Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore Star Buzz Magazine July fashion special edition

Star Buzz Magazine July fashion special edition

Published by abimford, 2020-08-01 09:34:14

Description: July fashion special edition

Search

Read the Text Version

Scan to read s bm on SBM site TABITHA TALKS Mary RELATIOSHIP MOHAMMED ARTISTE OF THE MONTH JULY FASHION Limoblaze SPECIAL EDITION ENIOBANKE Fashion Trends WITH HAVILLAH WITH AnitNOLA + TOP 5 GOSPEL SONGS 1

s bm you can read previous editions on : issuu.com/starbuzzmagazine online.pubhtml5.com 2

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What is the inspiration behind that proper. name?? Q8. What Approach should be given to it?, since this to us is a Ministry Akin’Made - Akin’Made is conned from From the EDITO฀RS DeskAkinnrinmade actually and I have always been particular about making Akin’Made - Branding has got nothing to sweet music, it stirs up a great sensation do with religion or whatever. Whether in me. So whFeanshitohne Soenpspeoirstuonniteykitnod of sensmeinthisattryis nootrrealilnydcuosmtrym, on tfhoer public perform at anLoenvgenntowwitihn atheteGamospcaelmMe usicscenpee. rIct ehpatsiobneeonfoenveeoryf thinodsieviadrueaasl is quite and I needed a cowlleechtiaveve onanemwe,ayI or the oathneirmtpreoartteadnwt tihthinglevtoityp.ay attention too, thought deeplyBaubt olautteltyhefamshaijoonr qinuathlietyGospel Mesupseiccisaclelynetohaastrteaainllyachreaangsoenda, ble rate about the mAusilcotthoaftoIpdMouasincdMloinvies,teirt’sshave emobfrareceledvtahnicset.ool in conveying the nothing but sweetness. message of the Gospel through songs Imagine Tim Godfrey and Xtreme attire durQin9g. onWe hoaftthSeihroAulndnuMalinfiesaterlrescsosCnocnesrti.d..e..r This mTohnetyh wweo'rlel bneotlhoionkginsghoarttBorfa\"nrdaignsg\"injust to deWnohteenanBdracnodnivnegy? amessage. (I Love that). GosApettlacMkuinsgic.GWospeeluMnduesrisctaiannds ftohar ttheaisr choice Aokf iDn’Mreassdeis -bTehceombianlganracme poafnktnthowesleeddgayes.. gospelers we're not just inWtohtahtisisbtuhtethpilsacise of fashaionnd ipnraGyoesrps,elthMeruesiacr?e certain principles to us is a MiniWstrhy,yTshhiosuhladswbeeeinncgluivdinegitain our moesvteirmy paorrttaisntet asnpeeecdt oftoMuinnidsterrys?tand to lot of Musicians oTuhtetsheerqeuehsatirodnstimanedomnore willsbtaenadnwsuneirqeudeinanthdistmheontethst’sof time. That’s what approach to use Edition of Star BwuzhzyMwaegahzainvee. some artistes who have Mary Mohammed popularly knowbeneansAdMoAinZgOmNu:sAic ffaosrhiaonbiosutat 20 years Q6. What is your wunidtherGstraenadt sinegnsaebwoiullt be tacklainngdthaersee sistislluvees rayndmuocthherreslevant. AiBuyamsornkeaaudidnngs’dsMethaitnoaoongwddEr?esn?pifdwioe-oerrhb.nBsaaotritnanf/yk.nwedIGthiahonieusgmtbwpreyiwrhsaooaiddutathyuadcHftrTteoee,afrhrivmionassieenrlaasrtYwihhnFvnyaiohdotcioarsture’miustg,aahaudasnivevnyegegrmMtaapenlonoloAaoAdrattfveclscseetoteoyauoanrum,waocnrltIuleoefahllryaauniaeytrdnrtgsoentpitrixuyeesolaptosrwaeucafw,rtie.enhl.yo.l.deougaYidnuloondgmidundnG'goostbhmnwoeton’otdeautcn’lrntsedetoe.rkletebmiandaeiginsstdecsooyotaonombsuosce.oiaonarugelsl, Send us a mail@ info.starbuitz’szmpaegratzinineen@t tghmataail.scyoomu pray or having Q7. Should Gospel Musicians take prayed, you ensure to embark on a Branding Serious promotional/marketing plan, with a Akin’Made - Ha, Yes of course. As serious good art cover, of course with a as every other thing that matters. Your professional music production. The fact music is likely not to progress or die 3

s bm Exclusive INTERVIEW Mohammedwith M A R Y 4

Moderation is vital........ Your style should be able to fit in the environment of message dispersal฀ AnitNoLa: We will olukotun, Kogi because, while in like to meet you Ma. State... Don't worry; I school I was still Mary Mohammed: I am bringing that engrossed in politics am Mary, Mary village to the map and I was the student Feranmi Mohammed. soon, Amen... union vice president People call me Yeah, I am a for the college of Amazon though, lol. graduate of Human health sciences, So, you can call me Anatomy, University University of Ilorin Amazon. of Ilorin, Kwara and before then, I State. I am currently served as deputy AnitNoLa: So a corp member. senate speaker for Amazon, tell us the faculty. So, I was about you, AnitNoLa: What do really engrossed in background, you do majorly? I politics I had little or academics, and sense music to be no spare time to be family. your side thing. fully involved in Mary Mohammed: I music all through my am a child of God, stay in school. Before birthed into the Mary Mohammed: then, it has always family of the The major thing I do been church music Mohammed. I am the now basically is and all that. only female child of Music. I don't know four children, and why you sense it to İ OÑŎPOÑǾPOÒŌŊŒHŇŎÆH be a side thing but, the last born too. actually before now model, I am a face it used to be Hehehe. model basically but I am from ife- 5

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What is the inspiration behind that nlaamteel?y?I have ventured into some fashion proper. Aliknine’Mmaoddee-linAgk.inS’Mo,adI emiosdceoln, nIedamfroamn AakcintrnerisnsmaandeI makcetuaplelyanuatsnfdor sIaleh.aFvoer HQo8w. Wwheallt Atphepnroawcehrsehouylodubeabglieventoto anlwowaytshebemeanjopr athrtinicgulaI rdoabmouusticmbaukt itnhge mita?,nsaingcee thsicshtoooul s iws oarMk,inicsthruyrch and psinwnmbfeaoaeroswmfesshoi,tteciroa.mmwinmlul.hSyapsaIoitocmta,raytiwmInat lhsniaenteatimvernespfonauaptftpshrahiwtensiaostioteinhogofrpnreaeeampsnattoyt.teethrautslueaismfninbeaistocsaytaru.timitgoIttheoni’sst politics? Cus' college of health sciences and I needed a collective name, I iAs..k.iYn’oMuakdneo-wBwrahnadt.ing has got nothing to thAonuigtNhot Ldae:eWpleylla, bhowut dthied mitaajollrbqeugailnit?yI c2aMmpdln0aaoeidn0srrsiycwLs,Ae,teirnptIyxhoMtweitoorhcaenuehsoltariiogarmvCfeiomsaeeanmeivntndeopatd:hrrutuyoesswrAtfFirhanrceyaedtc,lulptuiovaelrwtivledyletysshuhfr,eea.einpllWtla.oiinsrwhgopeqsuuhmtunbhiidpyeltiecr anfMmobrtoeoahmaurinytngtmMhbceuhousihtlmidacs.uwmhsoemicoeedttdnh,e:astIss.uIandmboeaaamnBd,aplocthivsietl.d, riSte’osn, Iaancitmupaollyrtahnatdthiangwtoaypaoyf apttreionrtitoiznintogo. , choir and teenager’s choir. I officially TehsepneIcihaalldy atowayttaoifnreaadreinagsoinabbitlsesurachte Tjhoisinmedontchhwurec'hll bceholoirokaintg1a3t .BrBaenidnigngthine btohufalktryeit.ledvMoaenescane'n.twahcicleu,muwlaete and become Gyoosupnegl eMst,usiIc.wWase suenednersatas ndsmathlal.t Masy could have gionsteprevleierswwder'roepnpoetdjumsteinttoo stohipsrbauntothciussi'sI SnQieg9nha.t,teWespshiaetttciniagSlshlyotuhbladutdgMsepitanisnsintteteirndsgsiC.ntoonstidheer ltwootssshhtiainnauinnoggstggfiiansssgpoMoaopnpurMorsoavaivacioennichaiirochsing,ettrstihmyoi,to’etusaTuoshtnIenjidugseths.ohtetaIrttesmhnhabaeyhettanuecrarndhawtigulltdlaryiimvasilvnedoagotoilhnctanoee't OWnheetnhiBnrganI dailnwga?ys tell them is 'the first beginning. tAhiknign’Mthaadteq-uaThliefiebsamlaencfeorotfhiksnpowosleitdiogne QF6o.r Wlikhea8t iys eyaorusr nuonwd,eIrshtanvedinbgeeanboinutto ias nbdecparausyeerIsa, tmhearestaurdeecnet.rtSaoinIpnreinecdiptloes uABgapmsrkeaaoriudntnsssi’pdstiMctie2stnaolagdyan?aee?dinrdadt-eiryssntBesItnr,isaof,yhbwncadahvIiasunehircgacaphvblilreseyomebdaunruaisscciticteakn,.regmAdsdegnuirtdlohpivgsaicpetftheo’ense,rtl msItewsthetaveiarhseviynnmwredtyaahwiuniiilennnaetirhrmqhbteoiuayesasetveiesnseoatgcunnansdadoewpemeashtnhtdyectuesidthIia'ttieempoersnst.thitssutettoanherfdatesutet's.iwmrIswhcetaaoh. nniTcdhhhsaatiivlttsl’oes imchaogreistoerr paenrdsoInk.nIot wis iwt’shatgdifetfiningesbuytouin BbuetetnhednoiInghamdusaic cfleoar ramboaurtk,2n0otyheinagrs aenvdershyogwisftwingha, t/hwerheomaryeosuevaereraol rowffhicaets tanmdpaerse stwililthvermy ymucsehrrveicleevatnot. God, yaonudstapnadrtfsort.o it. I love soul inspiring music and classical music. I love music. nAosthainnga.rWtishtee,thyoeur odnonc’atmnepeuds otor hboemaell cohvuerrchth.e place. You should be conscious QBArre7anp.nitldNieSinoshg,LoayuSloed:urioSmGuoseo,nstpiforeonlemdMyuposoiucliritaicnpss.reWvtaiookwues! Soof, yI ohuardgsreotwttoh baonudnbdaericeesrtfaoirnSytouudiaerse Akin’Made - Ha, Yes of course. As serious aancdtuaelxlytraecxuprarnicduinlagr Gacotdiv’sitkieinsgadnodms.et as every other thing that matters. Your priorities. music is likely not to progress or die Also, If you are going to release a song, it’s pertinent that as you pray or having prayed, you ensure to embark on a promotional/marketing plan, with a good art cover, of course with a professional music production. The fact 6

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on proper. What is the inspiration behind that Q8. What Approach should be given to thite?,fsaisnhceionthtishitnogu. sStiisllabuMdidniinstgr.y name?? Akin’Made - Branding has got nothing to AkinĖ’MŌaÒPdÍeŎI-MAÈkHion’wMtahdeen aiss acomnnoeddel fhraovme Akinynoriunmbeaedneabalecttuoadlloymiannisdtry Iwohrkave .....do with religion or whatever. Whether alwamyasybeewnithpacrrittiiccusl?ar about making m“iInisltoryve foarshioinndustry, the public sweeMt amruysiMc, oithsatimrsmuepda: Mgryeacht usercnhsaistiaonn in moert.hoSdooxwchheunrchthseo, itopsepeomrtsuvneitryy to It's majorlyperception of every individual is quite tpahneodrufgctynohhoorhIemoutrimrrndaiaseoacetttelweeutdarpnoaenillsynlbdyoieenaatvtcbraetoreoonittituibhncctweoiintztlhiherglteieehdsgc,hcttmawhihtveaufhetoyerjeocrafnhrenam,aaeqbsslmu,awceaaoyelhilne,maiotvyemeI r. abouSto,thwehamtuIsdico tihs,attakI edtoheairndwolordvse,anitd’s an important thing to pay attention too, nothisniegvbeuttheswme.eNtonet sles.tting things so get to about settingespecially to attain a reasonable rate me as I work with moderation. I know, of relevance. This Imloovnethfawseh'lilobnebluotoiktidngoeastnBortahndavinegtoinin Gospaewl aMy uasfifce.ctWthee ucnadlleorsftGanodd otvheart mays standardsQ9. What Should Ministers Consider tgoosupssslietafilsaeyen.sars,dItwMaw'sreeidmn'sariaserftjeoronyrtor,hlytyTeojhauueibssrxtospheiunraltetfso.ssAbsetiethsoteitnisnnhbpgegueBitovitpibhnlligees for yourself.”When Branding? is a Akin’Made - The balance of knowledge and prayers, there are certain principles lot osfeeMmutsoicikannoswoCuthrtihset.rePehoaprlde ntiomleonogner AenvietNryoLaa:rtNisotew,naeseadmutosicumndineirssttearn, d to whatreaapdptrhoeaicrhBtiobleusse. We, Christians, are hsotawnids tuhneiqpuleacaenodf ythoeurtefastshoifontimstey.leThat’s inwghiyvinwgeexhaacvtley wsohmateyoaurtsisatye,shwowhodohave what are read. yboeuemn adkeoisnugremtousgicivefoyrouarbmouetss2a0ge years wainthdoautreitsbtiellinvgearyffemcutechd relevbaynyto. ur Q6. SWo,hoautrims ayionufrourntdheisrsmtaonndtihngis,aTbhoeut faAsshiaonn astrytliest?e, you don’t need to be all Branpdliancge?o? f a Music Minister's fashion sbMMaooheofvaocaetdruyubyrelaodlrMetulnahlrytt'eotoioghebpfnarxeioltmapiwesicanmxvtenthtie.rtdhaadaYeivln:o.naegdYugnIoaGsvsbunehiroercoeodesuinct.t’lsyedmalrkesetbiannstehihgtneodocroyufoeolnmdsuc. iaorues uAskeidnms’Meentaossdseeaiigdne-ec.nBotrniafvynedyiainnggptirhsoedaiunctttee,nrmdseerdthvaicte’s, message dispersal. Just so you do not imagAeniotNr opLear:soHno. wIt misuwchharet adlleyfainreesyyoouu and isnhtoowfasswhihoant/owr shaoymwyhoaut laerveeloisr ywohuart dAillustoe, tIfheyoinuteanredegdominegstsoagreelbeeaseurae song, thita’stpwehratitnyeonut 'tlhl haat vaes oynouwpillranyotobrehaaving you steannsde ofof rf.ashion? sporuarcyeedo,f dyisoturacetniosunrteo atonyoenmeb.ark on a promotional/marketing plan, with a Mary Mohammed: My sense of good art cover, of course with a professional music production. The fact Q7. faSshhioounldrighGt onsopwe,lI cMa usicianns't etvaekne BranmdienagsuSreer.ioI husave not really grown in 7 Akin’Made - Ha, Yes of course. As serious as every other thing that matters. Your music is likely not to progress or die

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What is the inspiration behind that proper. name?? Q8. What Approach should be given to Akin’ĖMŌaÒPdÍeŎI-MAÈkin’AMnaytdheingisfocor nMneudsicfrom witi?ll, nsointcbeetchoismteo 'uosnciseaupMoinniasttriyme'. AkinnMriinnmisatedres onatchteuaelflfyectaonfdtheIir fahsahvieon alwaoyns thbeeemnespsagrteicsutlhaery adebloivuetr?making The testimonies, the lives that will be sweeMt maruysMic,oiht asmtirms uepd:aNogwre,aotnseetnhsiantgioIn in mwei.ll lSikoe towhsaeyn tothmeusoicpmpoinritsutneirtsyoutot trAaknisnf’oMramdeed-aBnrdacnhdainnggehdaws githotynooutrhing to panedrfolbtohreIomemkrneabeoiotedsr,edaitsnenhtgdadeatovntaeehdsnentncfeowaogtclillttiheghtacehtvanaievttettoyeoofanumtmhawaemckaaaeenc,myttuoetIoaul pduobliwcaitthionreslwigiilol nforoervewrhgaivteevgelor.ryWtohether thougrihgthtdse. eTprylystaribkionugt athbealmanacjeorasqaunaylity Gmoidnifsotrryyou.or industry, the public aboubtetlohew morussoicatbhoavteIcdano haanvde iltosveef,feitc’ts oTaphpneaprnoicmkretpypuoontiuriottyvna.enGortyfotmhdeinuBvgeclehrtsyofso.iprnadthyivisiadtuteanl tiisonqtuoitoe, nothionngybouutrscwoenegtrneegsast.ion. A music especially to attain a reasonable rate of relevance. minister's outfit matters a lot. Q9. What Should Ministers Consider This month we'll be looking at Branding in AWnithNeonLBar:aYnoduincgan? make a shout outto GgoossppAIetenllhedraMssawstuosewi'cbre.eellnjWbuoestetwjeueusntanotdiunhetgerohsrttcafhoonisnrdstbihdutehteaerthatviteseani.sst. tMaoAananykmdroinyyn’pMMepr.aaaordyheeeanrmt-ss,mTftohheeerdrb:beriaOanlkgraeainnyccg.ee..mr.otSeafhiuonkpunptoirnwoinulcetipdlgees to usAins iatNMoLinai:stSryo,, Thhaivsehyaosubgeoent agniyvtinhginga theevewryay aofrttihsteeLonrede, dandtomyunsdpierirtsutaalnd to lot otfo Msauysaicbiaonust Sotuatr BthuezrzeMhaagrdazitnime.e on psatarenndtsu.nique and the test of time. That’s whataaďpproaach tďo usťeş So, St ar Buzz Awbhiyg swhoeuthaouvet tosommyesiabrlitnisgtse, sanwdhTohehave BbOeMenB.doing music for about 20 years Magazine, this is just the beginning Tahnadnkasrfeorstbilelivnegrmy ymFuicrehlirgehlteevras.nIt.ol ve SyoAoohfvousSeutnaartonrtowhBuaeutarztntpziosdlatPeMaca,lewpay.gaaoYayuFozsaiu.nditeoshh,naoy’tnoudlundeAgebnudeiytNstcooaornLbesaceioaulsl Q6. aWndhathteisskyyoiusrthuendstearrsttianngdpinogintafboor uytou thoef byeosutr. Tghroawnktsh faonr dbebinegcseorptaaitnieynot u are BArkainn’gTidMnuhinavyisgasd.ir?esi?oau- psBlafrotafronmrdmsi.ntIgobepisluietavoeuttethrtimhsetGothobasept’eas l aancdtudaillilgyenetxwpaitnhdyiongurGwoodrk’s. kLionvgedaonmd. usedgretoat tidooelnitnifyGoda's hparonddsucatn, dsienryvoicuer, imagheanodrspaesrsonw.eIltl,is ewvehanttoderefcinoensciyleou light always. and psheowplsewtohaGto/dwthoosmenysoituivaerteheomr wahbaotut you stthainngdsftohra. t they should pay attention TAolseov,eIrfyyMouusaicreMginoiisntgertoourtetlheearsee a song, biot’tshpbeurdtidnienngt atnhadtthaossyeosuetptrinagytohre having to. pparcaeyed, you ensure to embark on a promotional/marketing plan, with a BQr7a.nwAdnSiinldhlgtoIauSpklerdearyyioo,GutushotaostppGeloal dceMws iuallsnihdceiatlphnisysowutoa, rHkkee good art cover, of course with a Akin’Made - Ha, Yes of course. As serious professional music production. The fact as every other thing that matters. Your music is likely not to progress or die 8

D KCJC LIMOBLAZE 9

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on proper. What is the inspiration behind that Q8. What Approach should be given to oitf?,Gsoindcemitxheisdtwoituhs liosvae, Mhoipneistarynd faith name?? itAnhekthineis’mMCphatridinseetisa-snBhrreaapandlswoinangygsshafaessltogpinopstiodnseeodthhitimong to adfoterwiltishterneinliggioton aonrdwwharittienvgerc.irWculhaerther AaAlkkwiinnawAon’MynrrsFiiaOntaemdbscrettaeoLRedib-misneeiAonrbgpk2liaaa5nP’rzctrMhtoteiudc1aa(uu9Sdllclaa9eeym5rr,iuhsaaeaarblcntiliooOsdstnufe.nrtoIeamImmdnodaB)hfekbsraionoonvdnmrgegen smoningiss.try He or chainngdeudstry,his themusicpaul blic sweelotcmalugsiocv,ti.tinstAirbsiaupstaategNreigaetrsiae.nHsaetwioans fpaeshricoenp/tmioenssaogfeeavendryeimndbiavrikdeudaloins aquite in mBeor.n Saond wbrhoeunghtthuep ionpMpaokruturdniitByentuoe mainssiomnptordtaisncot vtehrinagndtoshpoawyCahrtitsetntotiothnetoo, weosprledctiharlolyugthohias tltyariicns.a reasonable rate perfsotarmte.at an event with a team came of relevance. and I needed a collective name, I Q9. What Should Ministers Consider thouHgehtddiseceovpelyredabhoisumt tuhseicaml aajboirlitqieusaalittya When Branding? aboutetntdheer amguesiocf t8hawtheI ndhoe astnadrteldovsein,giitn’gs Akin’Made - The balance of knowledge nothaiinnggtehebhuecthcislawdmreeeen’tsinnechcsous.rnctahccthwoiirt,hArlasop at this and prayers, there are certain principles music every artiste need to understand to stand unique and the test of time. That’s TGhoisspawlmiekneoeldnntEsMtmthaouiwrnnsteieecmtd'.oll,mbW2wiepmreailitoncego,u5knhthi0idnseegcrsoesoawntnattngsnBsedrloytacfrn.tirchdTasahi,pnetgptnheaehirnsyes why we have some artistes who have gospweelerersn’wt ge'oroedneontojuugsthinattofirthsti,sbbuutthethkisepist been doing music for about 20 years to usoniswariMtinign.isYterya,rTs hwisenhtabsybienetnhisgpivriancgticae and are still very much relevant. As an artiste, you don’t need to be all lot oufntiMl huesicbieacnasmoeuta twherlleknhoawrdn ltyimriceistoinn over the place. You should be conscious of your growth and be certain you are whatscahpopolroaandchetaornuesde himself the nickname actually expanding God’s kingdom. of “microphone 1da boy” fashioned to Also, If you are going to release a song, it’s pertinent that as you pray or having Q6. “W1dhaabtoyisofyfoicuiarl”u.ndHeerstnaenvedringknaewbouotf iuABmsrkeaaidnngoCCkm’dMenthhohiotrrnaneoowiigssedrrttsy?iieaaa,?pidlnnncie-kdaererrrnaBsasfot,perDpianf,lfplaya.naeimdInltrtlerianlhui,oLsgeteevhwpect,rcriarh.satwophaUediepattnhuetadiAcdtltnteehmd,haefrebimbnslamcaoeesautusrstemshtaviryacidewcotooeao’tusron,fs, A R T I S T Eprayed, you ensure to embark on a andTsrhipowlesew, KhaB,t/Awndhyommiynoeuo,aTreedaosrhiw, hSahot you Bstaarnadkaf,osrw. oope, Pro, etc. promotional/marketing plan, with a Q7. Should Gospel Musicians take OF THE MONTHgood art cover, of course with a BranHdeinfgouSnedrwiohuast he described as the spirit Akin’Made - Ha, Yes of course. As serious professional music production. The fact as every other thing that matters. Your 10 music is likely not to progress or die

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What is the inspiration behind that name?? proper. AaAswlkkweiiHiHinnnnaeeen’ddMytreesimoaSnppfmdtueebfaesinnaecriddctieda-e,eenedlnnilAtytt/pkshtruiasainiestnr’raccssMttoirmiugutcraeanpuudddesllilainadeycgrahgiilrssaaeracebrcccnatoaaooidrsrrtnuetdentseieienenrIrmgdnsa2aaahafs0skratri1oitnovaai2mgsennnt. in wmiteh. hiSs o1stwsohnegn “mtheemooripeps”o(rdtuendiitcyatetdo Q8. What Approach should be given to pertfoorhmis actlaasnsmeavteesn)t wafittehraleteaavimngcahmigeh andschoI olneaenddeidt waas caolpleecrtfievcetlyneanmjoey,edI Hite?,csainmcee uthpisatsoseuscoisndarMuninneisrtruyp in the thosuognhgt dbyeeepvleyryabliostuetnethr.eHmeajwoernqt uoanlityo aboreuctotrhde msounsgics thliaket I dAomaaznindg loGver,aicte’s, BHAdOeokUisnawQ’yMiUtshaI dUreensl-itgoBpiroapnnadboilrnegwRahhaapstcegovmoetpr.neWotittihohienn.gthetor notMhiengrcyb,ut Uswnceoentdnietisosn.al Love, Wrong “mI jiunsitstwryant toormakeinmduussitcryf,rom tthhee heaprut,blic Ways, Grace Talk (intro), Pain, Misfit, bpeecracuespetfioonr toofmeeviet risythiendgirveidauteaslt fios rqmuite oafneixmppreosrstiaonntatnhdincgomtompunaiycaatitotne”n.tion too, ThisFomrothnethKwineg'llwbheiclhofoekaintugreastaBnraAnmdeinrigcainn especially to attain a reasonable rate GorsappelpeMr Luossico. f Whgea aunnddSerostFaanrdgotnhea.tAlasos wtglooohtsautcpCCpooostrruefoloriallsamrsepeMshbaripnsisosuetrRMlwrsosyhaiaecyitnci'icttaarroihohseennmtdsrstfnyooikaot,oeMuntuTunedusjdhtpuaesifisisrtncrtheeghiietenacrstremstoecayeobwhltmemehaeibiscrsonnedoegfbsurg.supti5iiotmolveH,ntifhnese.aigstHonhoiadieensfs Hoef reislevaalnsoce.known for his various affiliated with 2corf North House. international collaborations; he Q6. What is your understanding about fQea9t.ureWdhoant USkhoraulpdpeMr iAnissttearrs’s Csinognlseider BraHnedihnags?a? unique and versatile style and rWemhixenDBFMraBn,ding? Akins’kMnaodwen f-orBranding is a term that’s aAlskoinr’eMceandtely-feTahteurbeadloannctheeowfekanroewolneedge useedxptliocitlyidfeunsitnifgyhisaChprirsotidauncfta, ithseinrtvoicheis, sigAHhwbasenoeotfevennahraseidgehyptncrhrastnadeypfeswlearudhslpaetnonaigorpydioroiqfe-hlntjaysheiuargnpsrrosceotive,pectmwemlstahanwnuenasnmiahdssoeramiinueccmegrtdsehehdieaescfeadorhimdenraatttsyoeoecArdcaestsefmitstbnsrruoatiteoatohncegafekadusseiet.tnwteoibwamrri2pdstimghhet0rmraoigi.nvatneTcyhehrdhsihieenkpstaaalvettr’oesss imamguesico.rHpeehrasosne. aItrnies dwshtaritpedseafisneosneyoouf maonvdieairnedusstitlrlyv. eInrytemrmuschofrethleevmanuts.ic, he andtheshfoawstseswt hriasitn/gwghoosmpeylohuipa-hroepoarrwtishtaint hAass aandaerbtuisttea,lbyuomu, d2oEnP’ts,n1eeLdP atondbea all youNsigtaenrida,foar.nd has received notable coovueprlethoef pinlatecren.aYtioounaslhofeualdtubrees ctonhscisious award nominations doifscoygourarpghryowanthd amnadnybemucseicratal ianwyaorudsare QBr7anl.inokdemSiniCnhgaorytuSisloetdanrslioiaGnuws2oa0srp1de5sl.whMicuhsihceiagnost ttraipklee baoctthualolclyalelyxpanadndinintegrnGatoiodn’salklyin. gHdisofmir.st Akin’Made - Ha, Yes of course. As serious feature as an actor is in a yet to be as every other thing that matters. Your music is likely not to progress or die rAellesoa,seIfdyouMaorveiegoin“gPatyodraeyle” asewahicshong, fiet’astpureerstitnheenltiktehsaotfaZsaycoOu rpjir, aByaaojr(Hhuashving hspptoarrsoart)my,oeBfoidtsoio,othlnaeyaroBlus/BtNmaer,asnc.roskumereteidngitaon Eebmiybeaarkndoan plan, with a a good art cover, of course with a professional music production. The fact 11

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What is the inspiration behind that proper. TOP 5 GOSPEQ8L. WhSat AOppNroaGch Sshould be given to name?? it?, since this to us is a Ministry Akin’Made - Akin’Made is conned from OF THE MONTHAkinnrinmade actually and I have always been particular about making Akin’Made - Branding has got nothing to sweet music, it stirs up a great sensation do with religion or whatever. Whether ministry or industry, the public 5 4in me. So when the opportunity to perform at an event with a team came perception of every individual is quite and I needed a collective name, I an important thing to pay attention too, thought deeply about the major quality especially to attain a reasonable rate about the music that I do and love, it’s of relevance. nothing but sweetness. 3This month we'll be looking at Branding in Q9. What Should Ministers Consider When Branding? Gospel Music. We understand that as gospelers we're not just into this but this is 2 Akin’Made - The balance of knowledge and prayers, there are certain principles to us is a Ministry, This has been giving a every artiste need to understand to lot of Musicians out there hard time on stand unique and the test of time. That’s what approach to usEeBEN why we have some artistes who have been doing music for about 20 years Q6. What isByAouBrAundNeIrstBaAndBinAg about and are still very much relevant. Branding?? As an artiste, you don’t need to be all Akin’Made - Branding is a term that’s over the place. You should be conscious 1used to identify a product, service, of your growth and be certain you are image or person. It is what defines you actually expanding God’s kingdom. and shows what/whom you are or what you stand for. Also, If you are going to release a song, it’s pertinent that as you pray or having Q7. Should Gospel Musicians take prayed, you ensure to embark on a Branding Serious promotional/marketing plan, with a tYheinsgofthcaoturmsFea.RtAteAsrssNe. rYKioouuEsr DWAgpRrooDofdessiaorntal cover, of course with a MEAkin’Made - Ha, music production. The fact 12 as every other music is likely not to progress or die

Tabitha talks RELATIONSHIP : Compromise in Relationship 13

Q5. \"Akin'made & Sweet Sound\"..... without proper branding, emphasis on What Firisstly,thewhaitn'ssptihreatigoennerbalehdinedfinititohnatof bupildrompoerer.understanding in relationship. nAakmine’M?(Cd?aaiofddmfmeepriterto-ninmcgeAi)s.ekb,inyC’oMemvaperdroyemoniseies is a way of settling yClooowiQutmer?8pr,pirn.saogiWmrntynicseoeherua.irtnsTthehRiAlaseftpl'taasoptnwidoruhnosysdaheiyiscpsoihrauaesssmMhtujoousiostnudtnliwdstootittrhbybpyeeleoautgoseoiven to mcaokninngedcofnrcoesmsion AkinnrAinlsmo,aidt eis wahcetnuatwlloy sidaensdgivIe uhpavsoeme Rigid in Relationship. Been Flexible does not alwaydsembaenedns topamreteict usloamrewahberoeuitn tmheakmiindgdle. meAaknitnh’aMt ayoduea-reBwraeankd. ing has got nothing to sweet cCmrooumssspitrcoo,mmiitaseksetiinrasRrueellpaattiiaoonngsshhriippeasautrcecseebssnrfisudalg. teios nwe CmoodmreopirmowmpiotishretairnsetaltihgsaiginonyntohuaortrEygo-wouArhnaroetnleatvioenrs.hiWp ishether in meC. omSporomwiseheanllowths eyouoapnpdoyrotuurnpitayrtnetor to Wmhainteivsetrry yoou r coimnpdruosmtirsye, intheyourpublic perforbme aabtleatno Beavleanncte weaitchh aothteeranemedcsa. Imt aelso replaetiorcnsehpiptiyoonu oshfoueldvealrwyayins dbievihdaupapyl oisf quite and Ihelnpes ehadveedmuatual cuonldleercsttiavnedingnaamnde,knoIw theanouimtcopmoerst.aWnthtehninygoutoCpomapyroamtisteenttoioo n too, thoughphtorowdbeleteompsflfayigcuianrgebtohoueuttretlhsaoetliuotmniosahnisjpo. rtCooqmuispsaurloeimstyisoer ymoueucshopraeintcddiaoyleolsyunr'tptfoarertaankettrtahdeinomestahneonrteyaaopuspohrnaeavceibattloee rate aboutmtohsetlymausstioc dthoawtitIh dsaocriafincidng,lodveeni,alit’asnd stoopf Creomlepvraomnicsein.g especially if she or he nothingaccbeupttasnwcee. eBtunt,eist sd.oes not mean you should takes it forgranted or does not Compromise lose your RESPECT, VALUE, DIGNITY and tooQ. 9W. hWen hayotu SghioveuldtooMimnuisctherisntoCoansider This moICDnoEmtNhpTrwIToYme'iflsolerbtienhelRoseaolakketiionongfshthaipet RBiserlaaabtnioodnuitsnhgaip.ilinttle RyoeWulatsihoomensenhtiipBmrewasitnfhedoeuiltngegme?tptitnyg anything in return, Gospegl ivMe, ausliitctl.e tWakee- MuanxdeBrasutcaansd that as and alone. That's whAykIinsa’Midaedaerlie-rTthhaet bnoamlaanttceer wohfatkndoonw'tledge gospelCeorms pwroem'rieseniont Rjuelsattiionntsohipthicsanbubtethsaisidisas givaendin pyorauryReErSsP, EtChTe,rVeAaLUreE, cDeIGrtNaIiTnY parnidnciples uos fisgmmMiouavtsiunutMagslipciuonuipaininsdnttssersorymsi,onteaTutnhrhtdeiinilstngahgtheioianrwnessiothhbrihpdeayeeorrynduortuogtpiimvraaeirnnaetdngcehory.anooAuurtt eIwDmhseEeptNvantTeynI.Try.dYyoY.uouBuneatahcirqairnteuiukssSeteteyrooaifunnngyde.aoreutehdsethilelttaoehrsatbtvureoonfkdaetelnlimrtsahetnias.d, nTdhatt’os to lot why we have some artistes who have what appaprtrnoear wchill htoavuesdeifferent approach, opinions or wish at this point to make peace rain one Yobu esehonuldd oainlsgo lmeaursnictofourndaerbstoaundt 2yo0ur years fLpeaaAaenrlgtnsnluodeaavrge'ansedrli,o.aeeyv.roesttuhtilsieanltlenebgev,eudesaytrtgoowyeuau.ymnFddtouheorecrynshyt’oactrounermdnlpemethaeuvernadtiirncneaLttroto.evteobe all BQr6a.ndWweoinxfahganaym?tot?gpuoilesoh, ayuAtsoswuatiorthgusyuunoyrudryereonpudraseprtrtaincekntordabitunhdtegastheoeatthsbhaeaoyr.tsuystFhooeur in olovveer. Fthore ypoular cpea.rtYneorutoshfoeueldlobveed cyoonu scious Akin’Mwaadnet to- gBoratondcininegmasismaeantwehrimle ytohuawt’esre used htoopinigdyeonutisfhoyuldatakpe rhoedr utocts,tadsieumrvtioceg,o neoedf tyoouunrdegrsrtoawndththeairnLdovbe eLancgeuratagein. you are imageadniofdfrerpweenattrcisnhotenbr.aelsIltt. aiBsnodwthyhoaouftcadyno'etufgionbeototshbyohotahuvaet WtheahirecnltouyvaeoluLlyaansegkxusaopgmaeensodofiintt'hsgelemGf,t tfohoedry’ysdoukonitno'tgsktdnuodowym. and shthoewssamwehatimt/ewehitohmer yboecuauasereoforMwonheaytor you staTinmde. fYooru. don't have any interest in movies, and know it. So that it will help you know how she also doesn't have interest in watching toAlcsoom, mIfunyicoauet amreorge oianngd tohareveleamsoerea song, unidt’esrsptaenrdtiinngeonftytohuar ptaartsneyroaundpkrnaoyw wohraht aving Q7. SSfooho,otobunaledll mofaGtycohou.spwielll haMveutsoicsiaacfnricise sotathkaet cyoopmu rpwariolylmceoisdme,pryoifmoiusiet ienmnyesouaurnfesor hltoiomweoerrinmhgebr. aDyrooknu'rt on a Brandyinogu cSaen rgiooutos the other or better still you both stapnrdoamrdoftoior lneassl/thmanayrokuedtiensgervep...lan, with a Akin’Mdaedciede-dHnao,t Yteos ogof ctoourasney.wAhesreserainodusgo good art cover, of course with a as evesormyeowthheerer tehlsine.g Ttohadt omathtitserits. rYeoquuirres Leparrnotfheeswsiiosdnoaml omf ucosmicprpormoisdeufcotrioit'ns .beTthteer fact music uinsdelirkstealnydinngotthatt'os wphyrocogmrpersosmioser hedlpies to bend a little htan break- Jane Walls 14

Fashion Trends with AnitNOLA Hello People!!! I am back again. We'll be going simple this month as I have for y'all pictures of few Nigerian Gospel artists. AnitNoLa will be back next month with something better. Till then, I say, be happy always. s bm 15

TIM GODFREY JADHIEL 16

EBEN MERCY CHINWO 17

AENIOB NKE WITH HAVILAH F cwos ccl q, you get to see, the more you're Happy new month of July, 2020. awed. This month, I feel led to just say a few things as we step into the next These last few months might have half of this epic year 2020. We been a hard time for you, you talked about Mindset January this might have had to struggle with year and I feel to say something certain decisions, you might have about it again and again. Because seen your true identity and level there's a limit to you if your of your trust in God stare at you. mindset is truly limited. There's a Even regarding your Spirituality, way that scarcity can condition you might have discovered that your mind not to see opportunities, you really don't know so much like ideas, and platforms that you think you know, but I'm asking embodies abundance and you this morning to strengthen your overflow and I'm not merely stakes, get set to get into the talking about Money, I'm also abundance mentality where God talking about how that not seeing will distill wisdoms about your life too many things happening can and purpose. Ask God to show you cripple your mind from expecting and open the eye of your spirit to so much from Life and God. But I connect the dots in your life am telling you today that if you do together so that your life will live not have an expanded mind or in his calculated sequence. thought, you would not Experience a new reality. No matter the level of smallness or I feel led to tell you here that God greatness you've interacted with has so much in stock for you, it is these past months, there just inexhaustible(as the sands on the always something more. I'm telling sea shores so are his good you, I sense so much that God is thoughts towards you),the deeper asking us in this next half of the year to enlarge our tents and it is more of our heart coast, because 18

a prophecy/vision that hasn't begin to ask so much and begin to entered your heart, you can't step prepare to step into so much as he into. opens your eyes and hold your He is asking you like he did hands. To patriarch Abraham, What do Happy new month of July 2020.I you see? am extremely excited about JULY. The Lord says to us in ENIOBANKE Step into Abundance like the TRIBE in our Spirituality as an Queen that you are, there's no ageless entity that we are where scarcity in our kingdom! other flows streams out from The father would not have me say (business, career, academics, more than these this month. See influence etc) to embrace these you in August and I believe so words in Isaiah 54:2-3 strongly that August is one of the \"Clear lots of ground for your best months of the year tents! Make your tents large. because..... (I'll give you the full Spread out! Think big! Use plenty gist next month) of rope, drive the tent pegs deep. Jesus Loves you and he'll go to any You're going to need lots of length to show you this. elbow room for your growing Yours in his grip, family. You're going to take over whole nations; you're going to Havilah. resettle abandoned cities. (Isaiah 54:2-3|MSG) 19 Take out time to pray around these and set yourself up for the possible with Christ, don't 'slim fit' your desires this next 6 months because he will do beyond what you ask, imagine or desire, so

09020285182 WATCH OUT HARVEST OF P R A I S E 20


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook