Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore PicoWay-eBook_EN

PicoWay-eBook_EN

Published by pavel, 2020-01-13 03:33:46

Description: PicoWay-eBook_EN

Search

Read the Text Version

PicoWay® The complete picosecond platform. Science | Results | Trust



Dear reader, On behalf of Candela, we would like to say thank you for your interest in the PicoWay® system, our picosecond laser intentionally designed to work from the inside out to treat wrinkles, acne scars, benign pigmented lesions and tattoos12345. In this eBook, we provide you with the most important information regarding this device, from technology overview to the results clinical experts worldwide have achieved with their patients. Know that when you decide to work with one or more of our devices, we’ll do everything we can to provide you with the highest level of customer service possible. That’s our promise to you. The Candela Marketing Team 1. PicoWay 510(k) clearance for wrinkles (K170597), May 2017. 2. PicoWay 510(k) clearance for acne scars (K162454), February 2017. 3. PicoWay 510(k) clearance for benign pigmented lesions (K150326), April 2015. 4. PicoWay 510(k) clearance for tattoos (K142372), October 2014. 5. PicoWay 510(k) clearance for tattoos with 785 nm handpiece (K160607), July 2016. 3

Science. Results. Trust. Science. What can you treat? The PicoWay® system delivers high peak power and the shortest pulse durations6 for a non-thermal, photoacoustic effect that transforms skin from the inside out.1-5 With this remarkably innovative picosecond laser, you can significantly improve acne scars and wrinkles with a series of quick, 15- to 20-minute treatments, with minimal downtime, address a range of benign pigmented lesions with flexibility in depth and spot size and treat a wide range of tattoos, including difficult-to-treat blue and green tattoos. Studies have shown that PicoWay lasers can deliver: Reduced acne scarring after just three treatments7 High rates of improvement in wrinkle severity1,8 A high rate of benign pigmented lesion clearance9 Removal of multi-coloured tattoos5 Pigmented Tattoos Lesion 1. PicoWay 510(k) clearance for wrinkles (K170597), May 2017. 2. PicoWay 510(k) clearance for acne scars (K162454), February 2017. 3. PicoWay 510(k) clearance for benign pigmented lesions (K150326), April 2015. 4. PicoWay 510(k) clearance for tattoos (K142372), October 2014. 5. PicoWay 510(k) clearance for tattoos with 785 nm handpiece (K160607), July 2016. 6. Based on available 510(k) summaries as of October 2017. 7. PicoWay 510(k) clearance for acne scars (K162454), February 2017. Data on file. 8. G old MH, Biron JA. Presented at: 37th Annual Conference of the American Society for Laser Medicine and Surgery ; April 5-9, 2017; San Diego, CA. 9. PicoWay 510(k) clearance for benign pigmented lesions (K150326), April 2015. Data on file. 4

The Science of PicoWay Technology - ExperienceScience. Results. Trust. Picosecond Laser LeaSdceiernschei.p UUMllttrreaa--cSShhhooarrttnPPisuullmsseess o&&fHHaiiggchh tPPioeeaankk:PPoowweerr ffoorr OOppttiimmaall RReessuullttss The Picoway SystemPPiiccooWWaayy’’ss uunniiqquuee,, pprroopprriieettaarryy mmooddee ooff aaccttiioonn hhaass hhiigghh ppeeaakk ppoowweerr aanndd sshhoorrtt ppuullssee dduurraattiioonnss ffoorr ddeemmoonnssttrraatteedd ppeerrffoorrmmaannccee aanndd ccoommffoorrtt.. PPiiccooWWaayy''ss uullttrraa--sshhoorrtt ppuullsseess eennaabbllee tthhee ssttrroonngg pphhoottooaaccoouussttiicc iimmppaacctt nneeeeddeedd ttoo ffrrTaacchttuuerreeSppiicggmmieeennnttcppaaerrttiiocclleefssPuussiciinnggollWoowwaeerryfflluuTeeennccceessh,, nffooorr cclolleeaagrraaynncc-ee Eiinn xffeepwweeerrrttirreeeaanttmmceeennttssP.. icosecond Laser Leadership Ultra-Short Pulses & High Peak Power for Optimal Results The PicoWay device’s ultra-short pulses enable the strong photoacoustic impact needed to fracture pigment particles using lower fluences, for clearance in fewer treatments. swssPLPwsLsLPtfmmoorhaahhiioaahllssellaarrsoogoeessaarllemasllttthhrrppeeooormpaaeessiieddaaaettittnndanttllcccnyyppeeeelltolyeoosrrrriiett..gggguhhruustmmgwyyaahstssytttaieeiipittlsscltttiinnihhiccssgddetteehmeedvffrraeelleeaaiievvtvvngglteenieeevmmrrnntreee.eerddttehhnndeettss PLlmwaahriolgsloreesetohrr staephltonietgPdtdfLLfPtewerrhhrmaaaaeemrhhraa.lssgggllyiieoottvveeammyneoeosttrrloorritoeennseeeettnnllfnnyyddrhhtdttaheesseellemmaagarrrrggwwlrrmtimmooggvyyoiierrlleeelleeiiaanssrrrnsselllsspphhytdsllaaiiooggttwwmmtteellyyeerr..nnssttoo GrGeraetaetreIrnItnetnesnitsiyty==GrGeraetaetrerEffEiffciaccaycy PPhhoottooaaccoouussttiicc AAccoouussttiicc ttoo TThheerrmmaall PPrreessssuurree IInnddeexx.. PPhhoottootthheerrmmaall AcouAAsnnticAATTtoPPIITiinnhddereemxx agglrrPeeaaretteesrrsutthhreaannIn11deiinnxddiiccaatteess aa pphhoottooaaccoouussttiicc An AffTrraaPccIttuuinrrdiinneggxmmgeerecchhaaatennriisstmmhawwnhh1iilleeinaadnniciinnaddteesxx llaeesspsshttohhaatonna11coiinnuddsiicctiaactteess aa LLoonnggeerr TTiimmee == MMoorree PPaaiinn fractppuhhrioonttgoottmhheeerrcmmhaallnffrrisaamccttuuwrriihnnigglemmaeenccihhnaadnneiissxmmle..sPPsiicctoohWWanaayy1,, wwiitthh ppuullsseess indicffarrootemms 33a00p00h--44o55to00tpphsse,,rmhhaaassl faarnnacAAtTTurPPinII giinnddmeeexxcgghrraeenaaittseemrr tt.hhTaahnne11.. PicoWay system, with pulses from 300-450ps, has an ATPIPPinhhdootteooxaagccooreuuassttteiiccr tFFhrraancctt1uurriifnnoggr piissaAArtddicvvleaannsttiaazggeeesooeuuxssceeding 35011n..mLL.eessss hheeaatt iiss ggeenneerraatteedd rreessuullttiinngg iinn ffeewweerr ssiiddee eeffffeeccttss aanndd mmiinniimmaall ddiissccoommffoorrtt.. Phot22o..aIIcmmoppurrsootvviceeddFraabbctiilluiittryyinttgoo ittsrreeAaadttvssammntaaallllgeeerr oppuaasrrttiicclleess rreessuullttiinngg iinn 1. L emmsoosrreeheccaootmmisppglleeetteeneccrlleeaaaterraadnnrcceees..ulting in fewer side effects and minimal discomfort. 2. Improved ability to treat smaller particles resulting in mHHoiiggrehhcPPoeemaakkplPPeootewwceelrreMMareeaaannncsse.GGrreeaatteerr EEffffiiccaaccyy TThhee hhiigghh ppeeaakk ppoowweerr ooff tthhee 445500ppss ppuullssee ooff PPiiccooWWaayy HighddeePlleiivvaeekrrssP44o..w55 ettiirmmMeesseammnoosrreeGpprehhaoottteooraaEccfoofiuucssattciiccy eeffffeecctt tthhaann tthhee The77h55ig00hppsspppeuuallksseepoooffwooetthhreeorrfpptiihccooess4ee5ccoo0nnpdds ddpeeuvvlsiicceeesso..fTTthheee775500ppss ppuullssee PicoddWeellaiivvyeerrsssyaastmmemoorreedepplhhivooettroostthh4ee.rr5mmtaaimll eeeffffseeccmtt,,ossriiennccpeehiiott tddoooaeecssonnuoostttihhcaavvee effechhtiiggthhappneeaathkkeppoo7ww50eerrpaasnnpddummlsuuessott ddf eeolltiivvheeerrrttphhieecoeennseerrcggoyynoodvveerr aa lloonnggeerr devippceeerrsiioo. ddThooeff tt7iimm5ee0..pTTshhpiissuleesxxecceedssesslivppehhrsoottaoottmhheeorrrmmeaapll heeoffffteeocctttheccraamnnalleel aadd effecttoot,ppsoointteecnnettiiaat lldssoiiddeees eenffoffeetcchttssa..v** e high peak power and must deliver the energy over a longer period of time. This excess photothermal effect can lead to potential side effects.* * UUnnppuubblliisshheedd ddaattaa oonn ffiillee *Unpublished data on file 5 *

Science. Results. Trust. Science. Mechanism of action: 3WrWdhyhwwyaa7ves8l5e7nn8mg5tnham?s 3chrdosweanvefolernPgitcho?Way's The 755 nm wavelength has been the standard to Figure 1: Absorption of commercial green and blue address blue and green pigments, as well as melanin. tattoo pigments and melanin. The relative positions of the three PicoWay laser wavelengths are also While Candela is a recognized expert and top global shown. The 7p5ro5vnidmerwoafv7e5le5nngmth lhaasserbdeeevnicthees,swtaenddaerldibetoraatedldyrecshsosbelue and gthreee7n8p5ignmmewntasv, ealsenwgetlhl ainssmteealadnains. oWuhril3erdSywnearvoenleCnganthdeolna is a rtehceoPginciozeWdaeyxspyesrtteamndbetocpaugsloeb: al provider of 755nm laser devic1e.s7, w85endmelihbaersagteolyocdhaobsseothrpeti7o8n5bnymgwreaevnele&nbgtluheininstkesa.d as our 32rd. 7w8a5vnemlenpgethneotnraPteicsoWdeaeypbeerccaoumsep:ared to 755nm o77in88f3te55.thrnnetm7foeemml8iremets5lhhpanpinneaencemasneocrteesgitfeortgrooruonnaimoommatdonebefsbwlsaoegl,bdofshrsweeotehuoederitelreptn.hpreaostiatir-uponscctnedhoaicnbomnbttyrretluptugrrpmafeererueaerilwentesdnknehmtscse&oe.er(leb73af5l0rnuito5oe0mcnspiamnosnbkm),sltoto.erfoeostadrh, t.beweriettthgeoirount 1. 2. 3. 785nm enables ultra-short pulses (300ps), for better elimination of green and blue inks. Figure 1 Compare how PicoWay’s 785nm Absorption of commercial green and blue tattoo pigments Compare how PicoWay’s 785nm picpoicsoesceoconndd llaasseerreelilmiminiantaetsetshe and melanin. The relative positions of the three PicoWay the green compared to a 755nm Q-Qgsr-ewsewintictcchohemeddpallaarseseder.tro. a 755nm laser wavelengths are also shown. Why choose the PicoWay device 755nm, 785nm, 50ns, 300ps, over a Q-Switched Laser?Control 01 200 pulses 200 pulses Before treatment Scientists acknowledge that the shorter the pulse duration, the higher the efficiency for converting laser energy into the mechanical Whsfrytaregscmsehnnoetseo.dTeshdeetosmPfraailccleturortehWepafarratigycmleoesnvint,teothrsemaeaalslQier-itSwitched Laser? Scienistisfotsr athceknboowdleydtgoeethffaetctthiveeslyhorertmerotvhee pit.ulse duration, the higher the efficiency for conve0rt2ing laser energy into the mechanical stress needed to fracture particles into small fragments. The smallerAfttheer tfrreaagtmmeenntt, the easieQr -itSiswfitocrhtehde bteocdhyntooloegffyecretivqeulyireresmnouvmeeitr.ous with nanosecond tQPrreei-qcSaoutwWidtlminerreieicstseascaiconyohtfomtmenetemawsdpecn.eflnthdeoertn,trcettsoirhnledelyonasmugortsremylaioinmoneghgnyonaysttvscrr,eeesaucesqaslatseturtmussaairi,se-toetseisnonnhssoctnoosuaswrmt*mingi*tpdphneau,lirefnlloieiscntduseeassmlpyndtdtiaurrgeeinrsmamacytteoiomocnmvnaeteesfsnos,edtrt1stsa.0,ett0sosotiiomsn**esas,ncsdahpuosirgetmesrestnhigtaenndifiQclea-snsiotwnditsics.hceodmQ0-pfso3uwrltistcdehuse.rdinPlgaicsoeWrs ay PicoWay technology has ultra-short pulse Before treatment After treatment with PicoWay’s durations, 100 times shorter than Q-switched picosecond technology, pigments pulses. The PicoWay treatment requires fewer are shattered into tiny particles sessions with less discomfort. making them easier to be eliminated by the body’s natural processes. 6 1

Science. Results. Trust. Science. Mechanism of action: The Picoway Resolve Holographic Fractional Handpiece • Provides dual wavelength (1064nm & 532nm) to target deep and shallow lesions. • 1st and only aesthetic laser with revolutionary holographic fractional technology. • Customizes treatment of pigmentation and skin and textural irregularities with adjustable fluences. • Easy add-on to the PicoWay device. Resolve Treats Skin Irregularities via LIOBs & LICs Resolve uses picosecond pulses to create both Laser Induced Cavitations (LICs) in the dermis and Laser Induced Optical Breakdown (LIOBs) above the dermal-epidermal junction, while leaving the stratum corneum or barrier function intact. These LIC creations, in a 2D pattern, stimulate a healing response and skin remodeling. The LIOB creations, in a 2D pattern, produce more of an effect on pigmentation. “Picosecond lasers are already being used for skin rejuvenation and improvement of acne scarring, using fractionated and non-fractionated beam profiles with beams”.1-3 LIOBs. Histology LICs. Histology of skin of skin biopsied biopsied one-day post treatment one-day post with Resolve 1064nm and treatment with 532nm showing lesions in the Resolve 532nm, upper dermis. The left image 1.3 mJ/μbeam was treated with 1064nm, 2 mJ/ showing 3 LIOB μbeam. The right image 1064nm, lesions in the 2 mJ/μbeam and 532nm, epidermis. 0.3 mJ/μbeam. (Courtesy A. Ribe, M.D.) (Courtesy A. Kauvar, M.D.) Resolve uses a Competitor’s Micro-lens Array Resolve Holographic picosecond holographic Fractional Technology 4 Fractional Technology fractional beam to deliver predictable energy and ensure uniform treatment with minimal downtime. Gausian Profile Top Hat Profile The peaks do not have the same energy. All peaks have the same energy. Peak Fluence Range: 2.6 to 11.3 J/cm2. Peak Fluence: 16.8 J/cm2 for all peaks. 30% of energy is lost as background energy. No energy is lost as background energy. Total energy = 0.2 J / treatment area Total energy = 0.4 J / treatment area 1 B ernstein EF, Schomacker KT, Basilavecchio LD, et al. A novel dual-wavelength, Nd:YAG, picosecond-domain laser safely and effectively removes multicolor tattoos. Lasers Surg Med. 2015 Jul 14. 2 W eiss M, Weiss M, Lorden F, et al. Picosecond laser for reduction of wrinkles: long term results [abstract]. Lasers Surg Med. 2015 Mar;47(S24). 3 Kauvar A, et al. Histologic evaluation of in vivo human skin following treatment with high-intensity 1064 and 532nm picosecond pulses [abstract]. Lasers Surg Med. 2016 April;48(S27). 4 Based on the competitors’ published data 7

Science. Results. Trust. Science. Practitioner advantages Remove Boldly. Treat Lightly. Profit Soundly. The PicoWay system is a sound investment for your aesthetic practice. It may help you: 01 Build patient volume. With four FDA and CE-cleared indications, the PicoWay system helps you attract a wide range of patients. 02 Differentiate your practice. With consumers seeking effective aesthetic treatments with minimal downtime1, PicoWay lasers can help set your practice apart. 03 Gain versatility. The PicoWay system features three wavelengths (1064nm, 785nm, and 532nm) and multiple handpieces to maximise your treatment options - and your ROI. 04 Minimise risk in skin of colour patients. The PicoWay system’s ultra-short picosecond pulses are 10 to 100 times shorter than Q-switch lasers, in the trillionths of a second. Picosecond pulses minimise risk of side effects such as hypopigmentation and scarring that can often occur with slower, nanosecond pulse lasers2,3. 1. American Academy of Aesthetic Medicine website. Available at: https://www.aaamed.org/aesthetic_med.php. 2. Adatto MA, et al. Curr Probl Dermatol. 2017;52:113-123. 3. Wang CC, et al. J Am Acad Dermatol. 2006;54(5):804-810. 8

Science. Results. Trust. Science. Patient advantages Give your patients what they want: 01 Comfort. The PicoWay Resolve system uses a gentle approach to building new collagen and elastin in the treatment of acne scars and wrinkles1,2. 02 Minimal downtime. In brief, 15- to 20-minute treatment sessions, the PicoWay Resolve system transforms skin while leaving the epidermis intact. So patients can get back to their lives quickly, without significant side effects. 03 Treatment made easy. PicoWay offers better results in few treatments for various skin types. Picosecond pulses minimise risk of side effects such as hypopigmentation and scarring that can often occur with slower, nanosecond pulse lasers3,4. Reduced need for post-treatment care. 04 Exclusive PicoWay Resolve uses sub-surface remodelling without breaking the stratum corneum, transforming your patient’s skin from the inside out and potentially minimising follow- up care needs. 1. PicoWay 510(k) clearance for wrinkles (K170597), May 2017. 2. PicoWay 510(k) clearance for acne scars (K162454), February 2017. 3. Adatto MA, et al. Curr Probl Dermatol. 2017;52:113-123. 4. Wang CC, et al. J Am Acad Dermatol. 2006;54(5):804-810. 9

Science. Results. Trust. Results. Reduced acne scarring Baseline Post 3 treatments Photos courtesy of Arielle Kauvar, M.D. Baseline Post 5 treatments Photos courtesy of Sai Y. Photos unretouched. Individual results may vary. 10

Science. Results. Trust. Results. Improvement in wrinkle severity Baseline Post 12 weeks Photos courtesy of Eric Bernstein, M.D. Baseline Post 6 weeks, 2 treatments Resolve 532nm and 1064nm - Skin Type II 11 Photos courtesy of David Friedman, M.D. Photos unretouched. Individual results may vary.

Science. Results. Trust. Results. Benign pigmented lesion clearance Skin Types I-IV, 532nm & 1064nm Baseline Post 2 weeks, 4 treatments Treatment parameters: 1: Pigment (4 sessions) 1064 3mm-1.3J 3sec stacking on lentigines 1064 8mm-0.35J 1pass over full face 2: periorbital rejuvenation (4 sessions) 1064 Resolve 1.4J 1pass + 532 0.5J 1pass. Photo courtesy of Lee Kyung Real M.D. Baseline Post 6 months, 3 treatments Treatment parameters: 532nm, 0.24J/cm2 , 1 pass 532nm Zoom , 3mm, 0.4J/cm2, 1 pass 1064nm Zoom , 4mm, 2.0J/ cm2 , 1pass Photo courtesy of Cheng Kuo-Liang, M.D. Photos unretouched. Individual results may vary. 12

Science. Results. Trust. Results. Removal of multi-coloured tattoos Combined 1064nm and 532nm (spot sizes 2-5mm) Baseline Post 3 treatments Treatment parameters: Tx 1: 1064nm, 2.86J/cm2, 4mm, 3 Hz. Tx 1: 532nm, 1.63J/cm2, 3mm, 3 Hz. Tx 2: 1064nm, 3.02J/cm2, 4mm, 3 Hz. Tx 2: 532nm, 0.86Jcm2, 4mm, 3 Hz. Tx 3: 1064nm, 2.73J/cm2, 4mm, 3 Hz. Tx 3: 532nm, 0.95J/cm2, 4mm, 3 Hz FDA Study Photos courtesy of Tina S. Alster, M.D. Baseline Post 2 treatments Treatment parameters: Tx 1 (Red, purple): 532nm, 4mm, 1.75J/cm2, 2 Hz Tx 1 (Black): 1064nm, 4mm, 2.96J/cm2, 2 Hz. Tx 2 (Black): 1064nm, 3mm, 3.12J/cm2, 2 Hz v FDA Study Photos courtesy of David Friedman, M.D. Photos unretouched. Individual results may vary. 13

Science. Results. Trust. Trust. Don’t take our word. Take it from our customers. “Tattoo removal with the PicoWay system has been received with overwhelming success. This laser has major advantages over other older lasers. With the PicoWay laser, the average number of treatments is less than half, which means that a tattoo is removed twice as quickly, with outstanding health and safety records.” LaserA, Amsterdam, the Netherlands “PicoWay Resolve is a treatment you can count on, because it’s been scientifically proven to reduce acne scars. During clinical studies, patients reported high levels of satisfaction with the results achieved: after only 3-6 sessions, 94% of treated areas showed significant improvement. No anaesthetic was used during trials. While there may be some redness and tingling immediately after the laser session, most users reported little to no discomfort.” Advanced Laser Clinic, Ottawa, Canada 14

Science. Results. Trust. Trust. “In our experience, the short pulse duration on the PicoWay laser allows us to clear tattoos faster than traditional Q-switched lasers. The Nd:YAG 532/1064nm wavelengths also treats a greater variety of tattoo colours and skin types with minimal downtime. The laser is successful, and patients are very pleased with the results.” Terrence Keaney, MD, Associate, Washington Institute of Dermatologic Laser Surgery, USA “The PicoWay Nd:YAG laser allows us to treat a broader range of skin types and a wide array of tattoo ink colours. With the ultra-short picosecond pulse duration, there is less discomfort during treatment and faster healing. Professional and multicoloured tattoos are cleared in far fewer treatment sessions than with conventional Q-switched lasers.” Arielle N.B. Kauvar, MD, Director, New York Laser & Skin Care, USA “This is the first, ever, 785 nm wavelength picosecond-domain laser in the world. This novel addition to the PicoWay enables optimal treatment for blue and green tattoos, and is a welcome addition to the 532 and 1,064 nm wavelengths already available with the PicoWay.” Eric Bernstein, MD, Main Line Center for Laser Surgery, Ardmore, PA, USA 15

Science. Results. Trust. Science. Results. Trust. Summary of peer-reviewed articles A 1064-nm Neodymium-doped Yttrium Aluminum Garnet Picosecond Laser for the Treatment of Hyperpigmented Scars. Koren A., Niv R., Cohen S., Artzi O., Dermatol Surg. 2019 May; 45(5):725-729. Method: “Sixteen patients with hyperpigmented scars underwent 3 to 8 treatment sessions at 3- to 6-week intervals with the 1,064-nm Nd:YAG picosecond laser (PicoWay, Candela, Resolve handpiece). A Mexameter quantitatively evaluated the melanin content of the scar before and after laser treatments”. Results: “The patients assessed their level of tolerance as good or excellent and their satisfaction level as moderate or high. The Mexameter showed that the melanin index decreased considerably (by 39.11 ± 11.58%) in all patients after treatment.” A Novel Dual-Wavelength, Nd:YAG, Picosecond-Domain Laser Safely and Effectively Removes Multicolor Tattoos. Eric F. Bernstein, MD, MSc (Eng), Kevin T. Schomacker, PhD, Lisa D. Basilavecchio, RN, 1 Jessica M. Plugis, 1 and Jayant D. Bhawalkar, PhD, Lasers in Surgery and Medicine 47(7) · July 2015.  • 92% clearance of black ink • 80% average improvement in the red portions of the tattoos • 85% clearance of yellow ink “Black and red pigment were removed very effectively, with an average 92% clearance of black ink after an average of 6.5 treatments in all 31 treated tattoos. An average improvement of 80% in the red portions of the six tattoos containing red ink after an average of 4.5 treatments. Only two tattoos contained yellow ink, and while conclusions regarding the ease of removing this normally difficult-to-remove colour cannot be generalized from two tattoos, the 85% clearance of yellow ink after only an average of 4.0 treatments was both surprising and encouraging.” 16

Science. Results. Trust. Science. Results. Trust. Picosecond 532-nm neodymium-doped yttrium aluminium garnet laser, a novel and promising modality for the treatment of café-au-lait macules. Ofir Artzi, Joseph Mehrabi, Amir Koren, Roni Niv, Lasers in Medical Science 33(3), November 2017. “A retrospective case series of 16 patients with Café-au-lait macules (CALMs) who were treated by a PS 532-nm laser (1–4 treatments, 4–8 weeks apart). Patient satisfaction and tolerance were documented at final visit. The results of 15 patients demonstrated significant improvement (average 3.43), and their satisfaction and tolerance levels were high.” Successful Treatment of a Red and Black Professional Tattoo in Skin Type VI With a Picosecond Dual-Wavelength, Neodymium-Doped Yttrium Aluminium Garnet Laser. Friedman DJ, Dermatol Surg. 2016 Sep;42(9):1121-3. “Clinical response was approximately 75% clearance for the black ink and 90% clearance for the red ink, after 3 treatments performed over 1.5 months (Figure 2). The patient was very pleased with tattoo clearance and will undergo additional treatments, using a smaller spot size and increased energy to target the remaining black tattoo ink particles.” Picosecond pulse duration laser treatment for dermal melanocytosis in Asians: A retrospective review. Ohshiro T, Ohshiro T, Sasaki K, Kishi K, Laser Ther. 2016 Jun 29;25(2):99-104. “Our results suggest that the 755 nm and 1064 nm ps-lasers are efficacious for the treatment of dermal pigment lesions, with minimum adverse events.” 17

Science. Results. Trust. Trust. Awards Energy Treatment of the Year (2018 Aesthetic Industry Awards) The Best PicoSecond Laser (2018 Aesthetic Industry Awards)

System specifications System Specifications PICOWAY SPECIFICATIONS LASER TYPE ND:YAG FREQUENCY TITANIUM Wavelengths DOUBLED ND:YAG SAPPHIRE Maximum Energy Pulse Duration 1064 nm 532 nm 785 nm Peak Power Spot Sizes 400 mJ 200 mJ 85 mJ Repetition Rate 450 ps 375 ps 300 ps Delivery System 0.89 Gigawatts 0.53 Gigawatts 0.28 Gigawatts Warm Up Time User Interface 2, 3, 4, 5, 6, 7, 8, 9, 10 mm 2, 3, 4 mm Size Single, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 Hz Single 1, 2, 3, Weight Power Requirements Articulated arm with 2 wavelength 4, 5 Hz Dedicated Zoom handpiece handpiece 2 minutes Touchscreen with GUI 42” H x 18” W x 27” D 107 cm H x 46 cm W x 69 cm D 275 lbs. / 125 kg. 200-240 VAC, 50/60 Hz, 30 A, 4600 VA single RESOLVE SPECIFICATIONS LASER TYPE ND:YAG FREQUENCY DOUBLED ND:YAG Wavelengths 1064 nm 532 nm Micro-beam energy Up to 2.9 mJ Up to 1.5 mJ Pulse Duration 450 ps 375 ps Spot Size 6mm x 6mm 6mm x 6mm Matrix 10 x 10 10 x10 Micro-beam array Repetition Rate Micro-beam array Delivery System Single, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 Hz Dedicated handpiece

For more information about how the PicoWay system may help achieve your practice goals, contact your local Candela sales professional or visit candelamedical.com. www.candelamedical.com Disclaimer: All contents of this material are for informational purposes only and provided by Candela without warranties of any kind. Healthcare professionals are solely responsible for making their own independent evaluation as to the suitability of any product for any particular purpose and in accordance with country specific regulations. The availability of products and the indications mentioned in this material is subject to the regulatory requirements and product registration status in each country. Refer to the User Manual for country specific indications.  Products and technical specifications may change without notice. Please contact Candela for more details. © 2019 Candela Corporation. This material contains registered and unregistered trademarks, trade-names, service marks and brand names of Candela Corporation and its affiliates. All other trademarks are the property of their respective owners. All rights reserved. PU07561EN Rev.A 0123