Classified A style guide to the outside Industry expert and founder of Out and Out Original, Daniel Fairburn, brings you this season’s best deals on designer furniture.Visit www.outandout.com or call 02037 728 752 for more exciting deals and discounts. Stockholm - Corner Lounge Set SAVE £300 Enjoy being in your garden this summer with the Stockholm Corner Lounge and Dining Set whether reading a good book or dining alfresco. This set sits up to 6 comfortably and the sofa is made from polyrattan which gives durability and virtually no maintenance needed. The table is 144cm long with a wood-effect slatted table top and has an underneath shelf for extra useful storage. The comfy seat and back cushions are covered with polyspun fabric so soft to touch and the covers can be removed and washed easily to keep your lounge looking pristine clean. Comes in Cream or Grey.** Normally £799, now available at an amazing £499*, but only when you quote your £300 discount code GHMAR22 at checkout. SAVE Chesterton - Corner Rattan Set £200 The luxurious Chesterton corner sofa and matching glass-topped coffee table set is perfect for entertaining outdoors. Generously proportioned with deep, anti-fade cushions you can seat 5 people in comfort. It’s so easy to look after – the seat and back cushions all feature removable covers (see website). With a maintenance-free construction of thick polyrattan and a galvanised steel frame, the set can even be left out all-year round, making it the ideal addition to your outdoor space this year. Normally £999, now available at an amazing £799*, but only when you quote your £200 discount code GHMAR22A at checkout. Marbella - 5-Seater Corner Lounge Set SAVE £200 The ideal addition to your outdoor space, this stunning lounge set offers comfort and style at an affordable price. Bang on trend in gorgeous shades of grey, this set is designed with a contemporary feel. It’s hard- wearing, woven in strong polyrattan on a galvanised steel frame making it virtually maintenance-free. The comfy cushion covers can be removed and hand washed with care. The sofa and armchair seats 5 easily, and includes a tempered, glass-topped coffee table so you can entertain outside with ease. Normally £999, it’s now available for just £799*, when you quote your £200 discount code GHMAR22A at checkout. To receive your discount on any of these products quote discount code at checkout at www.outandout.com or call 02037 728 752 before 27.04.2022. *Excludes delivery. **Colour cannot be guaranteed on ordering For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
Classified DARLING DELPHINIUMS rare | unusual | exciting BUY 12 FOR £12 ONLY £1 PER PLANT White with Black Eye HT: 1.8m Galahad HT: 1.5m Blue Jay HT: 1.5m THE PERFECT PLANT to add colour and structure to a cottage garden or herbaceous border yet also looks sensational in a more modern planting scheme. Stunning spires rise majestically above lower growing plants. Prefers well-drained soil in sun or part shade. Spread 30cm. Fully hardy herbaceous perennials. Your order is covered by our No Quibble Guarantee and will be confirmed together with a copy of our latest catalogue. Your young plants will be delivered from April. nudicaule Laurin HT: 40cm Summer Skies HT: 1.5m Black Knight HT: 1.8m Guinevere HT: 1.5m Sky Blue with White Dark Blue with White Blue Bird HT: 1.5m Blue Butterfly HT: 50cm Cherry Blossom HT: 90cm Bee HT: 1.5m Bee HT: 90cm PLEASE COMPLETE IN BLOCK CAPITALS Please Send Item Code Price Qty Total 12 Plants ORDER ONLINE YPDEL12-GH0422 £12 Name 24 Plants YPDEL24-GH0422 £18 hayloft.co.uk/GHHY P&P (UK only) £5.95 Address Please debit my Visa/Mastercard Card no PHONE Total 0333 358 2006 Postcode Tel Valid Expiry CV2 from Email QUOTE GHHY I enclose cheque/PO for ____________ made payable to Hayloft Plants Ltd Send to: Hayloft Plants FREEPOST RTGR-JAGJ-JETG, WR10 3HB Please write your name and address on the reverse of the cheque GHHY THANK YOU, WE WILL CONFIRM YOUR ORDER Your details are kept securely and not shared with third parties. You will receive a catalogue, welcome email and special offers, if you prefer not to receive them please call 01386 562999. For T&Cs – see hayloft.co.uk For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
10027 - 105217 (36737499-2-- 10205 - 106889 (36745982-5-- Classified 24.02.2022-13:55 Uhr) 04.03.2022-11:05 Uhr) FASHION 582966-673242 (36645431-4-- 04.03.2022-11:07 Uhr) document9706753767751513429.indd 1 3/4/2022 10:05:35 AM PollyBagCo For flattering full figure Pattern, fabric, design, lingerie & swimwear visit handmade in Brixton www.AmpleBosom.com etsy.com/uk/shop/ PollyBagCo or phone 01439 798388 for a catalogue KATHARINE DAVIESdocument17788328447651771165.indd 110/4/2021 1:25:17 PM SIZES 14 — 32 PHOTOGRAPHY ORDER ONLINE AT WWW.BOX2.CO.UK OR CALL 0800 328 8847 FOR A FREE CATALOGUE Based in Sherborne, Dorset. Specialising in natural reportage, lifestyle and portrait photography. ument15143208576645329522.indd 1 2/24/2022 12:55:23 PM C0 C 53 C 53 M 69 M 38 M 28 Y 65 Y 25 Y 25 K0 K 80 K 10 #ed6c53 #2e323a #808a9e For Flattering Full Figure Lingerie visit www.AmpleBosom.com or to request a catalogue telephone 01439 798388 C 24 C0 M 11 document182829433590311M079186.indd 1 3/4/2022 10:07:47 AM Y 51 Y8 K0 K0 01935 813374 #ffe393 #cbdce6 [email protected] Come and cook! www.katharinedaviesgraphy.co.uk Pick up your style confidence tips here 020 7439 5500 For details of classified www.helenreynoldsstyle.com/tips www.goodhousekeeping.co.uk/ advertising call 020 3728 6260 institute/cookery-school For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
Classified Exclusive offer for readers Exclusively for readers SAVE of The Daily Telegraph of Good Housekeeping £16* Crew Neck Sienna Cardigan Red FREE delivery FREE returns 100%20% Cashmere “Excellant fit, great fabric, 80% Merino wool lovely colours” Machine washable Janice, Colchester LinenSize: XS∙S∙M∙L∙XL Blue/ Ref: A87L White Batik Village Green Print Was £62 now £49 Mid Mustard Blue lcuxauryshmere now Linen Pocket with merino wool £49 Tunic Dress “What a wonderful soft cardigan. 100% Linen Perfect in every way.” Machine washable Size: 8∙10∙12∙14∙16∙18 Tracy, St Ives Model wears: Turquoise Painted Spot WAS £65 Use Code: RDTU1s23e Code: RGH14 Terms & Conditions: Use code RDT123 for total saving of £18.94 including FREE standard delivery and returns for Mainland UK only. Offer ends 12tte*hcTroOme(nArcsjm8utao7nsnbLc&d)etirocoCn2ornoe0lnywnf2d.ud1iAinttialhitdloineoopnddnrrsdo,c.sepmaI:trnrUeosonsmtvaoeiiorstdecncibonsaaeduglneucbibtosjReeediGscdeetHrsxietn1,cot4mhucaaofruconnnlcrtgejeiuedtbponduwttcayoatinsitlrohcsoyneiaronvwuudi2nrniis8tdmgchedooopraufnrWyn£oest1ymoef5orrdo.oel9Otimf4tiuovenintemnhdracsseell.udcsdOdot,aafpditnfnreeegodsrova,FifsimrRddpvEiuuntaElregltcisridbihmttuaaoisnyssnesdara.naeodrtdWrvdudcerodoinrsoetneclilOdsdoiveiuvtwednieroirtsytnsethasydsin.nlheiIdtta2seel8rm(lmeWndtssuoa.1trcy0Onasb4fsneffLerfb)loorieaomrisbneMlltxveyhaca.fiehlAnoiaddllranlaoanogtnnrdeeyddaoUewdforKvsapreosuyarhnorrtceiliunyshrs.egauOmdsebfersofjr.teenoyWcrerlteeysotnoodlOascv3ce0ertpshtsaJhunancleelBnu2lon0atd2cbe2keraWlniadoboclealOnfvonerortasnbsyetawunsadesadhriidnng errors or doertdeergterngtednatmdagmea.gFeo.rFfourllftuellrmtesrmansdacnodncdoitnidointsiovnisivtiwsitwwww.wwo.owloovelorvs.ecrosm.co/tmer/mtesr.ms. For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
Classified For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
Classified SAVE £10 ON OUR JERSEY JACKET Add a layer of style to any outfit with this jersey jacket from Barbara Lebek. Beautifully embellished with textured stripes on plain coloured background, it is comfortable to wear, while the immaculate cut flatters every figure. Give it a try—with free delivery and free returns, you’ve got nothing to lose. • Chic design SAVE • Contemporary textured stripes • Easy-care, stretch fabric £10 • 97% polyester, 3% elastane • Machine washable ONLY £65 • Length 56cms. Sizes 12-26. USUAL PRICE £75 Exclusively available to readers of Good Housekeeping at the offer price of only £65. SAVE £10 on our usual price. Don’t forget to quote your offer code FAB2 when you place your order. Offer expires 20.04.2022 so we recommend placing your order soon. 13857/33H Jersey Jacket - Mint WAS £75 YOUR PRICE £65 SAVE £10 JERSEY JACKET NOW ONLY £65 RISK-FREE Offer • FREE Delivery • FREE Returns Ordering is easy Online: mona.co.uk/mona-offer Don’t forget to quote the offer code FAB2 when checking out. By phone: 0844 482 2345* How to pay: We accept Mastercard, Visa and Paypal. *Lines are open 7 days a week, 8am to 8pm. Calls to this number cost 7p per minute plus your telephone company’s access charge. Standard postage and packing is £5.99 - but free with your offer code. Delivery 7-9 days. This offer code is valid for single purchase only. For multiple purchases please place separate orders. Free returns within 14 days for a full refund. T&C’s apply - see mona.co.uk. For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
Classified For details of classified advertising please telephone 020 3728 6260 or visit www.hearstmagazinesdirect.co.uk
A quick word from our Every month, the GHI experts put products through their paces to bring you n ACTILEAF n GUIDED TOURS n CATCH & CLEAN n EMMA ORIGINAL FOAMABLE OAT DRINK Cosmos Tours RUBBER BROOM MATTRESS & DUSTPAN SET Emma Aldi 90% of GH panellists rated Our testers found this to be a Cosmos Tours’ customer Spontex A comfy, substantial, very good dairy replacement. Versatile, efficient firm mattress that A clean, balanced oat flavour service as very and perfect for quick and with no lingering aftertaste. good or excellent. provided our panel with easy tidying. a great night’s sleep. n n HYBRID MATTRESS n CRYSTAL CLEAR n FLOWER DELIVERY n IRRESISTIBLE Rollo by Slumberland WINDOW CLOTH SERVICE PROSECCO Moonpig Co-op The combination of springs Marigold and memory foam in this This microfibre cloth leaves Testers said that this plant An easy-drinking Prosecco and flower delivery service with a refreshing green apple mattress delivered a cosy and windows shining provided fresh bouquets that aroma, crisp pear and apple comfortable night’s rest. and streak-free. flavours and smooth bubbles. arrived promptly. n n 1-2 SPRAY MOP n BREADMAKER n UPHOLSTERY n POISE PLUS 3200 Vileda SD-YR2540 CLEANER MATTRESS Panasonic Sleepeezee This mop works well on most Dr Beckmann floors – with no need for a Our loaves were well-risen, Its easy-to-use design and The cooling gel layer bucket – and the microfibre fluffy and flavoursome. The powerful formula effortlessly effectively regulates body pad can be reused up rapid bake setting made a removes stains, leaving fabrics temperature, so a restful to 200 times! light loaf in under two hours. clean and smelling fresh. sleep is guaranteed. 208 GOOD HOUSEKEEPING MAY 2022 goodhousekeeping.com/uk
experts at the GHI the best – and these are the latest to pass our rigorous tests KEY n GHI APPROVED n READER RECOMMENDED n GETTING GREENER n PETAL SOFT LUXURY 3 n GOOD ENERGY n PREMIUM ENGLISH n 3 LEG ADJUSTABLE PLY SOFT TOILET TISSUE Good Energy SPARKLING WINE TRIPOD LADDER Aldi Henchman Iceland Harnessing renewable An intuitive and This toilet tissue is strong resources, this energy Our panel enjoyed the gentle, and absorbent, while also company also supports biscuity aroma with notes of well-designed ladder that felt carbon offset projects. melon, green apple and pear, safe in tests. Handy for a being luxuriously soft. and the sweet, floral flavour. variety of gardening tasks. Exclusive to Iceland. n ECO COMFORT 1200 n TURBO SPIN MOP AND n COMBINATION n MEMORY FOAM POCKET MATTRESS BUCKET SET MICROWAVE OVEN TOPPER Silentnight Vileda Panda An innovative mattress, NN-CS89 This mop has some excellent Panasonic A luxurious mattress topper comprised of fibres that are design features, particularly In addition to its microwave, that kept our panel cool at made from 100% recycled the foot pedal wringer, which grill and convection functions, night and offered just the make cleaning floors easy. this clever combi also steams. right amount of extra support. plastic bottles. n 500 COOL GEL n EXTRA SPECIAL LOUIS n CONCENTRATED n LUXURY BEDDING PILLOW BERNARD VINTAGE LAUNDRY DETERGENT Primark REM-Fit CHAMPAGNE Asda Ecover Soft and luxurious This won best overall pillow Recently taking the top spot for a budget price, this and best memory Well-balanced, with apple, in our eco laundry detergents citrus and toasted yeasty good-value bedding foam pillow. Every tester notes and delicate bubbles. test, this works brilliantly set will keep you snug gave it 10 out of 10. on tough stains. all night long. goodhousekeeping.com/uk MAY 2022 GOOD HOUSEKEEPING 209
Just like us housekeeping! BBC Breakfast presenter Naga Munchetty on her love of fish fingers, getting Tupperware deliveries from her mum and enjoying cuddles with her cats Naga lives in Hertfordshire with I’m quite frugal, but I will buy nice her husband, James Haggar, things that last and I won’t scrimp and their three cats, Missy, on food. I’d always rather eat Xena and Bella. well-sourced, good-quality food. How would you describe your What is the best bargain you’ve home? It’s light, airy and clutter-free, ever found? A pair of outdoor but also cosy and warm. chairs that were £7 each. They’ve How tidy is it? Both my husband brought me immense joy because and I are really tidy. However, they allow me to sit outside in the because of the early hours I work, sunshine; there’s no nicer feeling I get dressed in a different than the sun on your face. bedroom, where I basically live What did your parents teach you? out of a suitcase, as I’m travelling My mum taught me how to make up and down to the BBC Breakfast a really tasty meal out of just studios in Manchester all the time. about anything in the fridge. I’m It does tend to look like a suitcase I’m a a confident cook thanks to her. What is your favourite household has vomited in that room, so the door is kept firmly closed! confident task? Ironing, because I always set cook thanks the board up in my lounge and What are your kitchen cupboard put a film on. There’s also nothing must-haves? I have every spice going, lots of herbs; and porridge to my mum more satisfying than a pile of crisply ironed clothes. oats are essential. What do you always have in your What always lifts you out of a fridge? Our fridge often looks like mood? A cuddle with one of my a student fridge: there’s usually cats, or listening to a great song. some dark chocolate, a bottle of wine and Lady Marmalade by Christina Aguilera, Mýa, very little else! Whenever my mum comes Pink, Lil’ Kim and Missy Elliott gets me going. over, she’s horrified. She’s started bringing What helps you stay calm? Being round some of her curries in Tupperware, prepared. I’m often asked if I get nervous so we keep those in the freezer and have doing my job, and I don’t because I them on standby for emergencies. prepare, prepare – and prepare some more! Would you rather cook for friends or eat What is your favourite home comfort? out? I do like cooking, but nowadays if I The first thing I do when I get home is have friends coming over, we often just get change into my soft, comfy clothes. a takeaway because it’s so much less faff. What is your favourite home gadget? What is your signature dish? I do a lovely My bottle opener! gratin dauphinois – it was a revelation when What is your greatest simple pleasure? I discovered how easy it is to make. I have Drinking a glass of red wine while curled up INTERVIEW: ANNA BONET. PHOTOGRAPHY: BBC, GETTY a mandoline, which is brilliant for slicing with a good book. I recently read Misfits by potatoes and leeks, and once you’ve done Michaela Coel and loved it – it’s a short but that, all you need is some Gruyère and a bit really brilliant, inspiring book. of cream. Layer it all up, whack it in the What is your health motto? Something I’ve oven and it looks and tastes amazing. learned later in life is that we should try to What food can’t you live without? look after our bodies as much as we can, I absolutely love fish fingers; if we don’t but that we do it so that we can enjoy have any in the freezer, I do panic a little things. So don’t deny yourself the things bit. I’ll have them in a sandwich, a curry that bring you pleasure. or with spicy noodles. Naga’s favourite things BBC Breakfast is on BBC One every day Are you a saver or a spender? A bit of both. include freshly ironed from 6am clothes, fish fingers, red wine 210 GOOD HOUSEKEEPING MAY 2022 and sitting outside in the sun goodhousekeeping.com/uk
Puzzle Collection 62 brilliant brainteasers to test your grey matter GET THE COGS WHIRRING AND SHARPEN YOUR MIND WITH OUR FREE 48-PAGE MAGAZINE FULL OF YOUR FAVOURITE PUZZLES ✶ SUDOKUS ✶ CROSSWORDS ✶ ARROW-WORDS ✶ CODEWORDS & MANY MORE
100 years Introducing the stylish in the making new GH100 collection from DFS, created to celebrate a century of Good Housekeeping The new GH100 collection of sofas, chairs and accessories, even offer powered footrests for the ultimate in comfort. exclusively available at DFS, combines comfort, style and The sofas are upholstered in cutting-edge fabric that’s functionality with the latest in fabric technology. luxurious yet incredibly hardwearing. Most stains, even wine Designed with the experts at Good Housekeeping, this and chocolate, can be wiped away with nothing more than innovative range puts modern family life firmly at the heart water, leaving you free to get on with the important things of its design. The sofas feature clever side-arm storage, along in life. We’re thrilled that the GH100 collection carries the with hidden charging ports for smart devices – some styles GHI Approved stamp of quality. See the full Good Housekeeping collection at dfs.co.uk/gh100
Time to get puzzling! It’s more important than ever to keep our minds active, so I’m pleased to introduce our latest Good Housekeeping Puzzle Collection. We know how much you love a challenge, and there are plenty of puzzles – from sudokus, arrow-words and codewords to number squares and crosswords (both quick and cryptic) – in this fun-packed, free magazine which will provide exactly that. We’ve included all the brainteasers you enjoy each month, as well as lots of other games, conundrums and mind-benders, too. We’ve also introduced an easy star rating to give you a better idea of just how hard each puzzle will be – I know I’m going to start with the one stars! I really hope you’ll find something to enjoy while also giving your brainpower a boost. Good luck and happy puzzling… PICK A PUZZLE Gaby Huddart ✶ SIMPLE SOLUTIONS EDITOR-IN-CHIEF ✶✶ HARDER TO MASTER [email protected] ✶✶✶ A REAL CHALLENGE @gabyhuddart 30% OFF* and FREE P&P PHOTOGRAPHY: DAVID VENNI. COVER PHOTOGRAPHY: GETTY All puzzles are kindly supplied by Richardson Puzzles & Games. *To order any of its books at a 30% discount off the RRP with FREE UK P&P, go 3PUZZLE COLLECTION GOOD HOUSEKEEPING to hive.co.uk/richardson-puzzles to select your book and enter the code GHPUZZLE when prompted on the basket page. Terms and conditions apply. goodhousekeeping.com/uk
Battleships 3 3 3 shLoipcsate the position of each of 3 3 3 2 2 2 Battleships ✶eoempdrcssostlLsftirohtNrtairsihsehuo,dsnhohhbste323hticrgunchepeuceeieelwemaodpeassdnilemstrurleepsdsndbtuaonduohegbeouemtntuehlsriidfoemsdtrNLaitnpdrennpbstLlohhwniisroohiruscengettuyoweesbdcbhsoeempltciguzcueiasonsowlneeoalielznmaodubdthadnutipneasfaenlrstileihmertnrlpeedryioidctdhrbattutotaog.esnsoesihbhoegoeheocwuelrmtgetueleuadolehS,lninsdfefrsordegrilpdegoionsatouhnwinosreietodoegwnmiuntiipbhdcnmfdpdhoeddspfonaleginosis.luauneeondtibtalneohecteipdaohaseofelaniznlahtNhtspnllyoifilncnhhlrdanetzyotcyauoeseiuthetseho.wb.gwotlhhllomeueemlcelsnefgseergseygdoifdlgooes.ubnbimiplrrdiiltgdoawnfaureienipSwhimuteddryceefdgmhrroezgtsh.hnusohetaaoeezteu.entbeheeoolinnzsutagnaeNsaynplnffldaeez.rocdiruuncsytwioSslbtlhdferlmeoshmceyhhus,eag.dtuhyoi.italnho.pbbpelriilcodpefusesenrSwihy,ndmrrthsohae.aneoiutalaplfeorcssosfrsihhu,dthinhepidpess 1 1 1 puzzle. Ships are surrounded on all sides 2 2 2 1 1 nbgy1wdaitaerg, oincnluadlliny.g diagonally. 0 0 2 2 21 1 5 1 10 0 52 2 3150210125 1 1 3 1 5 0 2 1 0 1 25 5 5 3150210125 Tough Sudoku 7 4 1STuhdeocklaussic sudoku puzzle. Place 14 1 7 6 4stshiec snuudmobkeurspu1z-9zleo.nPcleacine each row, 8 2 1 4mcboelursm1n-9anodnc3ex3inbeoaldch-lirnoewd, box. 16 6 3 4 71 6 3 1 7 6n and 3x3 bold-lined box. 8 33 3 1T✶S12ou✶4ud71go1hku6 8 2 4 83 1 7 3The classic sudoku puzzle. Place the numbers 1 to 9 once in each row, column 98 46 34 8 3and 3x3 bold-lined box. 18 9 49 8 9 8 34 6 3 6 8 2 81 48 6 3 9 4 GOOD HOUSEKEEPING PUZZLE COLLECTION 16 8 92 8 goodhousekeeping.com/uk
Codeword Numbers in the grid (1-26) correspond to each of the letters of the alpGhoaboedt fproumzzAl-eZsin Codeword ✶✶✶Three letters are provided to give you a start. Numbers in the grid (1 to 26) correspond to each of the letters of the alphabet from A to Z in some order. Solve the puzzle and fill in the letters in the key included as you find them. Three letters are provided to give you a start. 6 23 14 5 2 6 11 7 9 18 7 6 7 10 19 15 15 8 14 10 25 2 26 23 6 7 7 1 20 7 18 16 14 20 18 6 4 2 26 8 22 24 2 9 23 7 7 21 12 7 7 10 19 8 20 4 6 22 7 9 6 14 1 19 9 2 2 20 26 13 8 2 17 22 20 14 4 2 6 13 19 4 12 2 8 14 7 7 8 4 20 14 22 22 8 1 12 20 19 1 4 19 2 2 8 14 24 3 16 7 4 5 8 26 2 ABCDEFGHIJKLMNOPQRSTUVWXYZ 1 2 3 4 5 6 7 8 9 10 11 12 13 V 14 15 16 17 18 19 20 21 22 23 24 25 26 UT goodhousekeeping.com/uk 5PUZZLE COLLECTION GOOD HOUSEKEEPING
Francis, Joan, Joseph, Jude, Mary, Michael, Patrick, Paul, PPeetteerr,, RRiittaa,, VVaalleennttiinnee Number Diamond ✶✶ The sum of the six triangles that compose each hexagon is 25. Can you place numbers from 1 to 9 in each empty triangle to complete the puzzle? You cannot repeat a number within a hexagon. 41 h 23 6 er 31 49 2 76 24 1 96 44 91 6 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
Good puzzles Pathfinder ✶from letter to adjacent letter, NN AA OO JJ HH TT EE BB AA ZZ FF CC HH AA EE UU NN SS TT II u create a continuous path RR II CC II LL DD RR AA AA LL Moving from letter to adjacent AA MM KK RR OO JJ YY MM NN EE ts everyletsteqr,ucaanryeouocnrecatee aacnodntinuous NN CC AA TT SS EE PP HH CC TT path that visits every square once SS II PP RR EE EE RR BB II DD ut all thaendwspoelrlsdosutlaisllttehednaumnesdleistred BB EE VV AA TT WW DD EE NN EE EE DD EE LL EE PP NN AA LL UU d? Startnsoheaxndt ettodhtsheqeusagrrheid.a?dSteardt osnqthueare. Andrew Jude Bede Mary Benedict Michael Clare Patrick Dunstan Paul Elizabeth Peter Francis Rita Joan Valentine Joseph II TT NN TT AA DD EE AA RR AA NN EE RR II JJ UU CC LL EE PP AAnnddrreeww,, BBeeddee,, BBeenneeddiicctt,, CCllaarree,, DDuunnssttaann,, EElliizzaabbeetthh,, Hexagon each of the letters below the grid onceFFirrnaantnocciissth,, JJeooeaannm,, JpJootsyseehppehh,,xJJauugddoeen,, MMs.aaErryyn,, tMMeiircchhthaaeeell,,lPePaattttreriiccrskk,,iPnPaauull,, Word Hexagon ✶✶PPeetteerr,, RRiittaa,, VVaalleennttiinnee Place each of the letters next to the grid once into the empty hexagons. on to adEjnatceretnhet lhetetexrsaign osunchtaowsayptehlalt oit uistpoesasicblhe two foinrdda.ll the words listed by moving from hexagon to adjacent hexagon to spell out each word. er Diamond N4 BEND S Km of the six triangles that CAHBUDG E G H I J O se each hexagon is 25. Can 1FRPORTTHU W Y Z ce numbers from 1-9 in each triangle to complete the BEND XYou cannot repeat a number 23 6JIBE CHUG FROTH a hexagon. L3 1 MILD JIBE OAK MILD OAK PAWS 49 PAWS PRY 2WAX ZAP PRY C F M7 6 2W4AX 1 goodhousekeeping.com/uk 9 ZAP ABDEGH I J O P R T UWY Z 6 7PUZZLE COLLECTION GOOD HOUSEKEEPING
o A to Z HR A ENU ES A to Z ✶ Place eEach of thIe lettersAA-Z onceT E UG Place each of the E S U G into the empty sTquares iGn the gridOto HR A A E N Uletters from A to Z once compleTte tAhe crUosswNordTpuzzIle. N G E AG in the empty squares NL TS I EI T Eof the grid to complete DT the crossword puzzle. KT EA EU OE I AAA NG D A ULT I P Y I D A AT A K E E L S ESL E U KL T IA P Y D T NS E R E RS E LR E KA T EAC RER NS ER R TE PEA TE T EAC CH I C P RE A C H I C WE I TW T E I TT 2 0 14C 1 0E 1 0 2 0E 4C O E E EOE 3 3 1 3 2 2 0 6DominoSe2s 4U 3D 3 E6 S 2 4DS O4 NU D R E S D O N R 2 4 4Each oAf tBheC 2D8EdoF mG inH oI pJieKceLsMfrNomO P ABCDE F GH I J K L M N O P Q R S T U V W X Y Z Q RSTUV WX Y Z 3 2 0 5 6 2 0 4 1 5 11 3 4 4 3 5 20-0 throu1gh to36-65have1bee6n pla3ced 2 5 4 Dominoes ✶once int1o3the02grid.36Can6y1ou 5wo1rk4ou0t 5 22 46 6 6 1 4 6 5 0 4 5 2whereEeacahcohf thoef28thdeomminoaprieeceps lfraocme0d-0?through to 6-6 have been placed once into the grid. 0 25 5 3 4 6 6 5 5 4 1 3DomCinanoyeosu work out where each of them is placed? 6 204 1 6 4 3 4Each of the 28 domino pieces from 6 4 1 630 11 12 36 42 5 46 5 10 1 0 1 00-0 through to 6-6 have been placed 0 5 5 3052 4 5 6510 1 0 1 0d 04 34 once int0o the5grid. 2Can y6ou wo2rk ou0t 0223 3 3 6244 54 where each of them are placed? 3 1 3220 21 43 u0t 0 423 4 3 3 6 1 6325 32561 0 1 2 3 45 6 33 020 635 62 50 44 5 1 2 5 4 16 26 56 51 41 1 0 3 2 3 5 1 6 452 6 143 0 3 6 5 03 6 1 1 6 2 4 5 0 24 6 6 5 5 413 0 50 21 62 32 40 5 06 3 1 06 1 1 6 2 4 65 08 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
Jumbo Arroword Good puzzles Jumbostyle grid. Arrow-word ✶✶ Simply answer the clues in the direction that each of the arrows point, to fill the crossword-style grid. Savoury Hurt; Step They prove Secretly Seller Small The Fish meat clever in who you copy into ___ File basket jelly are (abbr) an email (informal) songbirds dancing (1,2) Forsyth (inits) novel Distribute overseas Amusingly Silvery fish Talk eccentric of the wildly Donkey carp family Australian arboreal Wayfarers Chop Extent Befitting A marsupial or of a nobleman cut a woman surface ___ ___ ___ Newton: David: Fisher: English actress physicist US lyricist ___ A Marry Japanese Thurman: fitting beverage reward US actress ___ Major: Port ___ Country ___ & Sharif: in Stimpy: US the Great in Egyptian animated actor Asia Bear Scotland sitcom ___ One event Seed ___ de in a vessel Danson: Cologne: perfume sequence US actor Bravo Dilapidated Talked Grandmother audibly (informal) Fizzy Units Assisted Fourth Chickens Near drink of Gospel electrical Garland resistance of Short US Sooty's Soak flowers cylindrical tax girlfriend up; piece of agency wipe (inits) away wood Great courage 'Goodness Sinking Residue me!' down from online a (inits) Greek fire writer goodhousekeeping.com/uk 9PUZZLE COLLECTION GOOD HOUSEKEEPING of fables
Jumbo Quick Crossword Jumbo Quick Crossword ✶✶ 12 34 56 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 ACROSS 33 Leers (5) DOWN 25 Finished (3, 4) 35 Extreme (5) 26 Small carved figure (9) 9 Body of written texts (6) 36 Intertwined segment 1 Gathering of people (12) 27 Cure-all (7) 11 Flowering plant (5) of rope (4) 2 Squirt (6) 28 Topmost (7) 13 River in South America (7) 37 Impudent (6) 3 Not odd (of a number) (4) 32 Generally accepted (12) 14 Support for a golf ball (3) 38 Burn with hot liquid (5) 4 Large steep hills (9) 34 Disgraceful; causing 15 Set fire to (6) 40 Sweet food courses (8) 5 Jumped on one leg (6) outrage (10) 16 Without interruption (3-4) 42 Appeal (10) 6 A cereal (6) 36 Renown (5) 17 Published false 43 Marine echinoderm (8) 7 Thief (6) 39 Female offspring (9) statement (5) 48 In a hostile manner (12) 8 Bad-tempered mythical 41 Mischievous sprite (3) 18 Female singing voice (5-7) 51 Cool and distant (5) creature (6) 44 Of inferior quality (6) 20 Remove a monarch (8) 52 Disciple (7) 10 Plant stalks (5) 45 Novice (6) 23 House (10) 54 Disease of the body (6) 12 Decorative design 46 Contaminate (6) 26 Blue precious stone (8) 55 Hair style (3) style (3, 7) 47 Floor of a fireplace (6) 29 Piece of paper (5) 56 Coiffure (7) 19 Meaningless (9) 49 Brazilian dance (5) 30 Involving financial 57 Small woody plant (5) 50 Personal attendants (6) matters (6) 58 Part of a stamen (6) 1021 Very fashionable (3) 53 Falls back (4) 31 Midge (4) 22 Choose through voting (5) 24 Provokes (7) 10 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
72 45 1 8Good puzzles 72 72 9 Fien1dis6h 44 55 Sudoku ✶3✶✶7 18 81 9 17 68 7The classic sudoku puzzle. Place the numbers 1 to 9 once in each row, column and 3x3 bold-lined box. 4 5 36 72 38 81 7 46 78 62 38 46 e word at the top of the NICE AUNT word at the bottom of changing one letter of the loafdtdheer.WLleDtaotoednrsrod.tderN✶ICE hoerder Move from the word at the top of the ladder to the word at the bottom of the ladder by changing one letter on each step of the ladder. Do not rearrange the order of the letters. goodhousekeeping.com/uk AUNT 11PUZZLE COLLECTION GOOD HOUSEKEEPING
e a ‘5’ in a cell 4 part of a region number 2in 2 3 2 Rectangles ✶✶ 4 8 10 3 2 2Divide the grid into a series of 14 5 4 rectangles or squares, so that every 7 cell is in exactly one region. Numbers 2indicate the size of each region: for instance, a 5 in a cell means that cell is part of a region that contains five 2 2cells in total. There is only one number in each region. 10 3 2 142 12 75 2 22 14 12 ds of three or more l as you can. Each central letter and LA T e outer wheel – no OU dhemoreWtimoersdthwanheel ✶ A O D Find as many words of three or more HD D d letters in the wheel as you can. Each D d hidden in the Lword must use the central letter and o a selection from the outer wheel – no letter may be used more times than it Oappears in the wheel. Can you find the nine-letter word hidden in the wheel? T H O U 12 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
ant Wordsearch Good puzzles d eachGoifathnetwoWrdsoinrdthesgeraidrocf lhett✶ers. Words may be hidden horizontally, tically Foinrd edaciah ogf othenwaolrldys inatnhedgriidnofeleitttehrse. Wr oardsfomarywbeahridddsenohorribzoantcalkly,wveartircdallsy odr diriaegocntailloy n. and in either a forwards or backwards direction. Kitchenware KITCHENWARE L GR E T S E Z R E C I L SO T AMO T ERREKOOCERUS S ERP F EC J QA T T X X CWL B A K I NG T R A Y U WT F R Y I NGP AN P E I MC E SWE UEO J REMAE T SOVKRDNUOG GR RWL T OC A P P L E COR E R KW PBKCHOPP I NGBOARDP I UO NOOP SGN I VRE SURECON J O F S TOCKPOTOTKNGTONGSD CG I EGSROS S I CSNR T ACME DOY T S ZQOQUP J E I DDCU I N ME F L T V F I CE LBULHO I PXS P UG F N A P E C U A S UO EWB J I P V E F R E H S AMO T A T OP H T J NO J P E F I E I WS S E R P C I L RAGO UT I L I L P I Z ZAS TONEUVBN LNFRENLROL L I NGP I NTOB K T I M E R T P E P P E R M I L L MWX PGOR Z BB I ASA L U T AP S L L F WC A K E T I N N N S Y CO L A N D E R APPLE CORER FORK PEPPER MILL SPATULA STEAMER APPBLAEKINCGOTRRAEYR FRYINGPPEAPN PER MILL PIZZA STONE STOCK POT CAKE TIN GARLIC PRESS PLATE TIMER TOMATO SLICER BAKCIANNGOPTERNEARY GRATPEIRZZA STONEPOTATO MASHER TONGS CHOPPING BOARD GRILL PAN PRESSURE COOKER WHISK ROLLING PIN WOK CAKCOEFFTEIENPRESS KNIFPELATE WOODEN SPOON CAN COOPLAENNDEERR ZESTER MEASURIPNGOCTUAP TO MASHESARUCEPAN COOLING RACK MIXING BOWL SCISSORS CHOCPOPRKINSCGREBWOARD MUFFINPTRINESSURE COSEORVKINEGRSPOON ELECTRIC MIXER PEELER SIEVE COFFEE PRESS ROLLING PIN COLANDERgoodhousekeeping.com/uk SAUCEPAN 13PUZZLE COLLECTION GOOD HOUSEKEEPING COOLING RACK SCISSORS
Place the numbers 1-9 once in each 19 10 16 row, column and 3x3 bold-outlined box. The values of the squares in 8 15 9 13 6 dot1t9ed-line regions m10ust sum to the 16 Killer Sudoku3 713 18 9 13 number given at the start of that 8 15 9 13 6 ✶✶✶15 6 region, and numbers cannot repeat 20 e insi3de the7 m. 13 18 9 13 Place the numbers 1 to 9 once 10 in each row, colu1m5n and134x3 5 bold-outlined box. The values 15 6 20 of the squares in dotted-line 11 15 r1e0gions must add up to the 11 3 number given at the start 10 15 14 5 of that region, and numbers c1a0nnot repeat in1si2de the1m7. 9 11 15 10 11 3 11 9 7 10 12 17 9 14 3 19 7 11 9 14 3 19 Word Pyramid Answer the crossword-style clue to the right of each row of the pyramid to complete Word Pyramid ✶the puzzle. Each answer is an anagram of the answer on the row above but with an extra letter added. Answer the crossword-style clue to the right of each row of the pyramid to complete the puzzle. he righEtacohfanesawecrhis raon wanaogrfamthoef thpe yanrsawmer iodn tthoe rcowoambopvelebuttewith an extra letter added. am of the answer on the row above but with anUsseeddaachcahirair Used a chair SSmaalllssoocicaliainlsiencstsects FFeelliinnggoof df edeepeapnxainetxyiety Small social insects RRepprreesseentnattaivteivses Oddd Feeling of deep anxiety PPoolilciecerarnaknk AAdodloeslecesnctesnts Representatives goodhousekeeping.com/uk Odd 14 GOOD HOUSEKEEPING PUZZLE COLLECTION Police rank
rney Good puzzles g visits every square on 33 3662 62 3567 40 67 King’son Journeyatctly once, 3st3arting 3at6 ✶✶neg at 100. Dedu3c5e the 40 ooff the king – some of 31 43 48A chess king visits every 3169 96 43 48 69 96 eusady gisvqeuanre–onathnedgrtidheuxasctly 2699 95 58 99 95 ohveesgrid.eonnTdcehin, gestaatkrt1ii0nn0g2g. aD6tem1daunocdeves 58 itnimaeny the whole path of the king 57 23100 57 100 (dsoimreecotf iwohni2ch3aistaalreatdimy e 51 72 given) and thus complete iagonatlhleyg).rid. The king m2ov2es one square in any direction at a 22 51 72 20 52time (including diagonally). 73 91 90 15 1 20 52 73 91 90 54 85 86 10 11 7 6 78 8015 183 54 85 86 7160 11 7 6 78 80 83 76 al 14 Symbols 24 of Value mf Vn alue 13 represents a whole 22 ✶✶ 14 me 1-10. The sum total es in each row/column Each shape represents a at the end of each whole number from 1 to 10. n. Use this knowledge he numerical value The sum total of the shapes pe. in each row/column is 24 displayed at the end of each row/column. Use this knowledge to deduce the numerical value of each shape. 13 22 15 27 9 goodhousekeeping.com/uk 22 15PUZZLE COLLECTION GOOD HOUSEKEEPING
Samurai Sudoku ✶✶✶ bPSolaalcdme-otuuhrtelainnieudmSubboedxrsoo1kfteuoa9chonocf ethine each row, column and 3x3 5 overlapping sudoku grids. Place the numbers 1-9 once in each row, column and 3x3 bold-lined box of each of the 1 5 659 3 479 234 6 78 8 8 46 2 15 2 17 78 9 5 193 4 76 2 6 28 539 24 8 3 42 8 8 96 62 47 2 43 8 71 71 535 46 9 4 1 7 2 96 426 4 83 827 5 58 3 2 3 8 96 8 34 6 892 794 16 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
∧ate ∨ Good puzzles 4 >< 3 ki < ∧ ∨ <e numbFersu1t-5oosnche iinkeiac✶h < 4> column. The ‘>’ (greater < Place the numbers 1 to 5 once < < d ‘<’ (leisnseatchharonw)asnidgcnolsuminn.dThice a‘>t’ e ∨ (greater than) and ‘<’ (less than) < ∨ <ne squasrigensisindgicraeteawteherr/eloonwe seqruare > than thetishegaraeddajjtaaecrce/lneotwnseqtruiasnrqevaiunludaeicrtaehtaend. d. ∨ < ∨ > by 2 2 423 d11 3 12 3 21 3 Bridges ✶✶ ach setvery isl5and (represe3nted by 5 42 2 3 4 2Connect every island 3 (represented by circles) netso a single interconnected 31 1 3 1 2into a single interconnected o do this5draw bri4dges 2 group. To do this, draw 3 1 32 1 3bridges between islands. The number in each circle islands. The number in each 23 25 4 3states how many bridges toes how man2y bridges must 5 5 3 must be connected to that island. Bridges cannot cross esc. ted to5that island. B2ridges 3 1 3 each other, can only be drawn horizontally or vertically, and ross each other, c1an only 252412 1 3there can be a maximum of n horizontally1or vertic3ally, 222 35 two bridges between any 2 e can be a maximum of two 3 2pair of islands. between any pair of island1s. 53 12 13 1 3 3 2 1 22 2 1 goodhousekeeping.com/uk 13 2 2 3 17PUZZLE COLLECTION GOOD HOUSEKEEPING
MaMazzee ✶ Find yFoiunrdwyaoy ufrromwathyeferontmry tahrreowentotrtyheaerxroitwarrtoowtthoesoelvxeittahirsromwazeto. solve this maze. → ← 18 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
Jumbo Kriss Kross Good puzzles Jumbo Kriss Kross ✶✶Place each of the words into the grid once to complete the puzzle. 3 letters Place each of the words into the grid once to complete the puzzle. 3 LETTERS BaByay 4 L4ElTeTttEeRrSs AgAagrar DiDll ill PinPeine SaSgaege 5 L5ElTeTttEeRrSs Anise BaAsnilise BirBcahsil EleEBmilercimhi HeHnennana LeLmeomnon MyMrryhrrh ThTyhmyeme 6 LETTERS 6 letters Citron CoCffitereon NuCtomffeege OrNauntgmeeg 7 LOErTanTgEeRS Co7colentutters JaCsmocinoenut OrJeagsamnione RoOserehgipano 8 LREoTsTeEhRipS Be8rglaemtteotrs Cinnamon LaBveenrgdaemr ot RoCsienwnoamodon TaRLrraoavsgeeonwndoeord 9 LTEaTrrTaEgRonS Fenugreek Go9ldleenttreords PaFtcehnouuglrieek SpGeoarldmeinnrtod 10PLaEtcThToEuRliS EuScpaelyaprmtuisnt Pe1p0pelermttienrts SaEnudcaalwlyopotuds Peppermint Sandalwood goodhousekeeping.com/uk 19PUZZLE COLLECTION GOOD HOUSEKEEPING
qpueallroeut each word. BEND 15 Numberumbers from 1-9 once xCHUG 6 + K NSquare ✶e puzzle grid in order to FROTH - x he maths sums correctly. +JIBE Enter the numbers from MILD + 19 ms from1 tloe9ftontcoe eraicgh hinttoathned puzzle grid in order to +OAK om, rathcoemrpltehteatnhe imnatshstrsiucmts PAWS + x correctly. Perform sums al ordefrro. m left to right and top to xPRY Lbottom, rather than in strict mathematical order. WAX + + 15 ZAP FM 50I J O P R T U W Y Z 11 21 h 9 2 4 7 Jigsaw 9 Sudoku 45 21 ✶✶✶ 5 39 6 Place the numbers 1 to 9 once in each row, column and 13 bold-outlined jigsaw region. 7 52 78 39 81 20 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
Good puzzles Hanjie ✶✶✶ Numbers around the edge of the grid indicate how many consecutive squares to shade in the respective row/column. Commas indicate a gap of at least one blank square between sets of shaded squares. For instance, a clue of 4,3 means that somewhere in the region there is a set of four shaded squares, followed by at least one empty square, then another three shaded squares. 1 11 1 112 221 2 112231 112 111 122133211111112211 423121121112255134 31151311311118115813 13 2 2 1 2 1 1 1 1 1 4 1 1 1 1 2 1 2 2 13 20 1, 1 20 18 2, 3 2, 1, 2, 1, 1, 2 1, 5, 1 1, 1, 2, 1, 1, 1, 1 1, 1, 5, 1 1, 1, 1, 1, 1, 1, 1, 1, 1 1, 2, 2, 1, 5, 1 1, 1, 1, 5, 1 1, 1, 2, 2, 2, 2, 1 1, 1, 1, 1, 2, 2, 1 20 1, 1 2, 1, 1, 1, 2 2, 1, 3, 2 3, 1, 3 12 goodhousekeeping.com/uk 21PUZZLE COLLECTION GOOD HOUSEKEEPING
mn and chain of six-linked 1 345 h Number 1 3 2 Chain ✶ 32 Place the numbers 3 4 5 1 to 6 once in each row, column and chain of six linked squares. 1 6 1 6 Tour night visits each square 48 75 17 65 d exactly once, starting at ding at 100. Deduce the 39 16 41 21 26 65 45 23 Knight’sth of the knight – some of Tour ✶✶lready given –48and7t5hus 17 the griAdc.heTshs kenigkhnt ivgisihtstemachoves 85 50 73 78 81 52 44 39 16square of the grid exactly 41 21 26 24 13 88 67 72 o squareonsceh, sotarritzinog natt1aalnlyd ending 45 23 by onepastaqt10hu0o.afDtrheeedukvcneeigtrhhttei(cwsoahmollleye, 85 50 73 78 81 52eusares voaenfrdwtthihcicuahsliclsoyamlrfpeolaedltleyotgwhiveeegndr)id. 91 82 44 quare hoThreizkonignhttamlolyv.es either 12 87 24 70 1 62 two squares horizontally 13 88 67 72followed by one square vertically, or two squares 36 9 90 61 100 30 3 34 32 55 58 91 82vertically followed by one square horizontally. 94 70 1 62 12 87 36 9 8 95 99 4 90 61 100 30 3 22 GOOD HOUSEKEEPING PUZZLE COLLECTION 32 55 58 goodhousekeeping.com/uk 94 34
wheel Good puzzles sdms aonfytwhorredes oofrthmreoeroer more A BB LLE AE K RE Wordwheel ✶in the wheel as you can. Each K meul satsusyeoFitnuhdeacscamenann.ytrwEaolardlces thotfethrreaenodr more letters in the wheel as you can. Each e central letter andtion fromwortdhmusot uusteetrhewchenetreallle–ttneroand he outer wheel – nomay be ulaeststeeelerdcmtmiaoynobfreroeumstetidhmemoeousrteetrthimwahenesetlh–annoit appears in the wheel. Can you find the d more times thannine-letter word hidden in the wheel? e-letter word hidden in the rd hidden in the EA B R AB Hexagon Word Hexagon ✶✶each of the letters below the grid once into the empty hexagons. Enter the letters in Place each of the letters next to the grid once into the empty hexagons. Enter on to adtjhaecleettnetrshinesxucahgaownayttohast pit eislpl oossuibtleetaocfihndwallothrde w. ords listed alongside the grid by moving from hexagon to adjacent hexagon to spell out each word. BLOT M K Lletters below the grid once into the empty hexagoCnsH.I Enter the letters in ABEFGHJN DORERWS T U V Y Z ent hexagon to spell out each word. FEZ BLOT W LP CHI MK FRET DREW JABMLOFFTREEZT JOT JAM CHI JOT PUB PUB DREWPUG PUG VOTERS DC YAK W VOFTEEZRYASWN I YAFKRET YAWN JAM goodhousekeeping.com/uk 23PUZZLE COLLECTION GOOD HOUSEKEEPING ABE FGH J NORS TUVY Z JOT
21 13 2 eper 3 e mines hidden in the 3 2 12 13 2 3 M✶✶inesweepermbers in s2quares sp2ecify1 1 y mines there are in 4 1Locate the mines hidden in the ring sqguriad.rNeusm–beirns icnlsuqudairnesgspecify 2 2 1 1 3 2how many mines there are in 2 3 3 2y touchnienigghbsoquruingarsqeusa.reNs –oincluding 2positiodNnioagemodinnaelislnyatroesuqpcohusiniatgiorsneqesudairnes. 14 g a numsqbuaerer.s containing a number. 2 0 30 32 12 1 1 2 12 1 2 2 11 2 0 0 12 11 1 21 1 2 21 12 1 AABBC ic AABBC letters A, B and C once A ABC Logic Bow and column. Each row ✶✶ mn also contains two blank B B Place the letters A, B and C letters at the edge of a B once in each row and column. mn indicate which of the AEach row and column also C contains two blank cells. column. The letters at the edge of a row/column indicate which Bof the letters is the first/last to appear in that row/column. C B B A B goodhousekeeping.com/uk 24 GOOD HOUSEKEEPING PUZZLE COLLECTION
Codeword Numbers in the grid (1-26) correspond to each of the letters of the alpGhaoboedt fproumzzAl-eZsin Codeword ✶✶✶Three letters are provided to give you a start. Numbers in the grid (1 to 26) correspond to each of the letters of the alphabet from A to Z in some order. Solve the puzzle and fill in the letters in the key included as you find them. Three letters are provided to give you a start. 13 1 3 17 18 2 3 19 22 7 3 13 3 18 22 9 17 5 20 11 9 5 3 1 3 20 6 20 3 9 13 3 12 14 5 20 12 8 3 3 17 13 3 13 22 17 24 85 9 20 9 12 15 3 22 23 9 21 5 1 3 21 17 20 25 22 1 10 16 2 20 3 16 2 3 20 17 4 8 3 17 1 3 12 9 23 6 17 19 3 8 5 18 5 1 3 12 13 5 26 2 4 22 8 13 4 8 5 1 13 22 13 4 6 3 2 ABCDEFGHIJKLMNOPQRSTUVWXYZ 1 2 3 4 5 6 7 8 9 10 11 12 13 Y LS 14 15 16 17 18 19 20 21 22 23 24 25 26 goodhousekeeping.com/uk 25PUZZLE COLLECTION GOOD HOUSEKEEPING
e a single square in any 3 2 2314 luding diagonally, on 1 3 1Journ2ey 4 1 124 3Find4er ✶ 2Plot a route through the grid that 4 24 3 3 he starts on the shaded 1 and ends on 1 43 24 the shaded 4, moving through each ou 4 1 3 3 31 42 1 2 1digit in turn 1, 2, 3, 4, 1, 2, 3, 4 and ce, 24 1 so on. You must visit every square ny 3 2 2 exactly once, and can move a single square in any direction, including 131 diagonally, on each move. 443424 321213 s so that the sum total of 11 16 30 17 or down run of squares 5 6 9 8 total at the start of that 4 19 4 11 11 18 8 aelrocf annot repeat within11a 16 30 11 29 8 Kakuroems ust use nu5 mb6ers fr1o7 m 29 9 14 at 4 19 14 4 7 7 6 ✶✶in a 11 11 18 7 6 12 om In this crossword, fill the white squares so t7hat the sum tota7l of e6ach across or 3 6 11 3 12 down12run of squares matches 7 16 9 24 the total at the start of that 14 16 run. A3number cannot repeat 3 17 12 14 within a run, and you16must 9 29 17 use n1u4mbers from 1 to 9 only. 16 16 10 29 24 8 11 16 16 11 10 11 17 11 14 17 16 22 16 22 16 24 24 26 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk 26
1 10 00 0 Good puzzles Binaryvtehe grid so that each row 1 1 10 e ✶✶1 1 0 0 0 00 more thCeaaocnmhprtloewwteoatnhdce cogornildusmseoncthuattive 1 1 any rowcTohneotsarainmcseofinvleuum0mbs eanrn.cdaIfnnivneott1hs. e 00 1 10 1 0 1appear in more than two 0 0 consecutive squares in any 0 1sequenrocweorocfol0umsna. Inntdhe1finsisthoed 0 puzzle, each row must have ow, anda dliiffkeerewnt isseequefnocre oefa0cs h 1 011 0 00 11 and 1s to any other row, and likewise for each column. 1 11 001 1 18 9 doku 2 3 7numbers 1-9 once in each 529 Ji9gsaw Sudo3ku n and bold-outlined 18 ✶✶✶ 6on. 2 529 1 9 Place the numbers 1 to 9 once in each row, column and 623 7 bold-outlined jigsaw region. 7 2 7 9 goodhousekeeping.com/uk 6 7 8 8 16 27PUZZLE COLLECTION GOOD HOUSEKEEPING 58 623
tleships ate the position of each of 2 2 sshhiippss listed below in the grid. 4 mtBbhaetrtpsleoassrhoitiiuponnsdotfheaecdhgoef tell you 4 4 2 2 Battleships ✶pnLsuomlcLisaobtcteeaedtretohbthefeeslpohpoowipssitiisitnoienotgnhomefoeegfanecrithadsco.ihfnthoeefacshhips 2 4 2 3emudrsstLlirttNaohrseduoohhbsentcguceruieewemaondradnbpstlmieohtsergyurleesnddebautcoguznehobwgueenzmomtdtdunehlisaeflemodpLNtriasdeleetlLinndtdohbhiuwnhroasre.isuncoesnwetgiedbsceehoeprtmmclgptcueeS,lassionslolneoadeaoildnaubtdoiiuhtpnnweenalsfstirieirmhrlnenttidsrcynidcbptuoehratotottgsloesiohbiheogeseleuchaoneumtllnueueeaeddholldnndfafolaerrergtilelpndygioscaoubhwrannsytortooeedogthwmuiebidehp.hghmefldpddsufonllioegosnsli.eneoriugndldtaeoheotwspueisfaoeroilnthizntawatriNispyoipnhlfhnndhdrtiltdzcgnyoesiaoueuteeth.oswub.tlohaohleueumeemltecnsefeennhzeggsnyNosgnldo.bebeiidazrmlpdildtdounugaifuephenmlSwbldugeelyfmcemeecmryergtz.srduhhnstyooh.aeiezt.ebbdnhtebeleozioloaNsutueanee.aSwpynlffezlenco.mrruirutcsnhywtotlhssSafrmemheashonshgu,heoaiettahluilpo.binhtbalpfeplrioreicfedpsensoSissrfyrhdsi,rru,tdhsothhenh.eeoiiudapesapfrcsosshhuhinpidps 4 1 nbpagyu3rzwezdalesitae.urgrS, ropsihnoeuicnpguzlsuazmndllaeeldirny.nee.gtSssddhuiiniarporgosenouaanncraadehllellysrd.osuworidrnoaeuannsllddsbeciddyoelouswnmaantlleosfri,dthees 0 in2cludinbgy wdaitaerg, oincnluadlliny.g diagonally. 2 2 4 1 2 2 2 2 1 2 10 1 22 0 11 2 0 2511041141 1 2 2511041141 1 2511041141 gh5 Sudoku 52 classic sudoku puzzle. Place 5 256 3 5 nSuumdobkeurs 1-9 once in each row, 28 4 ausmTsoincugasnuhddSo3ukxdu3opbkuouzldzl-eli.nPeldacbeox. 6 366 385 1 mTbheerscl1a-s9sioc nscuedoinkueapcuhzzrolew. ,Place 3 ntahnedn3uxm3bbeorsld1--li9neodncbeoixn. each row, 51 8 844 4 1 1 Toughcolumn and 3x3 bold-lined box. 3 36 865 83 1 Sudoku 4 7 1 ✶✶ 2 4 4 47 The classic sudoku puzzle. 5 359 337 Place the numbers 1 to 9 5 once in each row, column 4 2 7 and 3x3 bold-lined box. 2 2 5 5 7 76 9 28 GOOD HOUSEKEEPING PUZZLE COLLECTION 2 2 9 39 3 goodhousekeeping.com/uk 69
Good puzzles Cryptic Crossword ✶✶ 56 7 Cryptic Crossword 1234 11 22 33 44 5 56 6 77 8 9 88 99 10 11 12 10 10 11 11 12 12 13 14 15 1613 13 14 14 15 15 16 16 17 18 17 17 18 18 19 19 19 20 21 20 20 21 21 Across Down AcrAocsrsoss DowDnown1 5 8 - BTHroa815arldfe---etdet81A5TBHhrxToeCBHfertoaroamaraoaRre158lsraddflerummfOelseetdrp---tdheeeSheofhofeHTB,loeeSryomanmrrnoaacraemsbamlmharlslspeapedfereueheatrlmheyetdralerihclnacsbo(onhtcfehb8heanuoamh)emtiargntnraucrtimmgsoehrlsdiepcnsaoa(erexgh4nhunsaetr)aunrgtnenrcrkbedemeheeaar,xnueustmntrlunrniyecesorkuam11c1hemsen264iahr,smonlegatPnyPBannrralrinryeteul(dyieoelun8clmaasrrttxgi)etsreussmehasltsr(ynaunrirl7uaneitin(trkb)(aplgt5em8cllellye)o)ets,(nhet4digsnnrid)luinnrye(tclgh5puatbsel)uaiy(rsmr4tyleahya)ia(hcn7(lki8lcl)lo)et(h7fs)in(g5)1b32Dc123(or4LAOAon---e)galtWvlAALeidreaeemlgcln123lN,eivarcapteseote---tntoeliAALbl,ac(ad9leettglmgelouo)ivrrapmeleeeadaennaelamut,tcgniepnetterroo(geen6elaad)xtcimttuno231egepgnnere---ettnebea(LAAtcxrm4itonoteelg)elapgnivrrnadtteeiebetbnc11l1ielxmorm(312al,coe4tsTmseINetttap)nrootmnegidtascil(eteatbaceada9ucm(alanm)ure4httegseuI)p(atmer(ncb6lee9(latni)a9r)tuaidticnn)mgitino(teh(e8igtna6rs)li)tlneybeCxrrmeoatpelapilfnaodtcirtbcnin(aliage4s,)tm(a9n) (6) - - drunken nuisances (5) 18 Old horse and sheep 4 Fitted glass with a smooth, alongside District Attorney (6) 9 - Po9s-tp9PoPonos9esttpj-puooPdnnooespjjuutrdpodoodounpcertoiojdunudcaotfitopenrroadfdftuoeilscrloctawiooidnngitseaacnofrtteeneadtrrerarnauntngeded(ims7rce)unontn?(t7(e7))ntes4dhi-nruyFnict4ote(a-7dtiF)ngigtltae(6sd)sgwlaitshs4aw-sitmFhiotatoestdh1m4,gosPolhuatrihnsit,aysnscwihcoiainatlhytginacangogsa(s6mtie)nrogo(t6h), shiny coa 10 - T1e0edp-nriTsodced1aoeu0nncntcte-iidonnTtnageenadacfetrrieunornugadn(a7ad)rnosculiinpndpgesralyiproepluem219nr0ydfFPieoisnlrmdmldipe(of7rpiwe)denledraey(wd7efi)usllmppraefrciteis(el4d)(5()7) 6 Hairpiece to increase last is original (6) b6it-s Hofa6mir-aplHieeaccoiernptfioiedceinencctreo6e(a6i-ns)cHerealaaisrspt1e5ibeliSatcstsaettoebtfoaimtsbianoolcyefrkmcenoaignslhefetidceloannscftiedbe(6int)sceo(f6m) ale 12 - P1r2y s1-t0eliPprTrp1eiyebe2rlntyye-derirnPalminbrtclhyfyiineetgilendthar(trrih7coib)ekunlytodhfiicnmkotohnfeummt2ahoen1nincdButkaanmneloawesfnntar(mt8uaf)caolctsunttorureruymc(e7teux)cnreetlal(e7ln)st truct7s7ueWrt-eniWco(kr7iemcd)k-sepW(de8o)icppkeleeodspolpemeeso7hopom-lweeWshooicmwke1be7sahdecHotkawpenlfdeosoo(ref6mpts)klsneeo(le8rstm)oonsms(ec8hh)ooowl (4s)et norms ( 14 - B1r4in-gBs r1uin4pgo-sdBudpripnolagdysdcuphlpayrotecdrhdsa(rp7tel)arsy (c7h)arters (7) 11 - T1r1ee- Tatreaell atitmaell1st1im-emTsaritemuermeaa(tt9u)arell t(i9m) es immature (9) 16 - P1i6lot- aPi1lliot6ttlea- gPlitritllloebtygaiarllhibtitylllea(7gh)iirlll (b7y) a hill (7) 12 - N1i2ce- hNuicnet ihnuitniatl1liyn2irtie-apNlllyaiccreeinpghlaulconisnttgignlaoitmsiatelgblyairmdree(p8bl)iardci(n8g) lost gam 18 - O1l8d g-hoOoodr1hlsdo8ueshe-akoenrOepsdineldgs.cahohnmeo/deurkpsshefoelaelopnwdfionslglohwaeiernepgarfaorarllenoagwrerimanneggneat?mr(ee7na)tr?ra(7n)gem1e3n-t?In1(s37e-)cItnIsceacut gI hcPta1UiunZ3gZCLh-EtaICilnniOfsoLCLerEnacCilTatiIf,OIoaNrcnlGaoiOanuO,ggDashHliodtOneUingSDEsCKidsEaEterPliiIcDNfotGisAr2nttrt9iiocatr,nAaetlytoo(nr6ng)esy 19 - F1o9rm- eFrodrmeedr diseepdreicsispere(c5i)se (5)
of the king – some of 57 62 39 7 eady given – and thus he grid. The king moves 4165 96 61 11 9 43 86 1 in any direction a4t6a time 98 King’s diagonally). 51 52 1005 9J2ourney14 9✶1 ✶ 19 57 62 39 7 A chess king visits every 89 28square on the grid exactly once, starting at 1 and 96 61 83 11 9 34 27ending at 100. Deduce e the whole path of the king 65 98 92 14 (some of which is already 72 81 77 26 22given) and thus complete 86 100 91 19 the grid. The king moves one 71 32square in any direction at a time (including diagonally). 89 28 83 34 27 72 81 77 26 22 71 32 quare umbers from 1-9 once he puzzle grid in order to 5x + 47 he maths sums correctly. ms from left to right and +x - Numberom, rather than in strict + - 47 + 4 cal ordeSr.quare ✶ 5 xEnter the numbers from 1 to 9 once each into the puzzle grid in order to complete the maths sums x x- + + +correctly. Number 5 has already been placed. Perform sums from left to right and top to bottom, -rather than in strict + +4 x 84 mathematical order. x + 44 + 35 8 +30 GOOD HOUSEKEEPING PUZZLE COLLECTION x 84 goodhousekeeping.com/uk
Domino3es 3 1 3 2 2 0 6 uE0tach o0f 0th1e3286d0om2in5o p0iec6es4from31 25 101 32 4 4 G3ood5puzz2les 4 0-0 through to 6-6 have been placed D1o1m2i3no6e0s1✶4 1 40 32 06 3once into the grid. Can you work out 0 0 6 4 6 6 1 4 6 5whereEeacahcohf thoef2t8hdeomminoaprieeceps lfarocme0d-0?through to 6-6 have been placed once into the grid. 3 0 1 1 2 4 0 62 44 3 4 2 5 54 6 6 5 5 4 1 3DomiCnaoneyosu work out where each of them is placed? 6 0 1 2 3 4 5 6Each of 6the 281dom1ino p6ieces2from 4 5 0 1 5 556 2 1161 6 0 3 4 4 2 3 400-0 through to 6-6 have been placed 0 353 06once int0o the5grid. 2Can y6ou wo2rk ou0t 0 3 5 3052 6 3 2 5 2 6 345 1where each of them are placed? 6 3202 1 3220 4 13044303 3650 16 2 31 4 55 66 6 051 615 22 40 04 2 14 5 0 25 0 13 24 46 21 31 4 06 2 14 0123456 03 6 3 2 5 2 6 4 3 26 15 5 6 0 11 52 36 46 5 56 5 04 6 3 5by 4 0 31 2 31 4 5 6 43 2 34dJourney Fin2der 6 3 14 5 1Plot a ro4ute through3the grid2that 3 0 21 3 B4ridg1es ✶3✶4acshtBarrtidsgoens the grey 1 and ends on the 4 4 1 13sgt rCeoyn4n,emctoeveinrygistlharnodu(grehpreeasecnhteddigbity 4 2 1 1 1 3 4 4 Connect every island 3 3(represented by circles) 04 2 3 2 22eisnctirucrlens1)3i,n2t,o3,a4s,1in,2g,le3,i4ntaenrcdonsnoeoc2tne.dYou 3 2 2 into a single interconnected 2 1 4 3group. To do this, draw 1mgursotuvpi.sTitoedv4oetrhyissqdruaaw3rebreidxgaecstly on3ce, 4 2 33 2 bridges between islands. 1 0anbdetcwaenenmisolavnedas. sTihnegnleumsqbuear rine einacahny 13 3 4The number in each circle 4sode. aibccrciaeerhnccclntemoioonstotnncave,rtoeceints.seschdleouatwdochimtnhogaatnthdyiesibrla,argcnidaodng.neBoasrnlil1mdlyy,guoestsn 22 2 1 1states how many bridges must 32 2 5 33 3 1be connected to that island. 53 Bridges cannot cross each 2 24 3 2other, can only be drawn be drawn horizontally or vertically, 4 4 2horizontally or vertically, and there ca4n be a maximum of2two 3 2 3and there can be a maximum of two bridges between any 3 2 pair of islands. bridge1s between1any pair o2f islands.4 32 31 25 1 23 1 2 2 52 3 3 43 1 4 4 1 2 42 3 2 1 goodhousekeeping.com/uk 1 1 2 4 3 131PUZZLE COLLECTION GOOD HOUSEKEEPING
Jumbo Arroword Jumbostyle grid. Arrow-word ✶✶ Simply answer the clues in the direction that each of the arrows point to fill the crossword-style grid. Menacing A Natural Garden of Performed Letters Departing Openly Days Observed number skill ___: an and and in before defining person major position biblical action parcels (3,2,3) events place generally Wide open (of the mouth) Custom Detected a sound Ticked Supple over (of an engine) Look Country Negative or in votes manner Africa Public Figure of Donna ___ house speech; New York: emu zag Facts (anag) clothing and label statistics collectively A Tibetan Ancient cause Buddhist boat ___ Gadot: of monk Israeli distress actress Healthcare ___ To provider Carlisle: some (inits) extent US (informal) singer Greek Grant Heavy Single Short Charged letter stove article profile of particle 'N's someone (informal) African country High Help; Limbs Long Suggestion spirits assist used period British Hunted for of nobleman animal walking time Soviet Flower Type Form Consume security part of of a police (inits) baleen public meal whale transport Journals Furniture to Shyly Remove silt from sleep a river on Abu Dhabi's location (inits) Afternoon sleep 32 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
gions must sum to the 16 10 6 21 at the start of that 14 6 Good puzzles 16 15 mbers cannot repeat 4 K1i7ller 14 6 16 13 Sudoku 14 8 13 17 13 ✶✶✶ 16 23 21 8 12 15 21 11 Place the num15bers 1 to 9 once e 14 16 10 in each row, column and 3x3 10 bold-outlined box. The values 4 17 of the squares in dotte1d0-line 16 15 23 regions must add up to the number given at the start of th5at region, and num15bers cannot repeat inside them. 11 9 17 13 17 10 16 10 5 15 12 9 17 word at the top of the TINY word at the bottom of VASE hanging one letter 33PUZZLE COLLECTION GOOD HOUSEKEEPING f the ladder. Do not Wordoerder of the letters. TINY Ladder ✶ Move from the word at the top of the ladder to the word at the bottom by changing one letter on each step of the ladder. Do not rearrange the order of the letters. goodhousekeeping.com/uk VASE
angles or squares, such that 15 2 9 y cell is in exactly one region. 42 Rectangles ✶ 32 mbers indicate the size of each Divide the grid into a series of 29 on: for instance a ‘5’ in a cell 5 8 2rectangles or squares so that 4 ns that cell is p8art of a region 2 every cell is in exactly one region. Numbers indicate the size of each 15 region: for instance, a 5 in a cell means that cell is part of a region e is only one number in that contains five cells in total. There 42 is only one number in each region. region. 18 3 8 5 22 4 62 6 18 22 62 6 mber Diamond 5 43 8 sum of the six triangles that 75 15 pose each hexagon is 25. Can 7 142 48 387 place numbers from 1-9 in each 7 ty triangle to complete the le? You cannot repeat a number Numbern a hexagon. Diamon4 d3 h ✶✶ 8 The sum of the six triangles er that compose each hexagon is 25. Can you place numbers 7 5 1from 1 to 9 in each empty triangle to complete the puzzle? You cannot repeat 7 1 4 2a number within a hexagon. 4 81 48 387 31 7 34 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk 48 1
Good puzzles Bridge Maze ✶✶Bridge Maze Find your way from the start arrow to the exit arrow. The maze contains various bridges Find your way from the start arrow to the exit arrow. The maze contains various bridges that you may walk under or over as you find your way through. ↓ goodhousekeeping.com/uk ↓ 35PUZZLE COLLECTION GOOD HOUSEKEEPING 35
8 also 6be pla4ced once into each of the continuous rows that run around the puzzle grid, and the continuous columns that run down it. Snowflake 1 6 ✶✶✶ 5 7 4 3 385 You must place the numbers from 6 3 6 1 41 to 8 once into each of the 12 4x2 3 bold-lined rectangles that compose 8 1 6this 3D snowflake sudoku. In addition, 1 the numbers 1 to 8 must also be placed 4 1once into each of the continuous rows 1 that run around the puzzle grid, 5 5 7 2and the continuous columns 8 that run down it. 3 4 5 7 2 81 4 3 6 5 1 4 2 5 8 28 54 ds of three or more l as youWcoarnd.wEhaeeclh centralFlinedttaesrmaanndy words of three or more TI e outerlewtthereseinl t–henwoheel as you can. Each OX T II I word must use the central letter and P OY Y Wordwheel ✶ Xd more taimseelescttihonanfrom the outer wheel – no Finldetatsemranmy awyordbseofuthsreeedomr moorree times than letters in the wheel as you can. Each P d hidden in theword must use the central letter and a stehleectinoninfreom-lethteteourtwerowrhdeelh–idnoden in the letter may be used more times than it apwpehares einl?the wheel. Can you find the nine-letter word hidden in the wheel? R MR M 36 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
1 0 11 1 10 Good puzzles e 1 01 1 1 1 0 10 0Binarythe grid so that each row 1✶✶ 0more thCeaaocmnhprtloewwteoatnhdeccgoorinldumssoen tchuattive 0 0 10 any rowTcohneotsarainmcseofinvleuum0mbs eanrncd.aIfninvneott1sh. e 11 1 0appear in more than two 0 0 00 consecutive squares in any 0 01 sequenrocweorocoflu0msn.aInntdhe 1finsisthoed puzzle, each row must have 0 0row, anda dlififkereenwt isseqeuefnocer oef a0sch and 1s to any other row, and 1likewise for each column. 01 0 00 0 1 2 10 14 2 eper 2 1 2 1 21 mines hidden in the 11 1 Min1eswe0eper 2 0 11 ✶4✶ 2 bers in square2s specify 21 Locate the mines hidden in the mines there are in 0 1 10 2grid. Numbers in squares specify ing squares – including how many mines there are in touching squares.2No neighbouring squares – including positioned in4squa3res 1diagonally touching squares. a number. 21 No mines are positioned in squares containing a number. 11 2 11 2 11 0 1 20 4 13 goodhousekeeping.com/uk 2 1 1 37PUZZLE COLLECTION GOOD HOUSEKEEPING
Codeword Numbers in the grid (1-26) correspond to each of the letters of the alphabet from A-Z in Codeword ✶✶✶ ThNruemebelrestintethresgarirde(1ptoro26v)idcoerrdesptoondgtioveeacyhoouf thae slettaterrts.of the alphabet from A to Z in some order. Solve the puzzle and fill in the letters in the key included as you find them. Three letters are provided to give you a start. 1 23 21 1 10 15 24 17 21 6 17 25 21 20 4 24 18 17 8 22 23 8 20 17 14 21 26 7 1 8 22 8 13 8 14 11 1 17 1 23 26 24 13 23 1 2 24 11 11 19 24 23 16 1 17 22 14 17 12 21 1 17 2 8 21 10 22 26 5 14 11 17 26 5 25 8 10 8 5 13 17 5 24 26 24 10 3 1 2 26 21 18 8 17 9 21 11 1 8 5 14 26 21 25 10 17 8 17 10 19 11 1 7 21 5 26 14 21 20 21 21 10 7 10 ABCDEFGHIJKLMNOPQRSTUVWXYZ 1 2 3 4 5 6 7 8 9 10 11 12 13 WK L 14 15 16 17 18 19 20 21 22 23 24 25 26 38 GOOD HOUSEKEEPING PUZZLE COLLECTION goodhousekeeping.com/uk
Search
Read the Text Version
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
- 109
- 110
- 111
- 112
- 113
- 114
- 115
- 116
- 117
- 118
- 119
- 120
- 121
- 122
- 123
- 124
- 125
- 126
- 127
- 128
- 129
- 130
- 131
- 132
- 133
- 134
- 135
- 136
- 137
- 138
- 139
- 140
- 141
- 142
- 143
- 144
- 145
- 146
- 147
- 148
- 149
- 150
- 151
- 152
- 153
- 154
- 155
- 156
- 157
- 158
- 159
- 160
- 161
- 162
- 163
- 164
- 165
- 166
- 167
- 168
- 169
- 170
- 171
- 172
- 173
- 174
- 175
- 176
- 177
- 178
- 179
- 180
- 181
- 182
- 183
- 184
- 185
- 186
- 187
- 188
- 189
- 190
- 191
- 192
- 193
- 194
- 195
- 196
- 197
- 198
- 199
- 200
- 201
- 202
- 203
- 204
- 205
- 206
- 207
- 208
- 209
- 210
- 211
- 212
- 213
- 214
- 215
- 216
- 217
- 218
- 219
- 220
- 221
- 222
- 223
- 224
- 225
- 226
- 227
- 228
- 229
- 230
- 231
- 232
- 233
- 234
- 235
- 236
- 237
- 238
- 239
- 240
- 241
- 242
- 243
- 244
- 245
- 246
- 247
- 248
- 249
- 250
- 251
- 252
- 253
- 254
- 255
- 256
- 257
- 258
- 259
- 260