Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore Simply Crochet №122, 2022

Simply Crochet №122, 2022

Published by admin, 2022-04-01 08:51:00

Description: Simply Crochet №122, 2022

Search

Read the Text Version

Cloud pleaser It’ll be all sunny days and blue skies with this rainbow bunting by Kelly Wilson Moore yodoreucorofhfroiacmteee

CLOUD BUNTING TA ICITY Add a little sunshine to your space with these WEDIGKHT 3H.5OMOMK puy clouds and rainbow tassels. This make would look so cute in a child’s bedroom! YOU WILL NEED NOTES Q Sirdar Happy Cotton (100% cotton, 20g/43m) The yarn quantities listed will make approx 2 balls of each: 30 Cloud Motifs. Shower (762) Clouds are worked in rounds throughout. Pebble (759) 1 ball of each: BUNTING Make rainbow-coloured ‘rain’ by attaching Giggle (795) tassels to thebottom ofeachcloud motif Sorbet (793) CLOUD MOTIF MAKE 30 Melon (794) Using Shower, ch12. Laundry (782) Round 1 (RS)Tr in fourth ch from hook Bunting (797) (skipped chs counts as tr), tr in next 7 chs, 5tr in Currant Bun (756) next ch, turn and work along opposite side of foundation ch, tr in next 7 chs, 3tr in next ch, ss Q A 3.5mm (US E/4) hook to top of beg ch-3. [24 sts] For yarn stockists contact Round 2 Ss in next st, (skip next st, 6tr in next Sirdar 01924231682 st, skip next st, ss in next st) twice, skip next st, www.sirdar.com 8tr in next st, skip next st, ss in next st, (skip next st, 6tr in next st, skip next st, ss in next st) TENSION twice, skip next st, 8tr in next st, skip next st, ss in beg ss. Tension is not critical, but it may Fasten off and weave in ends affect the yarn quantities required CLOUD EDGING MEASUREMENTS Using Pebble, join yarn with a surface crochet ss around post of any tr. Each Cloud Motif measures approx Round 1 (Surface crochet around each tr from 7x4cm (2x1in) Round 3 to first ss, surface crochet around st A length of Bunting with 30 Motifs below ss from Round 1) rep around, ss in beg ss. measures approx 282cm(111in) Fasten off. ABBREVIATIONS FRINGING Sew the clouds together on thewrong side, Using Giggle, Sorbet, Melon, Laundry, Bunting leavinga gap ofabout 3cm between them surface crochet ss Position yarn on and Currant Bun, cut 60 lengths of yarn, each WS of work, insert hook from RS to 10cm long. WS where you wish the surface Using the image as a guide, take 2 lengths of crochet to begin, yrh and pull loop each colour and fold in half. Insert hook up to RS, *insert hook back through through stitch at base of Cloud, pull folded to WS in direction you wish the ends of yarn through and thread the tails surface crochet to travel, yrh and through the folded loop to secure. Repeat with pull up a loop, pull through first each colour across to form a rainbow effect. loop on hook; rep from * as Trim to desired length. required. When fastening off, pull the final tail through the last ss, TO MAKE UP thread onto a darning needle and Using Pebble, sew the Clouds together on the weave through to the WS WS, leaving approx 2-3cm between each Motif. For a full list, see page 90 Make sure to leave approx15cm of yarn at the beginning and end of the Bunting to hang. 52 WWW.GATHERED.HOW/SIMPLYCROCHET

WnfE@#anhvxstiootniomSkapibtitomlyedyhpioovglnooyiottkicaInhlgectomoftcpahaygegrtyoaofmtwhuee! It’s a cinch!HOOKTOHOOK We chaelalecnhguesdintgwtohedesasimgneeyrasrtno…cowmheicuhpiswyitohuar ffaavbed?esign, Pauline Morgan Lorraine Catterall “For this project, I was “I’ve really enjoyed asked to make a belt using being part of Hook to sHoowoko.rIkdinegsitgonacblortihefintgo, wjuhsitchoniseanveeurtyradlicoelroeunrt, design an accessory was a kind of project for me! But fun challenge. I love using that made this challenge all wcoatstodnelfiogrhmteydmwahkeensmanydRowan yarn arrived. It’s vintage-style ptahtetemrnosreanedxctietixntgu.reI as,daonrde so beautifully soft! I wanted my belt design to wanted to evoke the look of a vintage basket be fun, full of dierent textures and versatile, of owers. I knew the beautiful textured too. I love that it can be worn tted or loose and basketweave stitch would be perfect along wa vitahritehteytoafslsoeolsktso.”tChheefcrkonotu,tbLaocrkraoirnsei’dsewfoorrk on awpirtehtatydorwesesr,-eits’lqluloeobkufcaknltea.sDtircapinesduamromuenrd.” Instagram at @lilliaserendesigns Find Pauline on instagram at @makingpolly WWW.GATHERED.HOW/SIMPLYCROCHET 53

HOOK TO HOOK Left to right: Pauline was inspired by vintage patterns andincorporated a textured basketweave stitch pattern into her belt design, which also features a tapered end; surrounding the buckle with flower petal-style stitchwork makes Pauline’s beltaperfect summer wardrobe accessory FLOWER BASKET BELT may find it helpful to mark the first stitch of BELT the round, moving the marker up as you go. Using a 3mm hook, ch16. With a rustic woven look and floral-style You can adapt the finished length of the Belt Row 1 (WS)Tr in fourth ch from hook and each buckle, this belt by Pauline Morgan will by working to the measurements required. ch across, turn.[14 sts] look lovely as part of any springtime outfit This may affect the yarn quantities required. Row 2 (RS) Ch3 (counts as tr throughout), FPtr Q Rowan Summerlite 4ply (100% cotton, Main Belt is worked in rows throughout. around next 4 sts, BPtr around next 4 sts, FPtr For a full list, see page 90 around next 4 sts, tr in final st, turn. 50g/175m),2 balls of Washed Linen (418) Row 3 Ch3, BPtr around next 4 sts, FPtr around Q A 3mm (US C/2 or D/3) hook BELT next 4 sts, BPtr around next 4 sts, tr in final st, Q A 2mm (US B/1) hook turn. Q Tri-glide slider buckle, 50x20mm (available BUCKLE Row 4 As Row 3. Using a 2mm hook, work 64dc around buckle. Row 5 AS Row 2. from amzn.to/3ubziIO) Make sure you work 32 sts each side of the Rep Rows 2-5 until Belt measures 78 (88: 98: 111) For yarn stockists contact central bar. cm, ending on Row 5 rep. Rowan 01484 668200 Round 1 (RS)(7dc, 2dc in next st) 8 times. Do not fasten off. www.knitrowan.com [72 sts] TAPERED END Round 2 3dc, (2dc in next st, 5dc) 11 times, 2dc Row 1 (RS) Ch1 (does not count as st TENSION in next st, 2dc. [84 sts] throughout), (dc2tog) first 2 sts, dc in each st to Round 3 *Ss in next st, skip 2 sts, 6dtr in next st, final 2 sts, dc2tog, turn. [12 sts] Tension is not critical for this project, but it may skip 2 sts, rep from * 13 times more, ss to beg ss. Row 2 Ch3, tr in each st to final 2 sts, tr2tog, affect the yarn quantities required [98 sts] turn. [11 sts] Fasten off and weave in ends. Rows 3-9 As Row 2. [4 sts at end of Row 9] NOTES Fasten off. EDGING Buckle is worked in a continuous spiral without With RS facing, join yarn in row-end of Row 1 closing off each round with a slip stitch. You of Tapered End. Round 1 (RS) Ch1,2dc in each row-end to SIZE S M L XL corner, 2dc in next st, dc in next 2 sts, 2dc in next st, 2dc in each row-end down to end of TO FIT WAIST cm 63-76 78-86 88-97 98-107 Tapered End, ss in side of Row 1. in 25-30 31-34 35-38 39-42 Fasten off. LENGTH cm 87 97 107 119 in 34 38 42 46 rTeolemvaanket cthoilsumpantt.ern easier to follow, we’ve colour-coded the sizing instructions – simply follow the 54 WWW.GATHERED.HOW/SIMPLYCROCHET

HOOK TO HOOK Left to right: Lorraine’s design features linked treble crochet and puff stitches for ageometric, textured fabric that can be worked todifferent lengths for size adjustments; tapered ends lead to tasselled ties, which can be workat the front, back or side ofthebody TO FINISH JENNY LOVED IT BELT ABBREVIATIONS Using a 2mm hook and with WS of Belt and Buckle facing you, make a slip knot. Full of interesting details, Lorraine ltr Insert hook into middle horizontal bar of last Remove knot from hook, insert hook below the Catterall’s belt has multi-textured stitches st made (or second ch from hook for your first central bar of buckle and place knot back onto and a tassel-style tie at the back st of the row), yrh and pull up a loop, insert hook, pulling through so the working strand Q Rowan Summerlite 4ply (100% cotton, hook into next st/ch, yrh and pull up a loop, lies below the central bar. (yrh and pull through 2 loops) twice Dc the straight edge of the Belt to the middle 50g/175m), Washed Linen (418) foundation ltr Insert hook into middle bar of the buckle, working 2dc through each st. See table for measurements and yarn horizontal bar of last st made (or second ch Fasten off. quantities from hook for your first st), yrh and pull up a Weave in all ends. Q A 3mm (US C/2 or D/D) hook loop, insert hook into the 2 loops (V) at the base Q Stitch markers of the stitch just made (or third ch from hook For yarn stockists see Flower Basket Belt for your first st), yrh and pull up a loop, yrh and pull through one loop on hook, (yrh and pull TENSION through 2 loops on hook) twice puff (Yrh, insert hook into indicated st, yrh and 24 sts and 13 rows measure 10x10cm (4x4in) pull up a loop) 5 times, yrh and pull through all over linked treble crochet (ltr) using a 3mm loops on hook, ch1 to close hook, or size needed to obtain correct tension For a full list, see page 90 SIZE S/M L/XL 2X-3X 4X NOTES TO FIT WAIST cm 63-76 84-96 101-114 117-120 Belt is worked in long rows. You may find it in 25-30 33-38 40-45 46-47 helpful to place markers or scrap yarn every 20 sts to help you keep track of your stitch LENGTH INCLUDING cm 88 111.5 129.5 141 count. When working the FPhtr around a TIES in 34 44 51 55 linked treble, insert the hook above the middle bar of the stitch. LENGTH EXCLUDING cm 62 85 103 115 The pattern is worked in 4 sizes, but you can TIES in 24 33 40 45 adapt the size to match your requirements. You will need to work your foundation row as YARN 50g 1 2 2 2 a multiple of 12 + 6. Minor adjustments can be made to the length of the Belt by working Treolemvaanket cthoilsumpantt.ern easier to follow, we’ve colour-coded the sizing instructions – simply follow the longer or shorter ties at the end. WWW.GATHERED.HOW/SIMPLYCROCHET 55

HOOK TO HOOK Left to right: the belt is worked in rowshorizontally, soyou need to decide on the length in advance, before working the foundation linked treble row; at theend ofthetapered ends, a chain isworked toact asa tie– it includes a six-chain loop, which a decorative tassel is worked into BELT With RS facing turn to work down first short edge. Foundation row (WS) Ch3 (does not count as Row 1 (RS) Ch1,13dc evenly across, turn. [13sts] st), fltr 126, (174:210: 234), turn. Row 2 Ch1, dc in first st, dc2tog, dc in each st to Row 1 (RS) Ch2 (does not count as st final 3 sts, dc2tog, dc in final st, turn.[11 sts] throughout), ltr in each st across, turn. Row 3 Ch4 (counts as tr, ch1 throughout), skip Row 2 Ch1 (does not count as st throughout), next st, (tr in next st, ch1, skip next st) across to FPhtr around each st across, turn. final st, tr in final st, turn. [6 sts, 5 ch-1 sps] [126 (174:210: 234) sts] Row 4 Ch1, dc in first st, (skip ch-1 sp, dc in next Row 3 Ch1,dc in each st across, turn. st) twice, dc in next ch-1 sp, dc in next st, (skip Row 4 Ch2, skip first st, puff st in next st, (skip 1 ch-1 sp, dc in next st) twice, turn. [7 sts] st, puff st in next st) across to end, turn. Row 5 Ch4, skip next st, (tr in next st, ch1, skip 1 [63(87:105: 117) sts] st) rep across to final st, tr in final st, turn. Row 5 Ch1,2dc in each puff st across, turn. [4 sts, 3 ch-1 sps] [126 (174:210: 234) sts] Row 6 Ch1, dc in first st, skip next ch-1 sp, dc in Row 6 Ch2, ltr in first 6 sts,*(ch1, skip 1 st, tr in each st and ch-1 sp to final ch-1 sp, skip ch-1 sp, next st) 3 times, ltr in next 6 sts; rep from * dc in final st, turn. [5 sts] across to end, turn. Row 7 Ch3, skip next st, tr in next st, skip next Row 7 Ch2, ltr in first 6 sts, *(tr in next st, ch1, st, tr in final st. skip ch-1 sp) 3 times, ltr in next 6 sts; rep from * Row 8 Ch40, ss in bl of sixth ch from hook and across to end, turn. bl of each ch across, ss in top of beg ch-3 from Row 8 Ch2, ltr in first 6 sts,*(ch1, skip ch-1 sp, tr Row 7. in next st) 3 times, ltr in next 6 sts; rep from * Fasten off. across to end, turn. Work End on opposite edge of Belt. Rows 9-10 Rep Rows 3-4. [63(87:105: 117) sts] TASSELS Row 11 Ch1,2htr in each st across, turn. Cut10 lengths of yarn approx 20cm long. Hold [126 (174:210: 234) sts] together and fold in half. Place your hook Row12 Ch1,FPhtr in each st across, turn. through the ch-6 loop at end of one of the ties Row13 Ch2, ltr in each st across. and pull folded ends though. Thread the tails Do not fasten off. through the loop and pull tight to secure. ENDS Trim to desired length. Tapered ends are worked across the 2 short Repeat on the second tie. edges of the Belt. 56 WWW.GATHERED.HOW/SIMPLYCROCHET



GOOD READ Devoted designer Ana often spends 12hours a dayworking on her crochet projects Blanket stitch Portuguese designer and creator of the new SimplyCrochet CAL Ana Morais Soares explains her passion for big blankets, colour and how she cannot live without crochethenyouimagineanidyllicplace where you could spend all day crocheting, you may envision Wsomethingthat’sverycloseto Ana Morais Soares’s reality. I love all the blue and green shades of I choose pastel colours if I need to relax and a stormy sea as well as the paradisiac strong colours if I need to cheer up. I take colours of the beach. I love the sea’s pics of anything colourful I see in my daily sound and smell. It really relaxes me.” life that catches my eye.” When designing, Ana likes to keep her Basedinabeautifulfishingvillageonthe COSYTOUCH options open and develop patterns west coast of Portugal, Ana has an Ana’sbodyofworktodateincludesawhole organicallywithout,forexample,sketching affinity with the ocean that feeds her hostofblankets,oftenworkedingeometric, themoutfirst.“I’mawfulatdrawing,”she creativity and nourishes her soul on mosaic-stylepatterns.“Ilovebigprojects,” confesses.“Itakenotesonideas,colours, a regular basis. “I love the sea,” she she says. “When I finish a crochet project, and so on and I ‘draw’ them with my hooks.” explains. “My grandfather was a ‘sea Ialwaysgetnostalgicandmissitalot.Sobig Shealsodoesn’tgettoospecificabouther wolf’, the name we give here to those projectskeepmesatisfiedformoretime. personaldesignstyle.“Ineverthought men involved in cod fishing. He was And I love the cosy, snuggly touch of about it,” she confesses. “Maybe a colourful acaptainononeofthoseshipsthatsailed ahandmadeblanket.”Infact,Ana’spassion [style]withoutneoncolours,elegantand toNewfoundlandandstayedintheopen forblanketsissoprofoundthat,upon sometimes romantic.” seaforalmostayear.Itwashardfishing joiningInstagram,shecreatedthe However, she does have favourite stitches inseveretemperatures,andmanymen #mycrushonblankieshashtag. and yarns, and she’ll mix and match them to lost their lives. I learned to respect the When selecting the colours for her come up with new projects. “I love double sea as something that gives but also projects,Anadoesn’tadheretoahardand crochet–it’ssorelaxingtodo–andcluster takes.Iloveitbutrespectitevenmore. fastformula.“Itdependsonmymood. stitches, which I think look like petals. I also 58 WWW.GATHERED.HOW/SIMPLYCROCHET

GOOD READ SeTTohsaAErL1 suetaM síuL dna seraoS siaroM anA :sotohP love the texture of front post stitches. and breathes crochet all day, every day. intense period of rapid design a couple of “I also love cotton yarn. It gives such “I cannot live without crochet,” she says. years ago as she put together the projects for her book Cosy Crochet Blankets to beautiful definition to stitches. I’ve used “Some days I might be very tired, but I need Snuggle Under for Tuva Publishing. “It was acrylic a lot as it’s warmer and more resistant to sit and crochet a few stitches. It’s my such a challenge. So much joy to create all to washes, [which is useful] with small kids relaxing moment, my me-time. I meditate those blankets, but also such a pain to have around. Now I’m trying to reduce my stash a lot while crocheting. I’m totally dedicated them all done in only six months!” of it and go for more sustainable yarns.” to crochet design now, but instead of a job FAMILY AFFAIR However, her time spent designing for Ana has been crocheting since she was “WheInaIlawfnindaisymhsisgasectirtonacohsletoattl”pgricoject, books didn’t stop there. “Last year I was also eight years old, and grew up seeing her contacted by David & Charles Books to mother and grandmother crocheting from Monday to Friday, I have one from design squares for the book 100 Crochet before becoming hooked herself. “We used Monday to Sunday. I usually work more than Tiles. I came up with 10 squares and three to sit all together after dinner chatting and 12 hours a day. It’s very absorbing, and my projects. I really like the challenge of crocheting. It was a kind of a family therapy.” bones sometimes complain, but in Portugal designing new things, but this time the Later in life, Ana began testing patterns for we used to say, ‘Those who run for pleasure process was much calmer!” several designers, which in turn made her never get tired’.” For this reason, Ana’s realise her true calling was to design herself. stitching studio has become her sanctuary. In addition to her new Talavera CAL with “I can get there and forget a little bit about SimplyCrochet (seepage61),Anasaysthere An Etsy shop and Instagram account the craziness happening in our world.” are many more exciting projects in the followed in 2014 and 2015 respectively, and pipeline over the next few months, but she’s now Ana’s online presence is going from This dedication saw Ana through an been sworn to secrecy. “Sorry, I cannot strength to strength under her One Skein Of reveal them yet. But I will keep designing Love brand. “Only last year I started using new things. I don’t like to make plans as Etsy more regularly. I love reactions from I believe good things happen when we least new crocheters saying how easy it is to expect them, but I would love to collaborate follow my patterns. I recently also created more with yarn brands.” a Facebook group, Oneskeinoflove Crochet. Written by Lucy Evans I’m having a lot of fun there. It’s such a great group with kind and helpful people, and it’s A few of her favourite things a place where crochet newbies can get all the attention and help they need.” When Ana’s not busy crocheting, you’ll find her… TRANQUIL RETREAT “Quilting, reading, baking and taking walks on the beach – especially Considering her infectious love of crochet during autumn and winter when the beach is almost empty!” and her desire to spread the word about it, Find out more at www.oneskeinoflove.com or visit Ana on Instagram it’s no surprise that Ana pretty much lives at @oneskeinoflove, on Facebook at Oneskeinoflove Crochet and on Etsy at www.oneskeinoflovecrafts.etsy.com WWW.GATHERED.HOW/SIMPLYCROCHET 59



CROCHET-ALONG TaBllaanvkeetra bBrirginhgt Scoplaonuisrshasnudnstheixnteuriendtostyiotcuhrehsoomf AenwaitMhothraeis Soares’seven-part Talavera blanket crochet-along stiLtocthseosftnoetwry! SUBSCRIBE! GYEATRAN CPAARCOKNTURNTTHCOEOPYMAAPGRLENE3TYE6OTUTHONERECEEDACLETIOVE ALL WWW.GATHERED.HOW/SIMPLYCROCHET 61

CROCHET-ALONG TA ICITY Imaginative stitches and bright colours pop WAERIGAHNT 5H.5OMOMK on thismulti-texturedblanket,bringing forth visions of Spanish Talavera tiles and YOU WILL NEED warm days spent by the sea. This is the rst part of this seven-part CAL, and we’ll be Materials are for the whole Blanket starting at the centre of the blanket. We hope Q Caron Simply Soft, (100% acrylic, you’ll join us on this exciting Iberian journey! 170.1g/288m), 4 balls of Off White NOTES (9702),3 balls of each: Blue Mint (9608), Robin’sEgg (9780), This crochet-along has been designed in 2 balls of each: seven parts, worked from the centre out. Gold (9782),Fuchsia (9764) The Blanket is worked in rounds with RS facing Q A 5.5mm (US H/8) hook throughout. You may wish to weave in ends Q Stitch markers or scrap yarn as you work. For yarn stockists contact Wool Warehouse 01926882818 BLANKET www.woolwarehouse.co.uk PART 1 Using Gold, make a magic loop. TENSION Round 1 (RS) Ch3 (counts as tr), 15tr into loop, ss to top of beg ch-3, do not fasten off.[16 tr] Rounds 1-10to measure approx10cm Round 2 (RS) Ch3 (counts as first tr of first 5-tr Part 1 ofthe blanket CALbegins with a (4in) in diameter pc), 4tr in same st, finish as for 5-tr pc, *ch2, tr in magic loop for the floral motif in the centre next st, ch2, 5-tr pc in next st; rep from * 7 times MEASUREMENTS more, omitting last 5-tr pc, ss to beg 5-tr pc. [8 5-tr pc, 8 tr,16 ch-2 sps] Finished blanket measures approx Fasten off. 145x145cm (57x57in) Round 3 Using Blue Mint, standing dc in any 5-tr pc, *2dc in next ch-2 sp, dc in next st, 2dc in ABBREVIATIONS next ch-2 sp, dc in next 5-tr pc; rep from * 7 times more, omitting last dc, ss to beg dc. 5-tr pc 5tr in st/sp specified, remove [48 dc] loop from hook, insert hook in first tr, Fasten off. place loop on the hook and draw loop Round 4 (Working in bl throughout) Using Off stitch, ch1 to secure. To work in the White, standing tr in any st worked in a 5-tr pc ‘eye’ of a pc already made, insert hook from Round 2, tr in same st, *tr in next 2 sts, 2tr in sp created when loop on hook is in next st; rep from * 15 times more, omitting drawn through first st last 2tr, ss to beg tr. [64 tr] standing sts A standing st at beg of Round 5 Ch1 (does not count as st), dc in bl of round is worked starting with a slip each st around, ss to beg dc. [64 dc] knot on the hook, then the st indicated Fasten off. is worked as normal in the st or sp Mark the 8 dc from Round 3 that are worked Work in the round, beginning with a circle specified into the tr from Round 2. Each leg of a ttr2tog st shape that will change toasquare later cl Work all sts of a cl in the same st/sp in the foll round is worked into the fl of marked specified, working each st of the cl up dc either side of a 5-tr pc from Round 2. to the last yrh of each st. At this point Round 6 Using Blue Mint, standing dc in Round 8 Using Off White, standing htr in any there will be 1 loop on the hook for second tr worked in a marked dc, dc in next 3 FPdc, htr in same st, *htr in next 4 sts, 2htr in FP each st of the cl, plus the original loop sts, ttr2tog with first leg in fl of prev marked dc cl, htr in next 4 sts, 2htr in FPdc; rep from * 7 on the hook (for a 2-tr cl there will be 3 and second leg in fl of next marked dc, *dc in st times more, omitting last 2 htr, ss to beg htr. loops on the hook), yrh, draw through behind ttr2tog and next 3 sts, dtr in fl of same [96 htr] all loops on hook marked dc just worked, dc in st behind dtr and Fasten off. ttr2tog *Yrh 3 times, insert hook in st next 3 sts, ttr2tog with first leg in fl of same Round 9 Using Gold, standing BPhtr around indicated, yrh and pull up a loop, (yrh marked dc as dtr, and second leg in fl of next any st, BPhtr around every st around, ss to beg and pull through 2 loop) 3 times; rep marked dc; rep from * 6 times more, dc in st htr. [96 BPhtr] from * once more working into next st behind ttr2tog and next 3 sts, dtr in same fl of Fasten off. indicated, yrh and pull through 3 loops marked dc just worked, ss to beg dc. [8 ttr2tog, Round 10 Using Robin’s Egg, work entire round on hook 8 dtr, 64 dc] in bl, standing tr in any st, tr in same st, *tr in FP4-tr cl *Yrh, insert hook from front to Fasten off. next 5 sts, 2tr in next st; rep from * 7 times back to front around post of st, yrh and Round 7 Using Fuchsia, standing FPdc around more, omitting last 2 tr, ss to beg tr.[112 tr] pull up loop, yrh and draw through 2 any ttr2tog, *dcbl in next 4 sts, FP4-tr cl around Fasten off. loops; rep from * 3 more times next dtr, dcbl in next 4 sts, FPdc around next st; Round 11 Using Gold, standing dcbl in a tr inserting hook around same st, yrh and rep from * 7 times more, omitting last FPdc, ss aligned with aFP4-tr cl of Round 7, *dtr in fl of draw through all loops on hook to beg FPdc. [8 FPdc, 8 FP4-tr cl, 64 dc] next st 2 rounds below, skip st behind, dcbl in For a full list, see page 90 Fasten off. next 6 sts; rep from * 15 times more, omitting 62 WWW.GATHERED.HOW/SIMPLYCROCHET

CROCHET-ALONG last dc, ss to beg dc. [16 dtr, 96 dc] Fasten off. Round 12 (Working in bl throughout) Using Blue Mint, standing dc in any dtr aligned with a FP4-tr cl from Round 7, dc in same st, *dc in next 13sts, 2dc in next st; rep from * 7 times more, omitting last 2 dc, ss to beg dc. [120 dc] Fasten off. Round 13 Using Gold, standing 5-tr pc in fl of any dtr from Round 11 aligned with FPdc from Round 7, skip st behind, *dcbl in next 14 sts, 5-tr pc in fl of next dtr from Round 11, skip st behind; rep from * 7 times more, omitting last 5-tr pc, ss to beg 5-tr pc. [8 5-tr pc, 112 dc] Fasten off. Round 14 Using Fuchsia, standing dc in eye of any 5-tr pc (see Abbreviations), *dcbl in next 7 sts, FPttr2tog around dtr from Round 11, dcbl in st behind FPttr2tog and next 6 sts, dc in eye of 5-tr pc; rep from * 7 times more, omitting last dc in pc, ss to beg dc. [8 FPttr2tog, 120 dc] Fasten off. Round 15 Using Off White, work all htr of this round in bl, standing htr in any dc worked in a 5-tr pc from Round 13, htr in same st, *htr in next 7 sts, trfl in st behind FPttr2tog from Round 13 (8th dc after 5-tr cl), skip FPttr2tog, htr in next 7 dc, 2htr in 5-htr pc; rep from * 7 times more, omitting last 2 htr, ss to beg htr, do not fasten off. [8 tr, 128 htr] Round 16 (Working in bl throughout) Ch2 (counts as a first htr), htr in same st, *htr in next 8 sts, 2htr in next st, htr in next 7 sts, 2htr in next st; rep from * 7 times more, omitting last 2 htr, ss in top of beg ch-2.[152 htr] Fasten off. Round 17 Using Blue Mint, standing BPhtr around any st and each rem st around, ss to first st, do not fasten off.[152 BPhtr] Round 18 Ch2 (counts as first htr), htr in each st around, ss in top of beg ch-2.[152 htr] Fasten off. a ro . br o ta e WWW.GATHERED.HOW/SIMPLYCROCHET 63

Peach fuzz aOirraynmgoehyaoiur wgrlaadp yboyuHsapnontatehdCtrhoisss? soumybabtrrlnee

SUMMER WRAP AASSYY Welcome the warmer seasons with lush The airy lace fabric is made ina four-row WLEAIGCHET 6H.5OMOMK orange creamsicle shades in subtle ombre, repeat herringbone treble stitch pattern perfectly displayed on this lightweight wrap. YOU WILL NEED SAV NOTES S LU Q Rowan Kidsilk Haze Colour (70% mohair, 30% silk, 50g/420m) Wrap is worked in short rows. For a more budget-friendly make, try 3 balls of Sunset (008) Use 2 strands of yarn held together as one Schachenmayr Mohair Dream: 2 balls of throughout. Blossom (00082). Checkhooksize,tension Q A 6.5mm (US K/10) hook Ch-1 sps count as a st throughout. and ball length if you use a different yarn For yarn stockists contact Rowan 01484 668200 WRAP For yarn stockists, visit www.knitrowan.com www.schachenmayr.com Ch51. TENSION Row 1 (RS) Hbtr in third ch from hook and each ch across, turn.[49 sts] Tension is not critical, but it may Row 2 (WS) Ch2 (does not count as st affect the yarn quantities required throughout), (hbtr in next 2 sts, ch1,skip 1 st, hbtr in next st, ch1, skip 1 st, hbtr in next 2 sts) MEASUREMENTS 7 times, turn. Row 3 Ch2, *(hbtr in next st, ch1, skip 1 st) 3 Wrap measures approx 49x202cm times, hbtr in next st; rep from * across to end, (19x79in) turn. Row 4 As Row 2. ABBREVIATIONS Row 5 Ch2, hbtr in each st across, turn. Rep Rows 2-5 until Shawl measures approx hbtr (herringbone treble)Yrh, insert 202cm, ending on a Row 5 rep. hook in st/sp indicated, yrh and pull Fasten off and weave in ends. up loop, pull loop through first loop on hook, yrh and pull through 2 rem loops on hook For a full list, see page 90 SIMPLE STEPS HOW TO BLOCK YOUR CROCHET PIECES 1Check the yarn’s ball band 2 Using long, rust-proof pins 3 Placepins inside the last row 4 Forwet blocking, just leave for advice on whether to dry, or blocking wires, pin out to or round of stitches, not in the to dry.To dry block, spritz wet orsteam block your item. the measurements in the actual stitches or you risk with cold water and leave to Towetblock, wash the item pattern (check the schematic distorting them. Insert the dry.To steam block, hover before pinning. For dryand for garments). Start at the pin’s point towards the centre a steaming iron over the fabric steam blocking, pin out when corners, then move evenly of the fabric, away from the (don’t touch it)untildamp, dry.To pinout, laytheitem around the edges. You can edge, to balance out the then leave to dry.Once dry, flat onatowelovera blanket. reposition pins if needed. forces involved. you can remove thepins. WWW.GATHERED.HOW/SIMPLYCROCHET 65

GOOD READ Healing hooks The calming, repetitive stitches of crochet can distract and soothe during tough times.Two hooksters describe how the crochet community and the craft itself have helped them through physical and mental illness...

GOOD READ Clockwise from left: Patricia wears the blanket made for her by her Instagram friends; Alice the Zebra accompanies her to all of her appointments; applique owls were “the first project to get me truly back into crochet again during lockdown” PATRICIA’S STORY: hospital since my diagnosis – often I’ll be in waiting rooms for hours at a time. Crochet “When I crochet, I feel warm and fuzzy”hecrochetcommunitywrappedits Afterachildhoodspenttravelling,Ifinally transports my mind to a more exciting, armsaroundPatriciaNovelliafter settledintheUKandstudiedtobecome creative place. It also distracts me if I ever feel nauseous due to treatments. Thercancerdiagnosisinthespringof avirologist.Crochetwasalwaysaroundin FEELING THE LOVE 2021.Below,shediscussesherfavourite thebackground,butwhileIworkedhardon The crochet community is just fantastic. I’ve makes,howshegotintothecraft,crochet’s my careerittookabackseat.ThentheCovid always disliked social media, but after soothing nature and how she received pandemic ended up coinciding with my I began my crochet journey a friend urged supportandlovefromothercrochetfansin cancerdiagnosisandIneededsomethingto me to join Instagram, explaining how I could an unexpectedplace–hooky socialmedia. distractme,sooutcamemyhooks. use it to record my yarns and patterns. Now Ihavemorethan2,000 followers–my NEW STRIPES SOOTHING STITCHES teenagesonasks mehowI’vedoneit! Alice the Zebra may be a bit wonky, but she’s When I crochet, I feel warm and fuzzy. There’s FRIENDSINNEW PLACES one of my favourite makes. You see, zebras something about its repetitive nature that I’ve made so many new friends through my are the symbol for rare cancers and, in spring makes it incredibly relaxing. I think it’s the account. When I went in for surgery, some of 2021, I was diagnosed with neuroendocrine soothing way that the hook slots in and out my followerssentmewell-wishinggifts of cancer. So, when I saw an amigurumi pattern of the yarn, over and over again. stitch markers and yarn skeins. Then, before to make this little zebra, I just knew I had to AVID COLLECTOR I started chemo, they sent me a gorgeous hook Alice up myself. Now she’s by my side at It’s not only the act of crocheting that I love – blanket to bring me comfort. all my hospital appointments. I’m also an avid collector of crochet books CROCHET ORIGINS and magazines. When I look at other people’s They had all hooked squares for that I crocheted as a child and lockdown last year designs and read about the history of blanket, and the whole thing was organised inspired me to return to the craft. I’m Italian crochet, I feel inspired and happy to be a part by Melanie Joy, aka @the.yarnicorn, through and my dad worked for the United Nations, of such an amazing community of crafters. a secret Instagram account. Their kindness so we lived all over the world when I was A LITTLE PROGRESS really took my breath away. growing up. I remember first being taught I’d highly recommend other people with Follow Patricia on Instagram at how to crochet by an American woman when cancer learn how to crochet. It can give you @crochetandcancer Dad was posted to Afghanistan in the 1970s. a sense of achievement on a day that might I also have vivid memories of crocheting tiny be filled with hospital appointments or clothes for my teddies and Barbies back necessary rest. I’ve spent so much time in when we lived in Kenya. WWW.GATHERED.HOW/SIMPLYCROCHET 67

GOOD READ SiyprSfhtSCnaoiatttoalpvteeeoprsoepovvvnctlrkliiiekueeeceeeilwfrnos’’’stsissstgtl:tihilccwseiSnetgaeoutsccogdaelrfthtorrrirevsikteoomiutiscssenimnrhtwpeftcl;uonaihtlvctehseesi;s;n STEVIE’S STORY: “Crochet pulled me through”tevieLarwood’snew-foundpassion for crochet was her anchor as she FIRSTVENTURES crochet. But it’s comforting to know that when My crochet journey began when I noticed I feel better, crochet will still be there for me. Shealed from psychosis. Now, she that a new yarn shop had opened up in my HOOKY ADVICE shares her love of the craft with others. town. I plucked up the courage to go in and Crochet can be of such a benefit to people got talking to the assistant. She suggested with mental health issues. When I was ill, I was AWELCOME SOLACE I come along to a beginners’ crochet under the care of an early intervention EverytimeIpickupmyhook,I’mescaping workshop.Iwastheworstthere,butIfellforit psychosis team and I now go back to advise intoaworldofcolourandcreativity.Crochet immediatelyandpractisedgrannysquares them on the patient experience. I’m looking relaxes me. It’s something tactile that for a whole year, gradually improving my into how I can start workshops to help people grounds me in reality. When I was first skills. Now, I love making clothes – particularly under their care. I know tricks such as using recovering,IwouldworrythatIwasslipping mysignaturebobble-stitchcardigan.Iadore chunky yarn if you are feeling shaky. intoanotherepisode.Crochetwouldreassure pastelshades,andripplestitchismycurrent LOOKING FORWARD me that everything was OK. favourite stitch to use. As I continue on my crochet journey, I’d like to I’ve always struggled with my mood and The crochet community helped to build me carry on teaching newbies on my social media then,in2017,mymentalhealthstartedto backup.IsetupmyInstagramandYouTube feeds. When I was learning, I found that some deteriorate.Ilosttouchwithreality–Iwas accountsasawaytomeetpeopleafterleaving beginners’ tutorial videos were so fast that I’d seeing, hearing and smelling things that my hometown. They allowed me to connect get lost. I make slower videos that really take weren’t there. I became so ill that I was with people who are also passionate about their time over the process of crochet. I’m also sectioned due to psychosis and put on crochet – all the lovely comments and planning to go to uni and eventually want to asecureward.Itwasaweirdandisolating messageshavereallyboostedmyconfidence. train as an art therapist. Crochet has truly experience and I was happy when I was given me so much, and I want everyone to discharged. I was diagnosed with bipolar NOT ALWAYSEASY understand how wonderful it is! disorderandputunderthecareofamental Therehavebeentimeswhenit’sbeen FollowStevieonInstagramat@steviebythesea healthteamforthenextthreeyears.Crochet physicallyhardtocrochet.WhenIfirst Written by Marianne Rawlins wasthemainthingthatpulledmethrough.It learned,Iwasonmedicationthatmademe gavemeapurposeandsomethingtofocus veryshaky.Ialsogetmigraines–linkedto on apart from my illness. trauma – which wipe me out so that I can’t 68 WWW.GATHERED.HOW/SIMPLYCROCHET

TULIP CUSHION rSepfrreinsgh Grow a garden in your own living room with this ower themed cushion by Florencia Campos Correa WWW.GATHERED.HOW/SIMPLYCROCHET 69

TULIP CUSHION WEDIGKHT H5OMOMK Rows ofblossomingowerscometolife The design is made inthe interlocking mosaic against a cool green background on this method, working with one colour ata time YOU WILL NEED pretty cushion. Go on, bring the outdoors in! The stitch pattern combines double crochet Q King Cole Cottonsoft DK NOTES with treble stitches worked into rows below (100% cotton, 100g/210m) 3 balls of Apple(1851) Cushion is made up of one Panel, which is The cushion is made asone front panel, which 1 ball of each: sewn to backing fabric at the end. is sewn tosturdy fabric to create aback Opal (3460) The Panel is worked in the interlocking mosaic Join Apple in first st. Hot Pink (1848) method. There is a Chart on page 96, which Row 87 Ch1,dc in each st across. Orange (3030) you will need to refer. Read all rows from right Fasten off. to left. Each row is worked in one colour only. Rows 88-90 As Row 87. Q A 5mm (US H/8) hook Where a second colour appears in a row this Fasten off and weave in all ends. Q Cushion pad, 50x35cm will be worked with a tr2d on the next row in TO MAKE UP Q Backing fabric, 52x36cm that colour. Each small square represents a dc Fold in a 1cm seam on each side of the backing Q Basic sewing kit in the bl except the first and last stitch of each fabric and pin to the Panel, with WS facing out. For yarn stockists contact row, which is worked through both loops. Sew the fabric to the Panel over 3 sides, turn so King Cole01756703670 Where a tr2d is indicated, work the treble st RS is facing out and insert the cushion pad. Sew www.kingcole.com into the unused fl of st 2 rows below. The first the final side close. few rows of the Chart have been written out TENSION to guide you. Work all rows with RS facing, fastening off at 24 sts and 26 rows measure the end of each row. 10x10cm over interlocking mosaic pattern using a 5mm hook, or size CUSHION needed to obtain correct tension PANEL MEASUREMENTS Using Apple, ch122. Row 1 (RS) Dc in second ch from hook and Cushion measures 50x34cm each ch across. [121 sts] (19x13in) Fasten off. Join Apple in first st. ABBREVIATIONS Row 2 (RS) Ch1 (does not count as st throughout), dc in each st across. tr2d Work a tr in the unused fl 2 Fasten off. rows below Rows 3-4 Rep Row 2, fastening off at the end of For a full list, see page 90 each row. Fasten off. For Join Opal in first st. at Row 5 Ch1, dc in first st, dc in bl of each st www.blacksheepwools.com across to final st, dc in final st. use the code 122KC Fasten off. at the checkout Join Apple in first st. Row 6 Ch1, dc in first st, tr2d in next 15 sts, (dc Oer ends 06/06/2022 in bl of next st, tr2d in next 21 sts) 4 times, dc in Code cannot be used with bl of next st, tr2d in next 15 sts, dc in final st. Fasten off. any other codes Join Opal in first st. Row 7 Ch1, dc in first st, (dc in bl of next 15 sts, 70 WWW.GATHERED.HOW/SIMPLYCROCHET tr2d in next st, dc in bl of next 6 sts) 5 times, dc in bl of next 9 sts, dc in final st. Fasten off. Join Apple in first st. Row 8 Ch1, dc in first st, (tr2d in next 15 sts, dc in bl of next st, tr2d in next 6 sts) 5 times, tr2d in next 9 sts, dc in final st, turn. Fasten off. Join Opal in first st. Row 9 Ch1, dc in first st, (dc in bl of next 15 sts, tr2d in next st, dc in bl of next 6 sts) 5 times, dc in bl of next 9 sts, dc in final st. Fasten off. Join Apple in first st. Rows10-86 Cont in patt set, using the Chart as you work.

THE DYE LOT Meet an indie dyer and indulge in a design with their skeins Attic Spin Dye is a dyer with “I started dyeing for her own personal use sometimes I put them out to Instagram and a difference – husband and four years ago, but I enjoyed it so much that let people suggest a name. That is popular.” wife team Andy and I ended up with a stockpile! I decided to In the future, Andy is looking to create Angela Holcroft are on a open an Etsy shop to sell the excess. It more classic literature-inspired yarns, and mission to spread the word bloomed from that. Just before lockdown, wants to start using natural dyes and more about misdiagnosed and I started to apply for shows and did the first 100% wool based yarns. “It’s always rare illnesses. They’ve even ones last year, starting with Yarndale.” a learning experience,” says Andy. “The created a little character, the rainbow- FEELING INSPIRED possibilities are endless.” coloured Spot the Zebra, to promote it. Andy finds a lot of his inspiration in things HAVING AN IMPACT This initiative comes from a very like nature, music and literature. “We have an As for their Spot the Zebra campaign, Andy personal place; Angela lives with EDS as ongoing Alice in Wonderland subscription explains that it’s already changed several well as a few other conditions. The couple club,” he says. “My personal favourite was a lives for the better. ”We’ve had feedback decided to create yarn packs that contain very early yarn called Kingfishers Bridge. It from people as far away as America and informationabout EDSandhelpraise was named after seeing a Kingfisher Spain who have seen our campaign, further awareness about the existence of other perched on a stone and brick bridge in investigated, realised loved ones have the rare diseases, too. Of course, this is done the Lake District. condition and convinced their doctors to on top of creating their regular large look into it further. If we can help with selection of hand-dyed yarns as well! He also explains that he has several yarns exposure and one more person is helped EARLY DAYS named after the birds and flowers that [because of it], then it’s a win.” “My wife Angela has been a knitter and inspired them. “Other colours are created www.AtticSpinDye.etsy.com crocheter for many years,” says Andy. first, and then I find what it reminds me of. Instagram: @atticspindye Some are based on abstract concepts, and WWW.GATHERED.HOW/SIMPLYCROCHET 71

MARictatriioncb1S0opwsinkZeeDibnyraeset Asditdtinaglitattloepmaavgiibcrtaonytorauinr lbifoewwbityhVtwictoolroiaveKbaiirrdiss 72 WWW.GATHERED.HOW/SIMPLYCROCHET

THE DYE LOT TA ICITY Not only is this amigurumi project a beautiful W4EPIGLYHT 2H.2O5OMKM make, the colourful skein set helps raise awareness for rare disorders like EDS. YOU WILL NEED NOTES Work the two rainbow stripe pieces in double Q Attic Spin Dye Rainbow Zebra crochet and then slip stitch them together Micro 10 skein set Parts of this pattern is worked using the (75%superwash Merino, 25% amigurumi method. Work stitches in a nylon, 10g/42.5m per mini skein) continuous spiral without closing off each round with a slip stitch. It may help to use a Q A 2.25mm (B/1 or C/2) hook stitch marker in the first stitch of each round, Q Stitch marker moving it up as you work. Q Toy stuffing The colour of each small skein is referred to as Q 2x large coins (optional) Dark Grey, Tweed Grey, Violet, Indigo, Light For yarn stockists contact Blue, Green, Yellow, Orange, Red and Pink. www.atticspindye.etsy.com RAINBOW Use arunning stitch tosecure the ends ofthe TENSION rainbow inside the bumps oftheclouds RAINBOW MAKE 2 Tweed Grey. Tension is not critical, but it may Using Violet, ch31. Ch9. affect the yarn quantities required Row 1 (RS) Dc in second ch from hook and Round 1 (RS) Dc in second ch from hook and each ch across, turn. [30 sts] next 6 ch, 3dc in final ch, turn to work down MEASUREMENTS Rows 2-3 Ch1 (does not count as st opposite edge of foundation ch, dc in next 6 ch, throughout), dc in each st across, turn. 2dc in final ch. [18 sts] Rainbow measures approx 14x17cm Row 4 Ch1,(dc in next 5 sts, 2dc in next st) 5 Round 2 (RS) (2dc in next st, dc in next 6 sts, (5x6in) inc Birds times, turn. [35 sts] 2dc in next 2 sts) twice. [24 sts] Change to Indigo. Round 3 *Dc in next st, 2dc in next st, dc in ABBREVIATIONS Row 5 Ch1,(dc in next 6 sts, 2dc in next st) 5 next 6 sts, (dc in next st, 2dc in next st) twice; times, turn. [40 sts] rep from * once more. [30 sts] invdec Insert hook in fl of first st to Row 6 Ch1,(dc in next 7 sts, 2dc in next st) 5 Round 4 *Dc in next 2 sts, 2dc in next st, dc in be decreased, insert hook in fl of times, turn. [45 sts] next 6 sts, (dc in next 2 sts, 2dc in next st) twice; second st to be decreased, yrh, pull Change to Light Blue. rep from * once more. [36 sts] through 2 loops, yrh and pull Row 7 Ch1,(dc in next 8 sts, 2dc in next st) 5 Round 5 *Dc in next 3 sts, 2dc in next st, dc in through 2 loops on hook times, turn. [50 sts] next 6 sts, (dc in next 3 sts, 2dc in next st) twice; For a full list, see page 90 Row 8 Ch1,(dc in next 9 sts, 2dc in next st) 5 rep from * once more. [42sts] times, turn.[55 sts] Round 6 *Dc in next 4 sts, 2dc in next st, dc in Change to Green. next 6 sts, (dc in next 4 sts, 2dc in next st) twice; Row 9 Ch1,(dc in next10 sts, 2dc in next st) 5 rep from * once more. [48 sts] times, turn. [60 sts] Round 7 *Dc in next 5 sts, 2dc in next st, dc in Row10 Ch1,(dc in next 11 sts, 2dc in next st) 5 next 6 sts, (dc in next 5 sts, 2dc in next st) twice; times, turn. [65 sts] rep from * once more. [54 sts] Change to Yellow. Round 8 *Dc in next 6 sts, 2dc in next st, dc in Row 11 Ch1,(dc in next 12 sts, 2dc in next st) 5 next 6 sts, (dc in next 6 sts, 2dc in next st) twice; times, turn. [70 sts] rep from * once more. [60 sts] Row12 Ch1,(dc in next 13 sts, 2dc in next st) 5 Rounds 9-12 Dc in each st around. times, turn. [75 sts] Round 13 *Dc in next 6 sts, invdec, dc in next 6 Change to Orange. sts, (dc in next 6 sts, invdec) twice; rep from * Row13 Ch1,(dc in next14 sts, 2dc in next st) 5 once more. [54 sts] times, turn. [80 sts] Row14 Dc in next 7 sts, turn leaving rem sts Row14 Ch1,(dc in next 15 sts, 2dc in next st) 5 unworked. [7 sts] times, turn. [85 sts] Do not fasten off. Change to Red. Rows15-17 Ch1,dc in each st across, turn. Fasten off first Rainbow only. Place Rainbow pieces together with WS facing out, and ss the final rows together. Fasten off. Ss the foundation ch of each Rainbow together in the same way. Fasten off. Turn so RS is facing out and stuff Rainbow firmly. Sew the ends closed. CLOUDS (MAKE 2) FIRST SIDE BUMP Make one using Dark Grey and one using Row15 (WS) Ch1,(dc2tog, dc in next 2 sts) 4 WWW.GATHERED.HOW/SIMPLYCROCHET 73

RAINBOW TOY times, dc2tog, turn leaving rem sts unworked. Make two amigurumi- [13 sts] style birds for thetop Row16 Ch1,dc2tog, dc in next 2 sts, dc2tog, dc in next st, dc2tog, dc in next 2 sts, dc2tog, turn. [9 sts] Row17 Ch1,dc2tog, dc in next 2 sts, dc2tog, dc in next st, dc2tog, turn. [6 sts] Row18 Ch1,(dc2tog) 3 times. [3 sts] Fasten off. SECOND SIDE BUMP With WS facing, skip the next 9 unworked sts from Round 13 and work Rows15-19 to make the next bump in the Cloud. Fasten off. MIDDLE BUMP (MAKE 2) invdec, dc in next 4 sts, invdec, dc in next 6 sts, Thread the tail through the fl of each st of final With WS facing, join yarn in last st of First Side 2dc in next 2 sts. [26 sts] round, pull tight to close. Bump. Round 9 2dc in next st, dc in in each st to final BEAK (MAKE 2) Row 1 (WS) Dc in next 11 sts (the last dc is st, 2dc in final st. [28 sts] Using Indigo, make a magic loop. worked in same st as first st of Side Bump, turn. Round 10 2dc in next st, dc in next10 sts, 2dc Round 1 (RS) Ch1,3dc in loop. [3 sts] [11 sts] in next st, dc in next 4 sts, 2dc in next st, dc in Round 2 2dc in each st around. [6 sts] Row 2 (RS) Ch1,dc2tog first 2 sts, dc in in each next 10 sts, 2dc in next st. [32 sts] Fasten off. st to final 2 sts, dc2tog, turn. [9 sts] Rounds 11-12 As Round 9. [36 sts] TO MAKE UP Rows 3-5 As Row 2. [3 sts at end of Row 5] Round 13 Dc in each st around. Place the ends of the Rainbow into the opening Fasten off and weave in ends. Round 14 (Dc in next 4 sts, invdec) 6 times. of each Cloud. Rep Rows 1-5 on the last st of the Second Side [30 sts] Sew into place using a running stitch, topping Bump. Round 15 (Dc in next 3 sts, invdec) 6 times. up the stuffing as you join. Place a large coin in the base of each Cloud to [24 sts] Sew a Beak to each Bird, then sew the Birds on help it stand. Round 16 (Dc in next 2 sts, invdec) 6 times. the top of the Rainbow. Stuff the Cloud. [18 sts] BIRD (MAKE 2) Stuff the Bird. Using Pink, make a magic loop. Round 17 (Dc in next st, invdec) 6 times. [12 sts] Round 1 (RS) Ch1,6dc in the loop. [6 sts] Round 18 (Invdec) 6 times. [6 sts] Round 2 (RS) 2dc in each st around.[12 sts] Fasten off. Round 3 (Dc in next st, 2dc in next st) 6 times. [18 sts] Round 4 (Dc in next 2 sts, 2dc in next st) 6 times. [24 sts] Rounds 5-7 Dc in each st around. Round 8 2dc in next 2 sts, dc in next 6 sts, SIMPLE STEPS HOW TO INCREASE IN DOUBLE CROCHET 1Work a double crochet stitch 2Then work another dc, 3Continue the second dc 4Finish the second dc stitch as as usual: insert hook into st inserting hook intothesame stitch, working yrh and pull up usual, working yrh and pull indicated, yrh, pull uploop, stitch again. a loop ofyarn. yarn through 2 loops onhook. yrh, pull yarn through 2 loops Once you’ve finished, you’ll on your hook. see how 2dc stitches are worked into the same stitch. 74 WWW.GATHERED.HOW/SIMPLYCROCHET



Join foourragacnhganocfeTtroebbleefMeaatkuerresdahnedres,huasree oyuorurhathsohutagght#s Sacntdrmebalkeemsawkeitrh us, INN ! HQOUEOEKNSOF U L TA Living in Here comes the ITnasgWtatueghs’reva@emhsbaimseahneptndalygdacdo#romuScCbihrtlierenetgtbmalypeaopmguinaargknmedoranukeses. full colour Queen! Temeka Clarence, aka SUMMER LOOKS @tenealtextiles, Kirsty Sullivan, aka made Her Majesty @ladybirdkirsty, from issue 107 in adapted the ‘little a beautiful pink black dress’ from dress. Creating issue 118 into her this little doll own blue creation has inspired for Spring, and we Temeka to start absolutely love it! crocheting more. CHECK YES We think she did Who can resist a cute an amazing job panda project? We with this regal yet can’t, and neither can adorable make. Isabel Alexander, aka @adventures_in_ ftfGsitraheoeubiasmmpusaolmaosinsunwas. usWoWeeitlnecli1lh’ahrs1esoie9slns.roauT,ctaarogsekklrooiaesnfuha@gcrteofma’wulmldlaagpeeydemlneittmoi.babmeceygenl.jrglaliteescesahbk!mtmreaw,tetlaeoennaottdrhkposedruoinatjeelolwicfntg crochetland. Her creation looks very FIN-TASTIC FRIEND handsome, too! SQUARE EYES Becky Urry has dipped into our 2022 calendar Katy Noble, aka and made this gorgeous turtle from issue 117. @katys.crochet. This little guy is the amigurumi make for May, critters, hooked up but as Becky demonstrates, you don’t have to this granny square wait to hook up your favourite endangered hoodie from issue animal! We wonder if Becky will create some 120. It’s an impressive more animal buddies from our calendar. finish, and Katy did it so quickly! Well done. SLEEPING LIONS How adorable is this lovely lion rattle from issue 118? Emily Love, aka @emilycatherine studios, made this as a gift. We’re sure it’ll be well-loved in its new home. So sweet! THE LOWDOWN It’ssimpletobeinwithachanceofwinningagreathookyprizeinafutureissue!Showus wyour Simply Crochet makes on Facebook, Twitter, Instagram or via email by 9th May. Foralltermsandconditions,andmore information, visit www.gathered.how/simplycrochetcomps PcntatPnICnhhonrrooOsoieendttztMmteapwabresgPcraoemiicrcnmEztapeeteTanompeur[iIerlTrstsfrsmo]atIo[aO.adrsfbniT]ntNdpaeyhtdbrnreeetrReedyaeas-Uwf.ksnsolaTpiLe]yirrah.nnEoerobaenSnTnrianlehesweTisgirtlehbe[ycseisneiPatodlh]anisrnPttooipwiynnernwmrodegiofglmoscomatoterbthoeneneoleitdodvrsttersienwrwoicatrno,anniiisfctldntatoliah[Ofenlruuismleoput]asshdtureeywaerbdeMwtepiideplonioeilntrntdodsbohreerraiemiaaesnfnfne.srtoLtaphd7rEstirueem’niedpopdctdfranirteuito.aryerolTsvonssedthfirotndotescn(ttehfohasaPeitrntheslhrrnhieoodperItemcmurerdictolwteimdolaermositein.ensleecosTtendnrtrhtitieyrionfaeeoearftrd[nsamPetserb.chr]a]rGicoy.elvwtoymrTehIoprnnhmsdeourseaoattptoehenamtpmpCregcrrpoooaeerbroatnmmxiewigmrcodrthpolsinouu,ttat.mhndiFbnCtoaieoytoytncfhsy)mreseeiolu(tsbmipmocabIosmoebasuoomtiaitmbbikllitli.tpljtjiuoeIeeoytfatrccdnhnetttteisoehayttmoeitohctnnrehoaewutleirPiihslmmrpi.resnefriuEucvbiintlznlteaaeeettcewrre1hrywni0xc2esetaPt5i2sreotano7ihenrmfaln1eistrEoco5coenpaynet4ufgoeieb1(tnvlrpew5aeemtoern)dfowcnt.idottfha[whtf.nieTferneto.thdeicfammsiorlcsbaorttmymmps0ehird0leneaeoa,:dgtcmw0ooiiloa1dorronftasgfooetiatisrmrnnoeiehlg.ansa1eaTntdrd9itheyseoiareaAdiltrn.vo.epPecasTorsrnoslhoip.ul,ofumeoe2dtkwn.hP0ao/Tderpm2atoheyr2pwmaierv’rsugsioaspotneudhcmottyereioninno-rlcrspati1ro7siiemono1irsodlenj:ieeu5ndcarwr9yya,vay)psneeis.lomndsol[tcdfTnotcchoohsooutuenretuhrscrsnrbee1iheindteg7wygdn,hcMieaoototntdtofantnaiomrfysiteielichsardi2sanemiie0atdsiirsrp2eoeeeft2ainnendnbr.rcd.taebeBeiEldcteiynnohiaipbntegfenraygnstadcn,hetnosoetnetetlrrsaoeniwenrarmtccimgsis,otnsiutensrtonhsrdhgcaeeteeinrsaafs[Pprnpdutsoroedr]pomcodnpmwoumdlwnshyioeloediinttstdteiobchtirooiebeoOrFnryneraau,hesscvtrteleheaahorMrbeitervleioaneePtnpbodogsrtakloiretcratmyhtooauiLeirncontpiicmIhtrptnoeeioegansirlt,,nthtpearnhattredgslooetqtromatteauphgrbmoeroerooysfeti.frmrti]eeFoa[ba.rTnopmcy(htteaehwieseor)beesninpotlonpldoronodobrktbiarimezhnleooeegoedrcbtntcapIaoionutotrneuaosarnrrtnSmeriariendAdusgoqgEnbrotiuanintyptoimotoreenoternht.s.d]hauieTmtteOfpshooea,enpwranolltPyluyiyerlnrcsrotorsnrmoetotnmeosacserrigoehd[raeseu-teene]n,ontnrd@itaftfrfcmrsecyiodimsoroamewintfnyemhpditgmlseheeilhtfeedtbipraoidoietrUraniimeozntKpseente;,e.hh,ccariinniemoecnsch.sddauiolsotunekatr(odetyrbhwasydi)enfeiuiliptrgtsnwthheauotaiiircnhrtnftcespentesthoepwehpCreprrothsoo(iaowunsamnmn)lniidocno,anoenrtntnenei,hoeodlgtoefrnIha[syraa.sslrriaTdw]rfponahlcwrfeindeinisztrirgshctseet,heueh.oaim[efstfgcoBhlnmepsroyetdorspaeoepirn1ctnnmrihacz8igtzoeseeoeyhdsdrttieiaponaoaoatrrgnlerfboitss,eeevtoetrhonihfndsriotesetaeruohniytrprtlie.tvdsrfnBooitepedaorumrraem,oltwnkoehmoedxtieefnicooantipentthnntpsiueroedityrrcen(popoltss.iohurnk)Tmiseetzh–aerneaPoegsedrelwroP.oseexTsfrimealohbflmmutmoeynoltapfoPoteiyrhltlrtreeoe’ibisblsrnermdeeewgawmoups/toreitdsalapeueerFnrlldtcloadiisdoevcyfbnobeseeeyertebrewaaistosnnbchioglotaleekrm./e 76 WWW.GATHERED.HOW/SIMPLYCROCHET

@SIMPLYCROCHET DARLINGDRAGON COSY CROCHET OfWYphoETr1t,vo0r!0RsS Dragons are real – or crochet sYoocukcsa, snonwevee’rer haalwveaytosoexmciatendy to *cSCheroaosrcechhnefatoporpnSsyimtoouprrely ones are, anyway! Karen Yau sKeneigshotms,eaokane@’sbnlueewhippapiro.1H6e, idi couldn’t resist hooking this one sheoeoinkegdththeepsaetuteprnfoinr hisesruseel1f2a0ft.eHrer GoogAlveaPillaabyl,eZoinnioAapnpdleN, ook up over her half-term break using pstiynlkisahnadndblwuearamda. pTotaatsitoyntoloeoskasnd pink and yellow yarn. The colour aasfkufnofr?inMishay–bwe hHaetidmi cooreulcdomuldakyeou iPad is a trademark of Apple Inc., registered combination looks neat and we’re a matching blanket or cardigan! in the U.S. and other countries. App Store is a sure your students will love seeing tsreardveicmeamrkarokfoBfaArnpepsle&InNco.bNleO,OInKc.iNs aOrOegKisTtaebreledt this project when you bring it into JOINUSONLINE! isisaftorardneemwaurskeorsf Boanrannensu&alNsoubblsecrIinpct.io*nFsreoentlryi.al school. We think it’ll enjoy beCinagnccehlaartgaendy. Fproeienttrdiaulrninogt tahveaitlariballetooanvZoiindio. If you’re looking to socialise the adventure, too! twhiethnlmikaek-me sinudreedyocurojcohinetoeurrs, * gSCrotruepb–letmheakpelarsceFatocesbhoaorek T is fP\\_\\bPZURbùYVù[VùT.N.,.`X ppiactttuerrensroefcoyomumr menadkaetsi,ognest aabndouatdhvoicwe,manudchgyeonuerlaolvlyetalk 5\\ddUVQY\\R SWimithployvCerro5c.h7ektmmeamgabzeinrse,.it’s aofbfurisetnlidnlgycfreollcohwethfoooruksmtefrusl.l !T’NAC I L VA T/ LA I Wwiethloyookufoonrwtharedret!o chatting NINCITSSUIL YT S LIF/VT NI CTA Y TALK TO US! 1 Post a pic on our Facebook page 7 facebook.com/simplycrochetmag Tweet us @SimplyCrochet_ twitter.com/SimplyCrochet_ Add to our Finished Projects board ravelry.com/groups/simply-crochet Use the hashtag #SCtreblemaker instagram.com/simplycrochetmag Email us at: [email protected]

g a crochet ith Becky Skuse howdoi avoid darning in ends? Brush up on your technique with our simple guide… Colourful crochet projects are one of the great joys in life, but there’s It’s easiest to start using this method with double crochet stitches, a downside – the more you change colour, the more ends you have to when you’re using two colours to work stripes of two rows each. Once weave in! Luckily, there are a few simple ways to reduce this you’ve learned the technique, though, you can use it with longer somewhat tedious task, and I’ll be sharing one of them with you here. stitches, more rows and potentially more yarn colours. Being able to carry different colours of yarn up the side of your When carrying different colours of yarn up the side of fabric, it’s fabric is great if you like stripy patterns and inset mosaic crochet as not unusual for short strands of contrasting yarn colours to be visible. much as I do. Instead of fastening off and cutting the yarn every If you dislike the finished look, try to keep your yarn weaving on the two rows or so, you can weave the unused yarn colour into the wrong side of the fabric. Or, you can add a border to the fabric and stitches at the edge of the fabric while you work. work the stitches over the colour changes to hide them. Let’s hook… Howdo I get started? We’ll begin by changing colour at the end of the row… To practise making stripes and carrying yarns up the side, you need Step 2 Pull a loop of your second colour or Yarn B (I used blue) two yarn colours of the same weight. Using your first colour or Yarn A through the remaining 2 loops on the hook. This finishes the final (I used cream), work two rows of double crochet or any stitch you stitch and gives you a loop of the new yarn to work the next row. want. At the end of the second row, stop before the last stitch. Step 3 At the side or wrong side of the fabric, secure the tail end of Step 1 Start the last stitch, but stop before the final yrh. Yarn B (blue) with a half-knot to Yarn A (cream). 01 02 03 moc.sserpdrow.odemekamta ykceBtuobaeromtuodniF 78 WWW.GATHERED.HOW/SIMPLYCROCHET

a Howdo I start carrying yarns? It’s easy to carry colours up the side of the fabric… Once you have two rows of stitches, you’ll be last stitch of the second row. Step 11 Repeat Steps 3-7 to work more ready to practise carrying the unused yarn Step 7 Drop Yarn B (blue) to the back and two-row stripes. up the side of the fabric, weaving it into the pick up Yarn A (cream), which should Tip To use this technique with longer stitches stitches you’re working. positioned be at the front. Yrh in Yarn A like trebles, you need to weave the unused Step 4 To start with, we’re going to weave (cream) and pull through – this is now yarn up a longer turning chain: *bring the the unused Yarn A (cream) up the turning becomes the active colour. unused yarn over the active yarn towards chain – this can be easier to do if you work Step 8 Now weave in Yarn B (blue) up the you and work a chain (as in Steps 5-6), then the turning chain before you turn. So focus turning chain before you turn. To do this, take the unused yarn over the active yarn now on the two working yarns – bring Yarn A bring Yarn B (blue) over Yarn A (cream) away from you and work a chain; repeat from (cream) over Yarn B (blue) towards you. towards you. * until your t-ch is the right height. Step 5 Pick up Yarn B (blue) and work Step 9 Pick up Yarn A (cream) and work a chain. Yarn A (cream) should be encased a chain. Yarn B (blue) should be encased With longer stitches, you also need to inside the chain. inside the chain. neatly weave the unused yarn up the last Step 6 For dc, one chain is enough for the Step 10 Repeat Steps 3-6 swapping the yarn stitch of the second row. To do this, pause turning chain and you can turn and work the colours to work two rows in Yarn A (cream), the stitch after the first ‘yrh and pull up a next row of stitches in Yarn B (blue), and then then switch to Yarn B (blue) and weave in loop’. *Bring the unused yarn over the active a second row. Stop before the final yrh of the Yarn A (cream) up the side. yarn and continue the stitch; repeat from * at regular intervals as needed. 04 05 06 07 08 09 10 11 Let Becky solve your hooky conundrums! Dsohwfnooo’twlrlomkycswihhosaouasrptshtht…oietwcnIh’letloxt Crochet Unravelled aims to deep dive into the techniques, tutorials and terminology that will make you a better hookster. Have you got a question you want Becky to unravel? Send it in to us at [email protected] WWW.GATHERED.HOW/SIMPLYCROCHET 79

FLORAL EARRINGS AASSYY WEDIGKHT H5OMOMK YOU WILL NEED Q Any DK yarn in 2 colours Q A 5mm (US H/8) hook Q 2 wire drop earring findings TENSION Tension is not critical for this project MEASUREMENTS Earring measure approx 3.5cm (1in) in diameter ABBREVIATIONS For a full list, see page 90 Up to your ears Show o both your style and your favourite hobby with these cute ower earrings designed by Amy Overbury A perfect project for beginners, these Quickly hook up this pretty set of earrings Round 2 Ch1 (does not count as st earrings are made injust three rounds to instantlybrightenyourlook–andyour throughout), 2dc in each st around, ss to beg mood. Use any two colours you like! dc. [12 sts] 80 WWW.GATHERED.HOW/SIMPLYCROCHET Change to second colour. NOTES Round 3 Ch1, dc in first st, (2tr in next st, dc in next st) 5 times, 2tr in final st, ss to beg dc. Earring are worked in rounds throughout. Fasten off. TO MAKE UP EARRINGS Use the tail to sew the Earring to the finding. Weave in all ends. Using first colour, ch2. Round 1 (RS) 6dc in second ch from hook, ss to beg dc. [6 sts]

summceorlleFcatiironisle C grannyblanket * Contents subject to change stylishtwinset QueenaEmliigzuarbuemtihII quickhookbracelets kidsponcho tealightholders Cutesunkeyring Exclusive 10dsetsyilginssh bpaototkern

YARN REVIEWS New season yarnsSix yarns in yummy shades to get your hooks into this summer DC TRIANGLE MOTIF Make a magic loop. ROUND 1 Ch1, (dc, ch2, dc) 3 times, ss to beg dc, ss in next ch-2 sp. [6 sts, 3 ch-2 sps] ROUND 2 Ch1, *(dc, ch2, dc) into ch-2 sp, dc in next 2 dc; rep from * twice, ss to beg dc, ss in next ch-2 sp. [12 sts, 3 ch-2 sps] ROUND 3 Ch1, *(dc, ch2, dc) into ch-2 sp, dc in next 4 dc; rep from * twice, ss in beg dc. [18 sts, 3 ch-2 sps] FASTEN OFF and weave in ends. 01 02 03 04 _\\b7[bQ`ù`ù_VSdN\\\\_[_XT`bYZ]RR`\\__R`VgR 05 06 82 WWW.GATHERED.HOW/SIMPLYCROCHET

YARN REVIEWS Debbie Bliss Dulcie King Cole Cottonsmooth WEIGHT Chunky WEIGHT DK CONTENT 47% cotton, 01 CONTENT 100% cotton 02 47% acrylic, 6% nylon BALL 100g/200m BALL 50g/75m HOOK 4mm HOOK 7mm RRP £4.79 RRP £5.25 Debbie Bliss’ Dulcie yarn has adds to the softness, and its This new 100% cotton yarn from smooth and processed that they many amazing qualities, and we loosely braided structure makes King Cole certainly lives up to its lose some of their character, the think it’s going to be a big hit it incredibly lightweight. This name! It’s a mercerised cotton, Cottonsmooth yarn still has with chunky yarn fans. It’s yarn is great for chunky yet airy so it’s super-silky and smooth a minimal halo, meaning the a blend of cotton, acrylic and accessories for the summertime. with a lovely shine, but it still yarn feels super-soft to the nylon fibres, which have There are 13 light pastel shades retains some of the natural touch. The range features 10 been combined to create an to choose from in the range, and qualities in those lovely cotton gentle pastel colours and is incredibly soft yarn. The texture it’s hand wash only. fibres. Whereas some varieties machine washable at 40ºC. has an almost felted feeling that www.debbieblissonline.com of mercerised cotton can be so www.kingcole.com Rico Design creative cotton flecky Fleece West Yorkshire Spinners Elements WEIGHT DK WEIGHT DK CONTENT 75% cotton, 13% 03 CONTENT 60% Lyocell, 40% wool 04 polyacrylic, 12% wool BALL 50g/112m BALL 100g/250m features a spray print that gives HOOK 4mm HOOK 4mm you gorgeous flecks of colours RRP £3.95 RRP £8.50 throughout your work. There’s Rico Design have come up with also a single-coloured wool You’ll be in your element (sorry, too – it’s made from cellulose a new yarn that’s honestly quite fleece worked into the cotton we couldn’t resist!) when you fibres (wood pulp) and is unlike any cotton blend yarn thread, creating a natural woolly start hooking with this fab new harvested from sustainable we’ve tried before. From the feel and texture. There are six yarn from WYS. A gorgeous sources. These two fibres come moment you start crocheting shades, and it’s hand wash only. blend of Falkland wool and together to create a yarn that’s with it, it feels different and www.rico-design.de Tencel™ Lyocell fibre makes this breathable, gentle on skin and lightweight. The cotton, lightweight yarn extra soft and fully biodegradable. Available in polyacrylic and wool yarn is silky. The Tencel™ Lyocell used 10 shades and hand wash only. both soft and strong and in this yarn is very Earth-friendly, www.wyspinners.com Bernat Softee Cotton Rowan Kidsilk Haze Colour WEIGHT DK WEIGHT Lace CONTENT 60% cotton, 40% acrylic 05 CONTENT 70% mohair, 30% silk 06 BALL 120g/232m BALL 50g/420m HOOK 4mm HOOK 3.5mm RRP £6.99 RRP £19.95 We love this latest addition to lovely and soft with a gentle If you’re a fan of super-fluffy These 50g balls come with 420m the Bernat Softee range (which shine. It’s easy to care for, too, as fibres, then you’re going to love of yarn, which will go a long way is also available in a baby yarn it’s machine washable and can the Rowan Kidsilk yarns. Their if you’re using it in conjunction and chunky yarn). It’s got a even be tumble dried. There are new Kidsilk Haze Colour expands with another yarn (as it’s so fine, fabulous and fun springy twist 14 shades in a wide range of on their existing Kidsilk Haze it’s quite tricky to crochet with to it, which feels great to colours, including bright and range, but now has soft stripes by itself). The new range crochet with but also gives your neutral shades as well as a of colour that blend effortlessly. includes eight gorgeous shades stitches a squishy bounciness to couple of variegated ones. In addition, it has double the and is hand wash only. them. As the name suggests, it’s www.woolwarehouse.com weight and double the length! www.knitrowan.com WWW.GATHERED.HOW/SIMPLYCROCHET 83



Crochet essentials VI - SFcowrsrotewhcpahwnpedi.tcgy-tfauvoirtderhe-teobusrteeoagrdniiad.nlhssn,oteevwiprss-i/tby- sOtvitecrhtehseannedxttefcehwnipqaugeesst,hyaotuy’lol u’nlldussiemepvleersytetipm-beyy-ostueppigckuiudpesathoomokany useful THryOthLeDseImNeGthoTdHs aEndHseOe OwhKich works best EHveOnLteDnsIiNonGresTuHltsEinYeAveRn sNtitches PENCIL METHOD KNIFE METHOD METHOD ONE METHOD TWO Hold the hook like a pencil, in Hold the hook between your Pass the ball end of the yarn Loop the ball end of the yarn your right hand (if you’re thumb and forefinger, about between the little finger and loosely around the little finger right-handed), about 3-5cm 3-5cmfrom the hooked end, third fingers of your left hand of your left hand, then take it from the hooked end. If your resting the end ofthehook (if you are right-handed), then over the third finger, behind hook has a flat area, you’ll find it against your palm. This will behind the third and middle the middle finger and over comfortable to hold it here. give you lots of control. fingers, over your index finger. your index finger. MAKING A SLIPKNOT Thefirstlooponthehook 1Hold the tail of theball of 2 Hold theloop betweenleft 3 Catchtheball end ofthe 4 Pullboth ends oftheyarn to yarn in your lefthand and thumb and forefinger, then yarn with the hook and pull it tighten the knot, then pull just drape the yarn clockwise over insert the crochet hook back through the centre of the the ball end totighten the the top ofit to formaloose, through the centre of theloop loop, taking the yarn through loop so it’sclose to thehook, circular loop. from front to back. with it. but not touching it. CHAIN STITCH Usethisstitchtomakeyourfoundationchain How to count chains 1 98765432 1 Hold the hook in your right 2 Pullthehooktowardsthe 3 Thisiswhatyourrowof Each chain or loop counts as hand, and both the yarn end slipknot, catching the yarn in chains will look like. Hold the one stitch. Never count your and the working yarn in your the hook, and pulling it through chain with your left hand near first slipknot or the loop on left hand. Move the hook under the slipknot loop. This forms the hook, to keep the tension. the hook (called the working and over the yarn to wrap it your first chain (ch) stitch. Keep going until you have the loop). So that you can be around anticlockwise. Repeat steps 1 and 2 to form number of chains that’s stated accurate, make sure the a chain length. in your pattern. chain is not twisted and that the front is facing you. WWW.GATHERED.HOW/SIMPLYCROCHET 85

YOUR GUIDE TShLisIPstitSchThITasCnHo h(esigsh)t – often used to join rounds FWollOowRtKheIsNeGsimIpNleRruOlesWtoSconstruct crochet fabric 1The slip stitch is used tojoin 2 Pulltheyarn through the 1The first row ismade by 2 Forthe next row, first make a length of chain into the chain stitch (as shown) and working across the the turning chain for the stitch round. Insert thehook from then the loop already on the foundation chain from right to you’re about towork(see front to back into thefirst hook to make aslip stitch. You left. At the end of thechain or opposite). Nowworkthenext chain you worked. Wrap yarn can also work this stitch into row,turntheworkso that the stitch into the topof the round the hook (yrh)in an each stitch along a rowto yarn is behind the hook. stitches on your first row, anticlockwise direction. form a neatedging. missing the first stitch. ODnOe oUf tBheLkEeyCsRtitOchCesHinEcrToc(hdect,)dUouSblteesramre s:imsipnleg, cleomcpraocct shtietcthes that form a dense fabric 1Tomakea double crochet 2 Wind theyarnaround the 3 Pulltheyarn through the 4Yarn round hook again, then stitch, insert thehook under hook (yrh). stitch, giving you 2loops on pull the yarn through both the top 2loops of the next your crochet hook. loops. There’s yourdouble stitch on the previous row. crochet made and you’ll have one loop left on the hook, ready to dothenext stitch. AHhAanLdFy sTtiRtcEhBthLatE’s bCeRtwOeeCnHdoEuTbl(ehatnrd)tUrebSletecrromche: thinaslifzed, aonudbit lloeocksrsolicghhtelytlooser than double crochet 1Tomakea half treble crochet 2 Insert thehook under the 3 Pulltheyarn through the 4Yarn round hook again, pull stitch, work towhere you top 2loops of thenext stitch stitch only (3 loops on hook). the yarn through all 3loops. want the htr and then wind in theprevious row.Wrap yarn You’ve made ahalf treble the yarn round the hook (yrh). around the hook again (yrh). crochet. Continue working htr into nextand following sts to the end oftherow. 86 WWW.GATHERED.HOW/SIMPLYCROCHET

YOUR GUIDE OTnReEoBf tLheEmCoRstOpoCpuHlaEr Tstit(cthr)esUinScrtoecrhmet,:thdisosuimbplleesctitrcohcishtweitce as high as a double crochet stitch 1Toworka treble crochet, 2 Wraptheyarnaround the 3You will nowhave 3 loops on 4You will nowhave 2 loops start by winding yrh and then hook (yrh) andpull theyarn the hook. Yrhagain, anddraw on the hook.Yrhagain and insert the hook under the top through the stitch only. the yarn through just the first draw the yarn through the 2 loops of thestitch onthe 2 loops on thehook. remaining loops on the previous row. hook. Your treble crochet is complete. UDSOtUeBrmLE: tTreRbElBeLcEroCcRhOeCt HET (dtr) UTRSItPeLrEmT:RdEoBuLbEleCtRreObCleHcErToc(thter)t This isastitch regularly used Yrhandpulltheyarn through This is one ofthelongest 2 loops only. Repeat from † as anelongated version of the 2 loops only (2 loops on hook). standard crochet stitches and is 3 times more andyourtriple treble (described above). It’s 4 Yrh andpulltheyarn through mainly used in fancy stitch treble will be finished. Repeat worked inavery similar way to the remaining 2 loops. Repeat patterns. It’s taller than a double from * tomake more ttr sts. the treble, as follows: from * tomake more dtr sts. treble crochet stitch (described 4Tomakethenext row, turn 1 Make afoundation chain. Skip 5Tomakethenext rowof dtr, left) andis worked inavery work and ch5.Thisturning chain 4ch, *yrh twice,andinsert the turn work and ch4. This turning similar way,as follows: counts as the first triple treble in hook under the top loop ofthe chain counts as the first dtr in 1 Make afoundation ch. Skip a newrow. Skip first st atbase of next ch. a newrow. Skip first st atthe 5 ch,*yrh 3 times, insert hook the t-ch. Work 1 triple treble, 2 Yrh, pull the yarn through the base of the t-ch, work1dtr under under top loop ofnext ch. inserting hook under the top ch loop only(4 loops on hook). the top 2loops of the second 2 Yrh, pull yarn through ch loop 2 loops of thesecond st inthe 3 Yrh andpulltheyarn through stitch in the previous row; only (5 loops on hook). previous row; continue to the 2 loops only (3 loops on hook). continue to theend of the row. 3†Yrh, draw loop through end of therow. FToUr aRnNevIeNn GfiniCshH, sAtarItNea(cth-crohw)with a turning chain How to count stitches In crochet, you needtoadd table below tells youhowmany Check your work is correct turning chains (t-chs)tothe t-chstsformthe first stitch. beginning of rows. Thereason *For dc, usually the turning chain Being able to count 123456 7 for this istobring the hookup to does not countasastitch, and your stitches isvery 1 2 3 456 7 8 9 the height of the stitches you’re the first stitch of the rowis important andhelps crocheting. Each basic stitch has worked into the stitchatthebase youtoensure that its own numberof chains. The of the turning chain. you’re following a pattern correctly. STITCH Afcsothdauadrnitnitdnobagteirfooonwre sfrSaootskauwifrpnitr(dascotoatfstuitno) tns ft(Fcciuhororsarnutininsntt)gs as It’sa goodideato Double crochet 1 ch 1 ch* 1 ch* count your stitches at Half treble 1 ch 2 ch 2 ch the endofeveryrow. Treble 2 ch 3 ch 3 ch To count short Double treble 3 ch 4 ch 4 ch stitches such as Triple treble 4 ch 5 ch 5 ch double crochet, look at theplaited tops (see above right). For taller stitches,count the upright ‘stems’ – each ‘stem’ is counted asastitch (see right). WWW.GATHERED.HOW/SIMPLYCROCHET 87

CHreOatWe stTripOesCanHdAotNheGr cEolCouOr eLffOecUtsR YOUR GUIDE SINhaCpiRngEsAtitSchINesGareAviNtaDl forDmEaCkinRgEgAarSmIeNntGs 1Before you work thefinal 2 Pullthrough aloop ofthe INCREASEToincrease one DECREASE Fora quick yrh (yarn round hook) on the new yarn tofinish the old stitch is verysimple – work decrease, just skip one stitch. last stitch ofarowin the old stitch. The working loop will one stitch into the nextstitch For aneater look, work the colour, drop theoldyarn and be inthenewcolour. on therow below. When first part ofonestitch and then pick up thenew one Continue, keeping theold you’ve finished, workanother then begin the next stitch. with your hook. yarn at thewrong side. stitch into the same stitch. Finish both together. YSoEuWcanINjoGin cSroEcAheMt seSams by using a tapestry needle or a crochet hook, using one of these four methods 1Sewing with atapestry 2 To slip stitch a seam, place 3 Fora dcseam, place the 4 Auseful variation on the dc needle is the regular and neat the crochet pieces right sides crochet pieces right sides seam, the dc andchainseam is way tojoinseams. Placetwo together. *Insert hook into together,or wrong sides used when less bulk and/or pieces of crochet right sides both edge stitches, yrh and together fora visible seam. greater flexibilityis needed. together and oversew them as pull through to complete 1 slip Work as for slip stitch seam, Work 1 double crochet and shown above, using a tapestry stitch; rep from * working into using double crochet instead 1 chain alternately. or yarn needle. the next edge stitches, of slip stitch. keeping work fairly loose. How to check your tension Make and measure a swatch to check your tension Most crochet patterns state thetension required, in rowsandstitches of aspecific type. Make a swatch atleast15cm square and check that your tension matches. Place a ruler across the swatch and insert twopins, 10cm apart. Then place theruler along a column of stitches and insert twopins 10cm apart. Count thestitches and rowsbetween the pins –if you have less than the pattern, your tension is too loose so youneed touse a smaller hook, but if youhave too many, use alarger hook. It’susually better to match the stitches than rows, because you can always work more orfewer rows. 88 WWW.GATHERED.HOW/SIMPLYCROCHET

YOUR GUIDE CFrOeaUteNa fDouAndTaItOionNriRngINforGworking in the round TWomOaRkeKcIirNcleGs,tSuTbeITsaCnHdoEthSerINshTapOesA RING 1Make a chain thelength 2 …andpullyarnthrough 1Make a foundation ring and 2 Finish the treble, as usual stated in the pattern 2 loops onhook. Nowyou’re work thet-ch (3ch for treble (yrh, pull yarn through ring, instructions. Next, insert the ready to start crocheting in sts).Workatreble st asusual, yrh, pull yarn through first crochet hook into the first the round, following the but insert hook intocentre of 2 loops, yrh, pull yarn through chain. Close the ring with instructions given right. ring. For treble sts, yrh, insert 2 loops). Work more sts into a slipstitch, working yrh… hook into ring. the ring asneeded. AMnAaltGerInCatLivOe foOuPndation ring for working in the round Wyaorrnking Tail end 2 Now insert your hook into the 3 Make a t-ch for the sts you 4 Once you’ve worked the first loop, from front to back. Wrap want to work (above, we made round of stitches, pull the tail 1 To start a magic loop, don’t the working yarn around the 1t-chfordc).Work your sts end of yarn to draw up the ring. make a slipknot. Instead, make hook and pull the yarn through into the magic loop, over both Work a slip stitch to join the last a loop with the yarn, leaving the loop. the loop and the tail end(so, and firstststofinishthe first atailaround10cmlong. Make 2 yarn strands). round (as instructed in the sure the tail end isunder the guide below). working yarn. FJiOnisIhNoIfNf eGachRrOouUndNofDcrSochet stitches nice and neatly by using a slip stitch oRrouspnidrsals 1Toclose around of stitches, 2 Then place theyarn round 3You’veslip stitched the yCohuecnkewedhitcohutseechnique moc.imatuoballa.www ,uaL einahpetS© work aslip stitch intothetop the hook. Pull the yarn round together! Before of the turning chain. Todo through the turning chain working another round, be Some patterns are worked this, insert thehook intothe stitch and through the sure tomaketherequired in rounds thatarejoined top stitch of theturning chain. original stitch on your hook. turning chain. Always work together at theendof rounds on the right side, each round (see left). unless your pattern instructs Other patternsare worked you otherwise. in aspiral, so youdon’t need to jointherounds at the end, just keep going, working into thenext stitch on theprevious row. Amigurumi toys areoften worked in aspiral like this. WWW.GATHERED.HOW/SIMPLYCROCHET 89

YOUR GUIDE Abbreviations Crochet hook conversions across to end of the row meas measures UK METRIC US approx approximate(ly) patt(s) pattern(s) beg beginning pm place marker 14 2mm – bl insert hook under prev previous BP back loop only qtr quadruple treble 13 2.25mm B/1 Back Post: rem remain(s)/remaining 12 2.5mm – ch(s) work st indicated, rep repeat ch-sp(s) inserting hook around RH right hand – 2.75mm C/2 ch- post of st from back to rnd(s) round(s) cl(s) front to back and not RS right side 11 3mm – cont in top of st sk skip dc chain/chain stitch(es) sp(s) space(s) 10 3.25mm D/3 dc2tog chain space(s) ss slip stitch refers to ch made st(s) stitch(es) 9 3.5mm E/4 dec previously, eg. ch-3 t-ch(s) turning chain(s) dtr clusters tog together – 3.75mm F/5 dtr2tog continue tr treble crochet fdc double crochet tr cl (yrh, insert hook in sp/ 8 4mm G/6 ftr (insert hook in next st, fl yrh & draw a loop st, yrh & pull up loop, 7 4.5mm 7 foll/folls through) twice, yrh & yrh & draw through 6 5mm H/8 FP draw through all 2 loops) number of 3 loops on hook times indicated, yrh & 5 5.5mm I/9 htr decrease draw through all loops htr2tog double treble crochet on hook 4 6mm J/10 in next work 2dtr together tr2tog (yrh, insert hook in inc foundation dc next st, yrh & pull up 3 6.5mm K/10 LH foundation tr loop, yrh a& draw lp(s) insert hook under through 2 loops) 2 7mm – front loop only twice, yrh & draw following/follows through all loops on 0 8mm L/11 Front Post: As BP, hook inserting hook around ttr triple treble crochet 00 9mm M/13 post from front to WS wrong side back to front yrh yarn round hook 000 10mm N/15 half treble * work instructions work 2htr together immediately foll *, Which hook do I use? sts to be worked into then rep as many the same stitch more times as directed Hook size UK yarn weight increase () work all instructions in 2.5-3.5mm hook 4ply yarn left hand the brackets as many 3.5-4.5mm hook loop(s) times as directed 5-6mm hook double knitting yarn 7mm and bigger aran yarn chunky yarn fTHaosOpterWnevtehTnetOeynodGusroEhfaTfrcdaArwePofurEkllyRu,nfForaEllvoCewlTliinnggFooINunrcIeiSnysHotruu’cvteiofinnsisbheeldowcrocheting, UK/US conversions ch ss Completethefinal stitch, then UK US sc cut the yarnabout15cm from hdc the work. Pull itthrough the chain ch chain dc last loop on the hook and pull slip stitch ss slip stitch tr to close theloop. Thread the double crochet dc single crochet dtr yarn tail onto atapestry needle half treble htr half double and weave into theback ofthe treble tr double work. Most crochet items don’t double treble dtr treble need a lotof blocking, but triple treble ttr double treble cotton lace work usually does. Todo this, carefully pin out the item with rust-proof pins, mist with a waterspray and leave to dry naturally. 90 WWW.GATHERED.HOW/SIMPLYCROCHET

MWpnyoOce ! You can buy a digitaledition of Simply Crochet, ready to read wheneveryouwant. Singleissues andsubscriptions areavailable andevery issueyoupurchaseis stored in your magazine library permanently. Onceyour magazine has downloaded, an internet connection is not required so you cantakeyourmagazinewith you, wherever you go. To buywywouwr.dgiagtihtaelrecodp.hyoowf/Sdiimgiptalyl-iCsrsoucehset visit iPad is a trademark of Apple Inc., registered in the U.S. and other countries. App Store is a service mark of Apple Inc. NOOK is a registered trademark of Barnes & Noble, Inc. NOOKTablet is a trademark of Barnes & Noble, Inc

Charts &CHARDTSiagrams Fobllloanwktehte, rsuecckhsaacrtkscwahmepnemrvaakninmgotthife, lgulgogbaegceutsahgio, lna,cme taopppaonudchtu, lGipoicnugshSioounth Globe cushion, page 21 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 70 65 60 55 50 45 40 35 30 25 20 15 10 5 92 WWW.GATHERED.HOW/SIMPLYCROCHET Key Gypsum Citronelle Leaf

CHARTS Map pouch, page 21 25 23 26 21 24 19 22 17 20 15 18 13 16 11 14 9 12 7 10 5 Key 8 3 Deep Sea 6 1 Citronelle 4 2 40 35 30 25 20 15 10 5 Going South blanket part 3,page 22 35 33 36 31 34 29 32 27 30 25 28 23 26 21 24 19 22 17 20 15 18 13 16 11 14 9 Key 12 7 2tr 10 5 let block 8 6 146 140 130 120 110 100 90 80 70 60 50 40 30 20 10 WWW.GATHERED.HOW/SIMPLYCROCHET 93

CHARTS Going South blanket part 2, page 22 82 83 80 78 81 76 74 79 72 70 77 68 66 75 64 62 73 60 58 71 56 54 69 52 50 67 48 46 65 63 61 59 57 55 53 51 Key 49 2tr 47 let block 146 140 130 120 110 100 90 80 70 60 50 40 30 20 10 Going South blanket part 1, page 22 127 126 125 124 122 123 120 118 121 116 114 119 112 110 117 108 106 115 104 102 113 100 98 111 96 94 109 92 90 107 146 140 130 120 110 100 90 80 70 60 50 40 30 20 10 105 103 101 99 97 95 Key 93 2tr 91 let block 94 WWW.GATHERED.HOW/SIMPLYCROCHET

CHARTS Rucksack motif,page 23 Key Luggage tag, page 25 15 Coral 13 21197111615318414350261 Citronelle 16 11 16 10 5 Gypsum 14 9 12 7 10 5 Key 8 3 Deep Sea 6 1 Citronelle 4 2 28 25 20 15 10 5 Lace top,page 45 Front Back Key Fold line Hexagon Half hexagon WWW.GATHERED.HOW/SIMPLYCROCHET 95

CHARTS Tulip cushion, page 69 Key 121 115 110 105 100 95 90 85 80 75 70 65 Apple Opal Hot Pink Orange tr2d 96 WWW.GATHERED.HOW/SIMPLYCROCHET

CHARTS 60 55 50 45 40 35 30 25 20 15 10 5 121212917253331323931484848484757575757566666666665757575757484888484842468133313131222221068860422436089072541698705234169870523416987052341698705234169870531975319753142 WWW.GATHERED.HOW/SIMPLYCROCHET 97

FAVE FOLLOW it Six reasons to follow Libby Forsyth of beatnikthreadz and explore her funky – and often froggy – makes TFoiklTloowk:e@rsc:r1o9c.h9ketbylib FInosltloagwrearms::3@,7b5e7atnikthreadz IFYOULIKE...bold,brightcolours. IFYOUWANNA... makethesefun IFYOULOVE... 1970sstyle.We’re Libbylovestocreate“funproductsthat projectsforyourself!Libbytellsher gettingmajorgroovyvibes fromthis promoteself-expression”andherfeed is followersthatanyonecancrochetand brown, green and yellow Quad Heart fullofextra-saturatedshades.#bebold lovesitwhenpeople useherpatterns. GrannySquarevest. #70scrochet IFYOUNEED... moreslowfashionin IFYOUARE... lookingtooutsourceyour IFYOUHAVE... anobsessionwith yourlife.Libbyisamajorproponentof crochet.NotonlydoesLibbycreate frogs. These sweet amphibians pop up makinggarmentsthatare“carefullyand patternsforherpieces,shesellsfinished timeandtimeagaininLibby’sdesigns. mindfullycreated”.#sustainablestitches clothesandaccessories,too.#madeforyou We can’tblameher–they’retoocute! It’s all over... TrenAdiNngAtThiOsmMonYthonInstagram @wee.yarns @thecrochetcarpenter @naashx.the.artista @knotmonster @choniescrochet TTrrnh!S 98 WWW.GATHERED.HOW/SIMPLYCROCHET

RoyalGuard saCCtorvooamccihklpeaitlsebitmdlefineronfBrmitgoamVrmayluyipedoaC-uAthrtupenlrrkoinylca2l022 01756 703 670 kingcole.com [email protected]


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook