (Min. 10} Rebate) Wea F-SONY (Min. 10} 4?%ea f KEYBOARDS SHERWOOL CASIO SKI SHERWOOD S2 CASIO MT205 SHERWOOL ) 59° YAMAHA fF i! YAMAHA P CCD-110 TECHNICS ALL MODEL HITACHI CASSETTE DECKS |CORDLESS PH S JVC 1DV66 339\" PANASONIC KXT3815 4% JVC TDOX301 19\" PANASONIC KX13845 9 PIONEER CTHI7Z0\\ om MICROWAVES PIONEER Ci1270W 219\" EMERSON ATSO5 Ng PIONEER CT1370W TECHNICS RS20 Serie ULTRX RDCé JVC DDVR? VX-403 1229.85 Magnavox U.S.A. Warranty VIDEO RECORDERS TOSHIBA Ef eee a nePPVa-n2a7s0o0nic 'U8.7SM.Ao.deWlarranCtayll i aa or VR-9510 239.85 aWALKMANS T URROUND — Haiatachi U.S.A. Warranty VR-9550 P4r-apHcecaedd 309.85 PV-1364 299.85 VI-1350A 329.65 VMI 285 279.85 Special §399.85* PANASONIC RXS28 58° PPVV--11446612 StHie-rFeio 3«39899..8855 V—-IV-71-3174050AA 4P49Y.85 BamaVMTEs29o5sMNStreraeo tie3e149.585 eeevf SSOONNYY SWRMFEFFI77 +»s NMOiWd tINelSeTOCKshifeo] it\"yCALL oes brome) aca PV-1560 4 Head 329.85 VI-1570A 549.85 VMI 395 Stereo 429.85 “After Rebate PPPpVvvi-ti2ps2dd0ed? etHHEecl! MieIna69s99a99ta..oa88cs58k «hi=vVVVKMeMC-Ca-S1S0o500An0WAwicese «f3E1z908a98g8.9a888s5.5 ©—YGYVAMMMTIEGO5S09%:.50, S‘SHDHtieEgertaTheadol 349\\89S999I9.V8-8B585B5 vev\\Cerap-l.sl8ao2lf90oo57rsaMwaWgivSncaoCvseoex sVtidieoe1fA09cl8c99ei.sao8se5 If y1ou-d3on0’t10 -see79i: t 9he-re8-S2S2CA2LLSS! PPVV--130000 w/cNaeswe VHS-C In StCoaclkl CCMPRR--310000 w/case 11203899..8855 Monday-Friday 9am-6pm 1 : Warranty R‘CAsAk aEbxotuetnd5e-dyeaWrarrUaSnAty eTaosthiba IpUe.rSw.eAt.ie Wartrhaenrtyyaad eSundaye12pm-Spm : PV-T150A 2 73bisni e ag VCaantonOHU.S9.A. Warranty 1580 tenner re SA2MEYEAARS UH.IST.AACHWIARVRIA-N17T2Y0A Call for RCA Video Accessories 5 a isock Baltimore, Md. 21227 a i sa AUN a Le) NVeEwNDAVMP-roE”2 IninSSttoocckk SPECIAL *A79°° E ‘OC! : = MPUS —_—PV-C800A MOS Ca‘lall Kyoyocceraera U.U.SS..A. yWarranty yOlympus U.S.A Warranty et GS WE WU TRY 10 MEET OR BEAT ANY ADVERTISED PRICE. Prices aresubjecttopriceincrease frommanutacturer: Retums o OPEN SUNDAYS AwPiPRcEIuRLrSeOn1tN9Ad6Lr7iveCrHsEliCcKeSn_sfec&oWnEgprLaehCsnntOaouMcmnEkbicensgirfneexgee.S:hIippNingD& IhanCRdElBiAAnamgTBuaTEctetahhenovarErartiingazoaSelasnstciineonoc”nnoorr“tuiergftiounemnadnlCaabulminneaet.trtvaSearoWenmodreels9da9.tloe0Aeidt{flpoaeermrracleuslotnro?mde‘eemrraa.ylWcbye.eeSohirepepn: iongt 2BUJ“G‘‘;4/OP0EdaUe9-NlIpOU4ueNeIOD9ANaeISyUPOpJeU! April 1987 Video 99 MON-S7ADT.AY8S-6AW* ESEUKN 9-4 For additional information, circle No. 38 on Reader Service Card.

There’s also a “gain up” switch to boost VIDEODISC ADVANCES SD-1, may be marketed here under the the pickup’s sensitivity in dim light, making the VM-E2 one of the first camcorders Videodisc collectors will be pleased to “Image Vision” name by Image Entertain- using a solid-state pickup to offer this fea- learn that Pioneer has added digital effects ture. Canon’s suggested price is $1699. to its latest player. The SD-1, which has a ment, a disc distributor. ; suggested price of $1600, uses a digital still Aiwa’s second-generation 8mm cam- store to generate still frame, slow motion, SCREEN GEMS corder is the CV-50, an extremely small and clean picture search on CLV discs, a box resembling Sony’s Handycam. The dif- format which previously lacked these fea- Big screens, like big cars, are back. TVs ference is a cradle, which clips to the bot- tures. The machine also plays CAV-format tom, that adds tape-winding and playback and monitor/receivers, both direct view functions. In lieu of the transport buttons discs. and projection, are breaking the 30-inch on the cradle, you can use a corded remote While Sony says it isn’t yet ready to sell barrier with ever greater frequency. control that combines the transport con- trols with a one-inch monitor. its own line of “LaserMax” consumer Panasonic and Quasar are both introduc- videodisc players in U.S., the new LDP- ing 31-inch direct-view TVs that have 480 730, with features equivalent to Pioneer’s lines of resolution, broadcast stereo tuners SAM FFER with 155-channel capability, a full comple- ment of audio/video inputs and outputs, a) on-screen programming, and unified re- a 120oa we $6.99eeay mote controls able to run both the TV and compatible Panasonic or Quasar VCRs. Re EAsNeASONICe CO{R2\\ DPrEompSrioswweonpdere Even larger is Sanyo’s AVM-350 35-inch teitesaeUs direct view. With twice the viewing area of *7autlouxfo*c’fade control quality Cay *4E up . WEAN Pv13 Jvc a 25-inch screen, it boasts 560 lines of . refurbisheg \"O° A PPQFeaaeuAnnaaaaMsessu1aOtooroSnnUiiCSftccfouhcleluPPesVVss:i-1Mz22c0e20.2A0071K20HE.OjStear6p9e 9My RZeCnAithCMVRM--2!700HiFi ro) resolution, MTS stereo, a 181-channel di- e zoom Minolta CR12 NEW E FAMOUS MAKE 1460 f rect-access tuner, a black matrix picture GAreLnL * 3rescpoered,i reocanere bv. 399 - 79 tube, on-screen display, and three sets of : of,actory refurbished, ~2159 Pu1a54c, ne felaleée audio/video inputs/outputs. The price is ((P0V7V1-741462242 699 _Dx9.6250.0.0.'....676290 $3199.95. OP-OF-LINEFIees Toshiba’s CX-3077 30-inch FST (Flat teams Square Tube) “Magnum” receiver/monitor Jvc anc7 ANON wi w VI cna also falls in this new dreadnought class. At a suggested price of $2499, it features * autofocus «MICNCOLDTHAa CR-3000 YESH te| |Cp*HM4aiHsEIQraoTaaSqLlUyiBSp,sMePepiEEeECsSke4ISwru_iAeO*rnL9eelO0Ca0b8lZfFeetaohrgeset‘viMieMaR4nV-Vge-h34.6d4I31o,0300T00Hi.HiHn.wFHwiAig\"irF|ae2eMyshltpT1eed!BSs0asewtiscrttaeeblrtleeseos|..GC.SCCA.AaAAL.LtL7L3pL9F MTS stereo, 141-channel tuning, on- ¢ 6:1 zoom e autofocus :fe screen display, audio/video inputs, and 600 © 2.9 |bas.rc-9 ©\" cordet gcse nie2000 digital lines of resolution. low light eliCTB-100 weRecord Only, 1029 Toshiba is also introducing the CZ- S autofocus ° 7 (UX 2697 ($1699), a 26-inch monitor/receiver ZENITH vM-6: + 6:1 200% with non-interlaced scanning. Instead of GeE7\\u9x-9710*oh ea displaying 262.5 lines every 1/60 of a HY @ autofocus second, it uses digital signal processing to ¢ 6:1 zoom [noe1GORDER LL\\iefaer} IF stereo, display all 525 lines in 1/60 of a second for better picture quality. PANASO! NEW 7 lux On a smaller scale, Proton is unveiling its VT-210 20-inch monitor/receiver with SONY wis8rOSmCaSLmHeA6MaO1tYinoNpONdMOfpiUYOoPcNcas°SEauuUmsscaCStVCTeoiOMnneVEVsr'aSs\"X3WewgAoV”A\\NILS“ATCBOALCLELK Vf*.n*se0wQAl1iuu0Cdda0IeersD/i:4s2Cp-/ho4atv10li5o0d0sewsWwitiDcAehCC! nlfamap m SpAedcndihaaEnlfcEffefeeccttyso G!enOevlreastor: an FST tube, MTS/SAP capability, on- CCD-V8 AF *- DETAILERIv screen display, 139-channel direct-access e auto focus tuning, and three sets of audio/video in- power zoom puts. The VT-210 has a horizontal resolu- tion of 500 lines, an RGB input jack for UptoFoc BATTERYDECar; : cVDoEiETdveANeoI,LjeoE.nRhae4n91se19e1 rn/ssIVpEli-tr2es0cd;0ioceio2ne6e9 computer use, and a suggested price of j $849. | Many new projection TVs will be availa- ica ble this year, especially the rear-projection ‘cording time models gaining favor with apartment dwell- 189 : ers. NEC is introducing the PJ-4100A RCsA aa ($2800), with MTS capability, audio/video inputs, and a unified remote control that CGA-020 char gen SUPER DUPER Audio for Video AMBICO \\.0310 fisheye Ge a works with many NEC VCRs. increases audio & video VAA-002 input adapt VAL-U-TRIPOD Speakers « 4” woofers V-0312 telephoto 1.5 30 The really big gun is Kloss Video’s new DCC-012 DC car cord fluid hd quik release * 2’ tweeters © 8 watts’ V-0342 1 4x tele lens 49 AVO-46 4.5 amp hour batt TELECINE CONVERTER 'V-0311 close-up/wideview 60-inch rear screen model, produced after LX-152A lens extender trf 8mm & 16mm to VHS * turns TV into stereo years of selling only front projection TVs. WN-002 wireless mic VO-190 A/C DIC light The Model Ten incorporates Faroudja im- WAL-01A wide angle lens DYNAMIC DUO PAVE Perispheric AC-018 tripod 100w/200w inc bulbs * 687 converts TV to stereo TV * superwide angle age processing, 700 lines of resolution, KK-040 soft case V-0623 wireless mic * macro lens Dolby surround sound, 139-channel MTS V-0604 wireless © 686 converts regular TV to * absolutely distortion free | KK-042 hard case VALUE $189 tuner, and a bank of audio/video inputs. CB-120 camcord batt headphones remote TV ONLY Telephoto The suggested price is $4295. HOME AUDIO S VO-687 MTS Decoder 199 On the front-projection front, look for Zenith’s new PV-851P two-piece model. It WARREN AAZWZVO-686 TV Tuner ¢ EXPERT STAFF -= throws a bright, eight-foot image on a ONKYO Tx-88 =@ ¢ FAST SERVICE a—a SONY CDXR-7AM/FM 499 aloes,receiver, Base 2esGUARANTEE! built-in CD player Taye white wall or screen from a three-tube pro- ¢ LOWEST PRICES - 6 preset digital tuner jector that rests on a low, wheeled cart. It has a 171-channel, broadcast stereo MTS AUDIOVOX 200 AM/FM auto tuner, audio/video input jacks, and is ex- =es reverse cass w/preset 140 F pected to sell for under $2500. ONKYO TX-108 KENWOOD KRC-838 AM/FM reciever Top-of Line cass auto rev builtin < 105 W PC BensiBox 449 F KENW636Oww/BBeenOnssiiBBoDoxx_33660 0 § HAND HELD TV.s ath,NEC PJ-4650 zrMITSUBISHI 45\" VS457R MITSHUBISHI CS2670R SONY FD-10A remote widoors 26” Digital TV w/Remote 2 inch TV * 46° projection * remote 45\" VS472R remote CALL Stereo Cable 1137 CASIO TV 30 ECD © 450 lines «2599 ” BIW LCD TV, SONY 36XBR remote 1925 NEC CT2680R CITIZEN O6TACIE * 142 ch cable 41° VS4150 xtra sharp pic 2149 26\" Digital Flat 1209 25 Bischeyve * stereo TV wibox Screen wiRemote NEC PJ4100 2400 41° V4110 widoors 1899 TOSHIBA CZ 2667R 26 SAP Flat Screen Dia 1287 | 1.40\" 4940 widoors 46\" VS4620 high quality 2399, GIPOENN:F7RIDA10Y-S7 & 16mm Onto Beta or VHS 8mmiSup 8 & 200K (4 Nims) $20 SAT 9-6 6mm 2{ $24 3SCNRciaFoaeoi2nedonr.rfrdadcvoidl.irteecmireaoltniaelonS,UN 10-5 100 Video April 1987


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook