Important Announcement
PubHTML5 Scheduled Server Maintenance on (GMT) Sunday, June 26th, 2:00 am - 8:00 am.
PubHTML5 site will be inoperative during the times indicated!

Home Explore Women's View Magazine, April 2020

Women's View Magazine, April 2020

Published by Up & Coming Weekly, 2020-03-26 08:54:33

Description: Women's View Magazine, April 2020

Search

Read the Text Version

VOLUME 14 | ISSUE 4 APRIL | 2020 Inspiring, educating, empowering and celebrating women in our community MAGAZINE Back to Nature More inside: Sourcing Sustainability Hiking for Health and Happiness DIY organic cleaners


RTeogdiasyte! r & Inspiring • Educating • Empowering & Celebrating Local Women since 2008 Mary Kate BurkeKeynote Speaker New Artistic Director | Cape Fear Regional Theatre Location SCHEDULE OF EVENTS: 10:00 am–12:00 noon..............Shopportunity Expo & Wine Tasting open 12:00 noon–2:00 pm................Luncheon, Keynote Speaker, Prizes and More 2:00–2:30 pm...............................Shopportunity Expo & Wine Tasting continues Catering Provided by Two Brothers, of The Vine TICKETS: $4500 (includes the Shopportunity Expo and 1 Luncheon ticket) VENDORS: $8000-$9000 • Sponsorships Available - Call 910.484.6200 Join us for the with Proceeds support the Kidsville News Exclusive Wine Bar & Literacy and Education Foundation. Thursday For more information: 910.484.6200 Shopportunity Tasting! May 14 Call with Expo any questions: 910-484-6200 WWW.FAYETTEVILLELADIESPOWERLUNCH.COM • #FLPL NUWBNS PICTURE OF HEALTH Rodney Sherrill Stephanie K. Frink, PbyoesSghahnDatwelysniegnse & Thermography, LLC Realtor Natural Haircare Chi Chi Okoroafor DREAM BOONE TRAIL VACATIONS VENDORS INCLUDE: at Hope Mills Paparazzi Jewelry Mary Kay Cosmetics MAGAZINE For more details on our REGISTER TODAY ONLINE! 2020 events, check out WWW.FAYETTEVILLELADIESPOWERLUNCH.COM • #FLPL 2 | APRIL 2020


Inside April 6 BUZZWORTHY HONEY 20 ROOTED IN COMMUNITY Local honey is all the rage. Learn all about the art of If you enjoy gardening, the garden clubs of Fayetteville offer fun beekeeping and a local company that sells honey of its own. and educational opportunities to connect with people who enjoy the hobby. 8 HUMAN NATURE 22 CLEAN GREEN Popular personality tests like Myers-Briggs and the Enneagram test encourage healthy introspection and Do you know what your cleaning supplies are hiding? You can insights into how we interact with each other. rest assured that your house is clean and safe when you know the ingredients of the products you’re using. 15 ENVIROTHON 28 EGGCITING EGGS Learn about the environmental competition that involves 53 high school and middle school teams across North Carolina, Try food blogger Hannah Willoughby's eggcellent deviled egg including ones from Fayetteville. recipes for this Easter or anytime. 16 OUTDOOR ADVENTURES 28 AUTISM AWARENESS MONTH With the weather warming up, now is the perfect time to do Alena Barosa sheds light on and celebrates the uniqueness of some exploring outside. Read our roundup to learn about people on the autism spectrum. great trails and hiking spots in the area. 29 PAGE TURNERS 19 SPOTLIGHT ON AMBER WILLIAMS Tune into local librarian Alison Shirley’s suggestions for new The Lake Rim Park ranger and superintendent shares about reads to be booked through spring. her job with writer Prudence Mainor. 2020 APRIL | 3


Close Letter from the Editor VOLUME 14 ISSUE 4 PUBLISHER Bill Bowman, F & B Publications [email protected] With the start of spring and ASSOCIATE PUBLISHER daylight saving time comes another good beginning, Stephanie Crider Women View Magazine’s Back to Nature [email protected] issue. Fayetteville and the Cape Fear region are awash each April with nature- EDITOR friendly opportunities and the entities that support and promote our outdoor Crissy Neville world. WWM, published by Bill Bowman, [email protected] winner of the 2017 ATHENA Leadership Award for local excellence in women’s ASSISTANT EDITOR empowerment efforts, recognizes this because, well, celebrating, investing Jenna Shackelford in and caring for the environment, to [email protected] women, just comes naturally. ART DIRECTOR Case in Point: The Cumberland County Soil and Water Conservation District's Elizabeth Baker youth Envirothon competition. Leader [email protected] Donna Foster champions teaching students and advisors about the OPERATIONS DIRECTOR environment and their connection to it. This month she shares with WVM Paulette Naylor about the competition. At Sustainable [email protected] Sandhills, Executive Director Jonelle Kimbrough creates partnerships MARKETING REPRESENTATIVE to help sustain resources for future generations, writing this month about Linda McAlister local sustainability-focused companies [email protected] who also work to this end. Cape Fear Botanical Garden’s Amy Stidham Friends of the environment : Our WVM editor, a certified North Carolina MARKETING COORDINATOR FOR WOMEN'S provides individuals of all abilities a certified Environmental Educator, poses with PWC’s Willie Waterdrop. VIEW AND FAYETTEVILLE LADIES meaningful and impactful way to POWER LUNCH connect to the natural world through the therapeutic horticulture program challenges women to get social with Caroline Schafer she directs. nature by joining or starting a local [email protected] Beyond the goals of education and garden club. Outdoor enthusiast Becky DISTRIBUTION DIRECTOR/ preservation is another all-important Rose offers hiking how-to and where- SALES ADMINISTRATOR aspect of nature — how to enjoy it. Co- to information for the beautiful spring owner Gwen Bell of Bell’s Seed Store, days ahead. And after exercising up Laurel Handforth a mecca for Fayetteville gardeners, [email protected] an appetite, recipes highlighting the APRIL healthy goodness and versatility of one CONTRIBUTORS of nature’s most perfect foods — the egg — is served up for you, dear readers, Mindy Love by food blogger Hannah Willoughby, Amy Stidham just in time for Easter. Julie Lee-Jacobs Jonelle Kimbrough Hal Broadfoot Donna Foster Read about human nature, the birds Becky Rose and the bees and Lake Rim Park Ranger Jenna Shackelford Supervisor Amber Williams, naturalist Prudence Mainor extraordinaire, to further whet your Gwen Bell Allison Davis whistle this April. Drink up! Crissy Neville Beth Lee Hannah Willoughby Alena Barosa Allison Shirley CORRECTION WOMEN’S VIEW MAGAZINE 208 ROWAN ST. FAYETTEVILLE, NC, 28301 The Fayetteville Republican Women's Club meets the second Tuesday evening of each month at Pierro's Italian Bistro at 5780 Ramsey St. #3466. Please note PHONE: 910-484-6200 this change. FAX: 910-484-9218 Are you interested in writing? Consider contributing an article or pitching a story idea Women’s View Magazine is for, by and about to WVM. We want to elevate your voice. For more information, email [email protected] women in Cumberland County. Published by F&B upandcomingweekly.com. Be sure to like us and leave comments on our Facebook page! Publications in conjunction with Media Marketing Management. ©2020 by F&B Publications, Inc. All rights reserved. Reproduction or use of editorial or advertisement without permission is strictly prohibited. Various vector sources credited to © Freepik and © Vecteezy. 4 | APRIL 2020


Fayetteville’s APRIL Vegan Fest EVENTS will host a Vegan Chili Cookoff April 3 at Prima Elements Holistic THE HEALTH OF Wellness Center from 6-9 p.m. Call MEMBERS IN 910-483-8406 for details. OUR COMMUNITY IS IMPORTANT. “Musical Folktales” DUE TO THE at Fayetteville SPREAD OF THE Symphony CORONAVIRUS, Orchestra’s AS A PRECAUTION, The Fayetteville Symphony SOME EVENTS Orchestra’s “Musical Folktales” will MAY CHANGE. be at Huff Concert Hall at Methodist PLEASE CALL University April 4. To get tickets and TO CONFIRM learn more, visit EVENTS. www.fayettevillesymphony.org/ or call 910-433-4690. Ribbon Walk for Cancer at Festival Park Dog Day in the Garden A fundraiser for the Cape Fear Valley April 4 is Dog Day in the Garden at Cape Fear Botanical Garden from Health Foundation, the Ribbon Walk 11 a.m.-5 p.m. With the purchase of a ticket, a variety of activities for for Cancer at Festival Park opens you and your furry friend awaits you. The event benefits the Fayetteville Animal Protection Society. For details, visit www.capefearbg.org/ April 18 at 8:45 a.m. The walk is or call 910-486-0221. from 9 a.m.-noon. For details, visit Dogwood Festival www.cfvfoundation.orgribbonwalk/ or call 910-615-4483. The award-winning Dogwood Festival, attended by 295,000 people in 2019, is returning once again this year April 23. The street fair will have Kings Empring food for sale, vendors, live music and so much more. For details, visit www.thedogwoodfestival.com/ or call 910-323-1934. It’s a bird … It’s a plane … It’s Fayetteville Comic Con, hosted at Sinbad at FSU the Crown Expo Center from April 25-26. Visit April 26, Sinbad will https://fayettevillecomiccon.com/ be at Fayetteville State to learn more or purchase tickets. University as part of the Seabrook Performance The Autism Society Series. 7 p.m. To buy of North Carolina tickets and learn more, visit www.uncfsu.edu/ The Autism Society of North or call 910-672-1724. Carolina, Fayetteville chapter, will host an Autism Awareness Fair April 18 from 10 a.m.-2 p.m., featuring food, bounce houses, vendors and more. For details, call Jennifer Hinson at 910-864-2769, ext. 1211. Gallery 208 On April 7, Gallery 208 will open a new exhibit, “Where the Winds Never Stop: The Hildreth Project.” For details, call 910-484-6200. “The Curious Incident of the Dog in the Night-Time” at CFRT Don’t miss “The Curious Incident of the Dog in the Night-Time” at Cape Fear Regional Theatre. The audience will enjoy a creative show that celebrates individuality. April 9-26. For details and tickets, visit http://www.cfrt.org/ or call 910-323-4233. 2020 APRIL | 5


THE ART OF BEEKEEPING By Mindy Love Centuries ago, humans discovered that bees produced a Worker bees make a queen by feeding a normal worker golden elixir called honey. So important was honey that larva a substance called royal jelly. This process allows a ancient Egyptians took it with them into the afterlife. larva to develop differently from the regular worker bees Archeologists found jars of honey in the tombs of the in the hive, producing a queen. kings and queens of Egypt. The queen bee is the only one to lay eggs, which are Philosopher Aristotle wrote about observations of bees. tended by the worker bees. Busy worker bees are He noted how they divided labor, tended their young and responsible for foraging for food, tending the eggs and reproduced. Bees buzzed their way into art and literature. larvae and producing honey: essentially every task in the hive except for producing young. Drones, on the other The ancient Greeks considered beekeeping agricultural hand, are good for one thing only: mating with a queen on art. Today, people often refer to the art of beekeeping, her mating flight. but keeping bees is not a traditional art form. Rather, the practice is heavily grounded in science. Beekeepers Each year, Dr. Harold Newman, a former military doctor, must know the ins-and-outs of bee science, plants and retired surgeon and missionary doctor, teaches a class agriculture and understand the environment, yet display a called \"Talkin' Bees with Harold Newman\" as a featured certain artistic ability when tending hives. guest at Bell's Seed Store. A beekeeper since the young age of 12, Newman is enthusiastically spreading the joy The art of beekeeping lies in being able to read and listen of bees and hobby of beekeeping. Attendees learn about to the bees in the hive. Beekeepers must then successfully keeping bees and helpful hints for producing honey right marry this art with science to manage their hives. at home. Modern apiculture is important for pollination of crops for Several other resources for potential beekeepers are also food and medicine and bee products such as beeswax available. In North Carolina, local Agricultural Extension and bee venom. Love coffee? Thank a bee. offices host beekeeping classes. The North Carolina Beekeepers Association at www.ncbeekeepers.org is a About 20,000 species of bees inhabit the world, and only wonderful resource for all things bee, including a map about seven are honeybees. Honeybees are social bees with local beekeepers. Local honey lovers rejoice — that live in a colony of thousands of individuals. Hives Cumberland, Harnett, Hoke and Moore counties have consist of only one queen bee with thousands of female numerous beekeepers, and local honey is sold at farmers' worker bees and male drones. markets across the area. Mindy Love is a full-time environmental program manager with the U.S. Army Reserve Command and creator of the blog Sweet Tea and Pasta. She’s lived in North Carolina for more than 20 years and started her blog to share her Southern experiences with others. 6 | APRIL 2020


Look no further.F9RBroau2odys0dneH:ent9Bhtayaeke1rasovwDyvii0hgudiianelA-fShmlrslpu4yereLgst,RShr,Gaot8.atSiAsIuIeNlsniMbr0lNoIoNUnD.rraCNcuR-metnyrtGuYGltoY1oLitoidGh2Doenm0slLeOwnllo8tLuTgIc1ow,EigsnbVOfi30,EaOvAthpgesOh1nLewKgye4eeAODmoRdIearAyNctseDunloOCRioktDrildGtgoaVEEfiKusuotVslwolDAEao!nIorEFapNwrNvMnnInaOyNeetGiT.nhdnhtRTfrwhUeehgsablUtwewimfivRoioTSuzotkReihpaOHInyytriFaNbOWhnyroiAUntEOGedsofuS,ughGUDIodor,usSwIU,R’D,sevONLSmtrVmPhYeiielmEnOGlNEaoyealKlbRrLaoDeNWgoLoosobEmerOvFNOsaEEnkevTeuuheaEOtsiknOeiUnTyPhaorewnRDMiKoltu!dRwEdEWhtogcaEAIfCnoArsOisioCuNNyAanksLi,sRafteLkLtU.r-iDrGTohnsDuAlnIiuE,eMblEnoNSrVeIgrhFATIn5kuOtgmeDr’,EuGOhrm5,olsItfBoeNaNsOoIG5eeLRwmrftoTacrLcwtTAurNEy!hbSikaarOulaEUntDeohIeeieAhnSncNsnnuReYsageDmatdiBHgGrOnuoytsnenRhiLLogIytUmlaoldPkooid,EfEiauoEfwDSotfiwn.Auaed!trlaloAyfLigorrsMDrfuIyayoseO,Rsnmltpt.I.oLhshuuSIgVfOMGabwviaoNeSAenIarriOuewtrKNwImmUenilvDuGsoaLNotltDRdeiIathGYsuftOeYnNliwGyehlotCIonTacwrkLygoVOAobG.gniavLaGEgOosEtiuShOsnDeedwfhnK,EnuDIU’oevNFsaLRVDmdIacmynrYeNnOyAOGslEoeCoeRlkbiAoLatdotGNgRlDuLEoOsEhferiuOvDsrotaElwTDeVeeAKaiuo!OTtrFaVznlUhrEnonMIpIanHOKaEyNolRNvWtnhorid.htINnREheedOfGiohNiATwkeeInsrlasTkeUD,i-iDGUwmOTivhgzniUthnSepaVOHRhigNFIakWgRr’,iEOOWmEedsiEFfOnNoILrRUsOrD,grOUtTAu,!hSSh,ROUnDNSIeaNnRWYsEgiGOnu It’s what I do. GET TO A BETTER STATE™. CALL ME TODAY. BEEHIVE YOURSELF State Farm Mutual Automobile Insurance Company, State Farm Indemnity Company, State Farm Fire and Casualty Company, Case in point: Rodney and Rebekah Medley of Beehive Yourself in Fayetteville. After Rodney State Farm General Insurance Company, Bloomington, IL retired from the military, the Medleys wanted to live a healthier and more sustainable lifestyle. The 1101201 journey into bees started unexpectedly several years ago while at the Festival for the Eno in Durham. A 2020 APRIL | 7 beekeeper at one of the festival booths put a buzz in Rodney's ear by asking if he ever thought about having a hive. It was the beginning of great things for the Medleys. A few years and 22 hives later, Rodney and Rebekah have transformed a hobby into a flourishing business. The Medleys not only produce and sell honey, but they are also passionate about educating the public. In an effort to increase the number of bees in the area, the couple created the Host-a-Hive Program. The program affords individuals interested in bees but who are either afraid to own them or lack time or space for a hive, an alternative way to get involved. Host-a-Hive features three ways to host a hive: Free Bees, Rent Bees and the Bees-iness. Each plan features different benefits along with hive hosting. The Medleys manage all the hives in the initiative. Find Beehive Yourself honey products at the Fayetteville Marketplace, the Dirtbag Ales farmers market, the Festival for the Eno and the Fair Game Distillery in Pittsboro, North Carolina. Or, check out other local beekeepers, honey products or even the practice itself to see what the buzz is all about.


HUMAN NATURE Does Type Matter? By Julie Lee-Jacobs, Psy.D. Interest in personality typing Broad interest exists in how the subject of empirical study, with continues to grow in our culture, personality type influences academic communities hosting as we have ready access to relationship choices and experiences. workshops to teach the wisdom resources about self-awareness and Relationships require attention of the Enneagram. On a smaller the psychodynamics that influence and investment to grow, and scale, interested individuals gather human behavior. Understanding empirical data concerning factors in groups and learn together about personal behavior patterns, emotional that improve relationship quality their personality types. In Fayetteville, style and learned tendencies and satisfaction is available. Can WinterBloom Tea hosted two socials are valuable to the extent that knowing one’s personality type help last year for fans of another famous the knowledge is used for self- in making choices for a partner or personality type indicator, the Myers acceptance and positive change. spouse? Or help improve partner and Briggs. Most remember that test Knowing personality type has little family relationships? We know that from freshman year psychology. purpose unless this knowledge leads personality types complement one to openness for personal growth, another, but the greater learning is An Enneagram is, literally, a nine-side and subsequently, to growth within to understand how your personality figure (ennea is the Greek derivative relationships and community. traits impact your communication, for “nine”), and each side represents a your “blind spots” in relationships and possible personality type — Reformer, Ironically, knowing oneself leads to your awareness of what you hope for Helper, Achiever, Individualist, a greater awareness of what one and expect in others. In other words, Investigator, Loyalist, Enthusiast, doesn’t know for sure. For example, knowing yourself enhances your Challenger and Peacemaker. Of consider the woman who identifies as authentic presence in relationships. course, most of us have traits from being ambitious and admirable. Most each of the types but score more would agree that these are positive If this work of greater self- heavily in one or several of these qualities. But perhaps this self- understanding is a process you feel categories, as is the norm. knowledge leads her to consider how inspired to tackle, perhaps consider ambitions compromise time for rest, tools for determining your personality Are you intrigued? The Enneagram self-reflection and the importance of type. An online search for personality Institute offers an affordable slowing down to nurture relationships tests yields results that can be more online test to help determine your in her life. Knowing oneself with confusing than helpful. The five-item Enneagram personality type at greater clarity comes with the personality quiz promises to help www.enneagraminstitute.com, opportunity to seek transformation, you determine just the right type of producing a report that includes or long-term, meaningful growth. partner for you ― an unlikely reality. your type, strengths, opportunities Transformation is lonely work to But reliable resources are available, for growth, relationship tendencies tackle on your own. The difficult work and some reflect centuries of and even famous people with similar of transformation occurs almost wisdom and decades of research. The types. If you’re interested in the completely within a relationship. Enneagram is such an example. spiritual dimensions of this model, We are wired for relationships and consider theologian Richard Rohr’s need companions on the journey of While interest in the Enneagram has writings about Enneagrams. And greater self-understanding. These increased in modern times, the model most importantly, because knowing companions may be colleagues or of Enneagram personality typing oneself more is not for the faint of friends traveling the same path, has roots as far back as the second heart, be encouraged to engage in spiritual directors, therapists, faith or century, influenced by spirituality, conversations about your Enneagram even online communities. philosophy and psychology. In type with a trusted other or trusted modern times, the Enneagram is community. Julie Lee-Jacobs is a licensed clinical psychologist serving military families on Ft. Bragg. She volunteers with the Child Advocacy Center and serves currently on the board of directors. 8 | APRIL 2020


9 The Enneagram www.enneagraminstitute.com 8 1 7 2 63 Saturday, April 4, 2020 11am-5pm 54 536 N. Eastern Blvd. Fayetteville, NC SELF-AWARENESS capefearbg.org 910.486.0221 REFLECTION Wag your tail and roll over for a barking good Considering questions that require time at CFBG Dog Day in the Garden. Meet self-reflection is a great starting adoptable dogs from FAPS. Enter your pup point for exploring aspects of in the dog pageant with local celebrity judges. personality. Spend some time with Enjoy demonstrations, shop with vendors, these questions, and if you feel comfortable, discuss your responses take a seat and sip at our with someone you trust. If you want Barks & Brews Beer Garden and much more! to learn more about your personality type, consider taking the Riso- Free to Garden Members Hudson Enneagram Type Indicator Non-Members daily Garden Admission at tests.enneagraminstitute.com/. FREE to all Dogs 1. What kinds of dreams and goals do you have? And why are these Thank You to our Sponsors: dreams or goals important? Riverbark Veterinary Hospital, Webb Carpet Company, 2. What is keeping you from these A&G Residential, Bed & Biscuits Boarding, Inc., dreams or goals? First Citizen’s Bank, Highland Animal Hospital, Blessed Oasis Pet Resort, Carolina Pet Care Services Inc., 3. Rank 5-10 of the most important Five Star Entertainment, and The Grand Dames things in your life related to career, family, relationships and 2020 APRIL | 9 love, money, spirituality, etc. 4. Has your personality changed since childhood? 5. Is your personality like either of your parents’? 6. Do you make decisions logically or intuitively? 7. What qualities do you most admire in yourself? 8. Of all the relationships you have had, describe one of the best moments you can recall in a relationship. 9. Describe a devastating moment in terms of relationships. 10. Who would you call if you only had a few minutes to live? What would you say? How are you investing in that relationship now?


VHeotpseinGtrhoewGs awridtehn By Amy Stidham blood pressure, reduce anxiety, increase socialization, stimulate You say your thumb’s not green senses and improve physical and your houseplants want and cognitive ability, as well a transfer? You wish you had as build coping skills. Plants something to pick besides contribute to our health, have weeds, but don’t know what great resilience and handle to grow? Wouldn’t you like to environmental challenges with harvest healthy food and get adaptability. Working with re-energized right in your own plants at the Garden shows us backyard? Check out Cape Fear ways to cope with struggles, Botanical Garden’s Therapeutic renews our energy and provides Horticulture programs, where rejuvenating benefits in a military service members, safe, refreshing, positive and veterans and their families can cooperative environment. find inner peace and develop new skills to create a garden that Enjoy indoor and outdoor gives back. therapeutic activities at the Garden that are in sync with For the last six years, CFBG your goals. Take forest walks on has connected our military trails near the Cape Fear River community to nature with and have fun with challenges unique programs that explore like nature treasure hunts and the healing benefits of teambuilding. Create, maintain gardening through relaxation, and harvest a garden of your restoration and empowerment. own, from soil foundations Classes are adapted to individual to restful landscapes. Plant needs and goals based on your vegetables, herbs and flowers, abilities. So, whether you’ve been try healthy snack recipes, create injured, are stressed, anxious or nature art or quietly reflect depressed or you’d just like to around the fire pit or pond. And connect with others, you can you’ll find plenty of plants and benefit from therapeutic classes samples to take home. designed specifically to cope with challenges of military and Hands-on therapeutic post-military life. horticulture classes at CFBG encourage interaction with Research has shown that we classmates to share ideas and are innately drawn to nature, challenges. Volunteers are as it rebuilds our strength trained to create a one-on- and focus. Service members, one experience, and many veterans and their families have military connections and who need to cope with the seasoned gardening experience. challenges of military life, We will make accommodations including deployments, moves, with notetaking, journaling, transitions, post-traumatic stress, adjusting pacing, planting injuries or illness, have found height and tool function. healing benefits from these Activities are easily replicated specialized classes. Therapeutic horticulture helps to lower Amy Stidham is the therapeutic horticulture program manager at Cape Fear Botanical Garden. A retired Navy veteran and certified Cumberland County Extension Master Gardener® Volunteer, she is a certified North Carolina environmental educator and landscape design consultant with National Garden Clubs, Inc. 10 | A P R I L 2 0 2 0


Connecting service Join Us members, veterans and their 2020 Gallery Events families to nature through April 7 therapeutic horticulture June 23 October 6 at home, and resources are provided to enhance your enjoyment of the garden and the great outdoors. You can share military experiences, make new friends and even give back to the community. You’ll discover plenty of healthy, active and restorative time for you to build new skills, communicate with others and enrich your ability to gain control and grow hope for the future. CFBG’s therapeutic horticulture program proudly partners with Wounded Warrior Project in Fayetteville and USO of North Carolina’s Warrior and Family Programs. We connect to Veterans Affairs of Fayetteville, local veteran centers, Community Patriot Arts Connection and The Arts Council of Fayetteville via its Creative Arts and Military Outreach programs. We receive generous support from the North Carolina Cooperative Extension and Fayetteville Technical Community College’s Horticulture Technology department. We are grateful to many individual donors, Cumberland County Extension Master Gardener Volunteer Association and HomeInstead for making this program possible. To sign up for classes or to become a volunteer, please contact Amy Stidham at [email protected] To learn more about our program or to donate, visit us at www.capefearbg.org. To learn more about Horticulture Therapy, visit www.ahta.org. 2 0 2 0 A P R I L | 11


The Three Rs Aren’t Just for School Anymore REDUCE, REUSE and RECYCLE Debut in Business, Too! by Jonelle Kimbrough The Sandhills area of North Carolina is home to several environmentally conscious artisans. Shop these and other sustainable, small businesses to support natural resources and the local economy. BDAZZLE JEWELRY BY GARDEN ARTWORKS KYMIA REUSABLES KRISTEN ROBINSON Artist Scott Dooley transforms When Jessica Haddock was a Designer and proud military coffee pots, teacups and other new mother, she searched for ways spouse Kristen Robinson is a aluminum, copper, brass and silver to save money and reduce waste. third-generation jewelry artist goods into stunning sculptures, So, she turned to cloth diapers who inherited her craft from her bird feeders, planters and arbors and other sustainable materials. grandmother-in-law and mother- for the garden. Dooley repurposes Eventually, her lifestyle evolved in-law. She creates eclectic and about 40% of the materials in his into a business with a mission to distinctive necklaces, pendants, award-winning work. share affordable, environmentally bracelets and even “scarf curls” conscious products with the like- from repurposed and recycled Garden ArtWorks designs are minded masses. materials of all kinds. available at artisan markets throughout the Sandhills. Based in Raeford and named Kristen sells her wares at artisan Find them on Facebook @ for Haddock’s daughters, KyMia markets and events across the gardenartworksusa. offers a variety of reusable goods, region. Peruse her talents on including “unpaper” towels, Facebook @krobinsonbdazzle. “unsponges,” diapers, coffee filters, produce bags and toothbrushes. VINTAGE WAX CANDLES Visit KyMia at artisan markets Unique fragrances, soy waxes and around the area or shop online at kymiareusables.com. KyMia is also repurposed, antique glassware come on Facebook @shopkymia and together in the elegant and eco-friendly Instagram @kymia_reusables. line of Vintage Wax Candles by Maria McDonald. Maria carefully curates every scent and bestows clever monikers such as Fabulous, Transcendent and Royalty for a special dose of whimsy. When she isn’t attending classes at Fayetteville State University, Maria sells her unique candles at artisan markets and events around the Sandhills. See what she is pouring on Facebook and Instagram @ vintagewaxcandles. Jonelle Kimbrough is the executive director of Sustainable Sandhills, a nonprofit organization creating resilient environmental, economic and social resources for current and future generations in the Sandhills of North Carolina. She worked in the Department of Defense sustainability programs for 10 years before joining Sustainable Sandhills in 2019. 12 | A P R I L 2 0 2 0


REBORN CLOTHING CO. REDOUX HOME VINTAGE THE SUDSY NUN SOAP Emily Neville has a solution to Redoux Home Vintage is in the COMPANY our society’s textile waste woes: heart of downtown Sanford, where With an homage to her maiden Reborn Clothing Co. A Cumberland resourceful merchants are integral name and her Catholic school County native, Emily learned to to one of central North Carolina’s roots, Ann Nunweiler Dowless sew at the age of 10 at Loving most rapidly growing cities. launched The Sudsy Nun Soap Stitches Quilt Shop in Fayetteville Owner Kim Hall and several Company in the small Bladen and developed her business when consignors rescue furniture, lamps County town of Dublin in 2018. she was a sophomore at North and other homewares destined Dowless crafts her soaps by Carolina State University. for the trash and turn them into hand, using mostly natural and one-of-a-kind showpieces with biodegradable ingredients such as Now, her team transforms painting, salt washing and other honey, essential oils and goat milk. abandoned clothes and textiles innovative refinishing techniques. She has a line of vegan soaps, too. into an array of upcycled goods for individuals and businesses, At Redoux, shoppers can also Offerings vary with the seasons including partners such as North discover a treasure trove of and include delectable aromas Carolina State University, East candles, jewelry and other goods such as Pumpkin Spice, Muscadine Carolina University, Sunbrella crafted by local artisans. Be sure to Wine, Spearmint Eucalyptus, Pink and many other universities and scratch the shop cats, Sophie and Cashmere and Outdoorsy, which companies. Her company motto is, Momo, on your visit. Shop Redoux Dowless describes as “the scent of “Your clothing has a story. We help Home Vintage at 200 S. Steele a clean man.” you tell it..\" Street in Sanford. The Sudsy Nun Soap Company Shop bags, earrings, laptop is on Facebook and Instagram @ accessories and more at thesudsynun and online at https://rebornclothing.co/. Join thesudsynunsoapcompany.com. Facebook and Instagram threads Ann often attends artisans’ @rebornclothing.co. markets in the region, too. UPCYCLE CANDLE COMPANY Entrepreneurs Heidi and Dominic Peterson turned a passion for recycling into a bright idea. According to Heidi, Upcycle Candle Company emerged from Dominic’s desire to do something else with all their glass ― other than dropping it at the dump or local landfill. The Petersons clean, cut and polish used glass, such as wine bottles, into vessels for scented soy candles. Even their wicks are upcycled, crafted with cherry wood drops from Dominic’s father’s cabinet shop. Aromas such as Apple Harvest, Blueberry Cheesecake, Cabernet Sauvignon and Fresh Coffee are sure to entice any candle lover. Unusual blends such as The Scholar, an amalgam of old books and pipe tobacco, and Enchantment, a floral fusion of gardenia, tuberose, vanilla and musk, are also favorites. Upcycle Candle Company products are available online at upcyclecandlecompany. com and artisan markets throughout the Sandhills. Find them on Facebook and Instagram @upcyclecandlecompany. 2 0 2 0 A P R I L | 13


The Early Bird Catches the Worm Rise and shine to greet our feathered friends this spring By Hal Broadfoot Billions of birds are headed this way. It has predators are sleeping. At first light, migrants happened every spring for millennia in North start looking for a suitable patch of woods to drop Carolina, and it’s happening again — right on into for the day. They’ll spend the morning eating schedule. Northbound migration started in voraciously to slake their thirst and to replenish the late February, and by the time it ends in July, some protein and fat they burned for fuel. species will already be heading south again. Have you ever seen this spectacle? As the day warms up, the migrants slow down. Some keep moving north at a slower pace. Some stop and The birds follow geographic features as they move rest, sleeping the balance of the day. When nightfall north and south: coastlines, mountain ranges, the comes, if a bird feels rested, hydrated and well-fed, fall line. And, since Cumberland County doesn’t it will take off again and fly north all night, repeating have any of these things, they largely go around this pattern day after day until it gets back to, or at us, passing by to the east and west. It’s not easy to least near, where it was born. be a birder in this land between flyways, but with persistence and a little luck, you can find quite a few The best place to look during those early morning good birds in and around Fayetteville. hours is in deciduous trees, like gums, oaks or maples. Around here ― in The Land of Longleaf Pine One family of sought-after birds is the warbler. On ― big tracts of hardwoods are difficult to come by. the Eastern Seaboard, this subset of neotropical The wooded margins surrounding lakes, streams, migrants incorporates 40-something small, brightly rivers and swamps offer us the most of these colored species, any one of which is stunningly warbler-friendly trees. Parks and cemeteries are also beautiful, especially in its spring plumage. Birders often planted with deciduous hardwoods, so they regularly find about 20 of these species in the can be great places to look for warblers, too. So, get Sandhills and Coastal Plain, albeit in smaller up early and go outside and greet our visitors. You'll numbers compared with those that fly north along be glad you did. the coast or through the mountains. While a few species overwinter here, including pine and yellow- rumped warblers, most members of this family either arrive here or pass through in late April on their way north to nest. Warblers are meat-eaters, preying on tiny caterpillars, spiders and insects. This dietary need is perhaps the primary reason warblers from as far north as the boreal forests of Canada make their way south in the fall through North Carolina and continue to fly as far south as South America for the winter. Less food is available here than there during our cooler months. But the food supply in North America makes a dramatic comeback in the spring. Countless caterpillars emerge to eat tender leaves and blossoms sprouting on deciduous trees. Spiders hatch in unimaginable numbers, as do hordes of crawling, flying and swimming insects of every type and kind. Nature sets out a smorgasbord just in time for the waves of warblers and other types of birds flying north to their breeding grounds. One of the best ways to find warblers in this area is to get outside early. Songbirds migrate at night when it is cooler and less windy and most of their Hal Broadfoot is a native of Fayetteville. He practices law in town and in his spare time draws, paints, writes and studies birds and local history. 14 | A P R I L 2 0 2 0


WOMAN’S AMBER WILLIAMS Her career comes naturally by Prudence Mainor SPOTLIGHT Birds sing backup for every minute of our lives Williams oversees the daily operations of the that we spend outdoors. Like most background park office, in addition to patrolling the park. She music, we often take birdsong for granted. In plans programs and leads outdoor adventure 1962, Rachel Carson wrote a book called “Silent trips such as kayaking, rafting and hiking. One of Spring,” warning about the unregulated use of the more popular adventures Williams guides is pesticides and detailing just what to expect once the State Park Hiking Challenge, which provides these chemicals proliferated in nature. As the title opportunities to visit each North Carolina state suggests, birds loomed large in that story. Birds park on hikes that range from easy to arduous. Also also loom large in the life of Amber Williams, city popular are William’s kayak lessons and guided of Fayetteville park ranger supervisor at Lake Rim kayak paddles, with Lake Rim Park providing boats Park. An avid birder since her youth, Williams and gear at a nominal cost to participants. Her participates in the twice-yearly Audubon bird guided whitewater rafting adventures offer thrilling counts. The data gleaned from these migratory challenges amid spectacular scenery. For more season counts only corroborate Carson’s warning. information, or to sign up for any of these programs, visit the parks and rec website at www.fcpr.us. “Many species of birds are in decline,” Williams said. “Readers can help them out by creating a Lake Rim Park has a full schedule for all ages bird-friendly yard.\" The Audubon Society has tips and seasons, including educator and group at www.audubon.org/native-plants. services, programs and amenities for individuals and families, after school activities, preschool With a singular determination, Williams programs, outdoor recreation, special events and turned her passion for life outdoors into a family-oriented weekend and evening nature career that benefits all participants in the programming. Swimming is available in season at Fayetteville-Cumberland Parks and Recreation the newly opened pool, and Lake Rim Park holds Department programs. annual summer camp sessions. “My love for nature started as a kid playing in For readers interested in learning more about the woods and running around on my family’s birding, Williams advised, “Get outside. Go on small farm,” Williams said. “I started out wanting guided bird walks, watch the birds in your yard to be a veterinarian, so I went to North Carolina or visit a park and sit and listen to nature. There State University and earned a Bachelor of Science are tons of field guides available. The Sibley and in animal science. After working at an animal Peterson guides are always good choices. The hospital, I decided not to become a vet, so I ended online sites such as www.audubon.org/, www. up working in a lab at Research Triangle Park until ncbirdingtrail.org/ and www.allaboutbirds. I realized that being stuck inside all day without org/ and phone apps like iBird, Merlin Bird ID and windows wasn’t for me. I went back to college and Audubon Bird Guide.” earned a degree in biology with a focus on marine life. Afterward, I volunteered at the North Carolina Learning to identify birds and the many songs Aquarium at Fort Fisher, and that is where I first they sing can be a solitary pursuit or fun for the caught the environmental education bug. After whole family. Protecting their habitat ensures that a short internship with The Audubon Society, I our grandchildren won’t ever have to face a silent started my career as a park ranger for FCPR.” spring. Thankfully, naturalists like Williams are here to assist with both. As park ranger supervisor at Lake Rim Park, Prudence Mainor is a longtime advocate of the environment and sustainable communtities. She lives in, works in, shops in and tirelessly promotes Fayetteville and Cumberland County. 2 0 2 0 A P R I L | 15


“A walk in nature walks the soul back home.”— MARY DAVIS By Becky Rose possible or take a screenshot on transportation will be waiting when your phone. If hiking solo, make you finish. Hiking is good for your soul. sure someone knows your route and Getting outside is good for expected return time. Most experts Walkers, bikers, runners and your physical and emotional recommend hiking with a buddy for rollerbladers use the CFRT, so take well-being, and it doesn’t safety purposes. caution as even the wide 10-foot have to take a lot of time or money. path can get congested. The path The low-cost activity is enjoyable for Armed with these basics, you next ranges from flat to hilly and includes young and old and ranges from a few need to find a place to get started. a boardwalk through marsh and steps around a local park to tackling Two places offer the most hiking wetlands and a covered bridge. the Appalachian Trail. In Cumberland opportunities in this region: Cape Glimpses of the Cape Fear River and County and North Carolina, a plethora Fear River Trail and Carvers Creek waterfalls peek through the wooded of recreational opportunities are State Park. terrain at many points. available. With over 40 local and state parks, North Carolina also counts the Cape Fear River Trail Amenities include interpretive signs most popular national park in the explaining wildlife and plant life; country in our western section and The trail is open 365 days, 8 a.m. to portable toilets, benches and tables; a over 95 miles of the Appalachian Trail. dusk. Free parking is available at both water station; security call boxes along the northern and southern terminals the trail and security officers on patrol. The list of equipment needed for at Jordan Soccer Complex, 445 Tree Trail rules permit dogs kept on leashes. hiking can range from the simple Top Dr., and Clark Park Nature Center, to the complicated. For day hikers 631 Sherman Dr., respectively. Near the southern end of the trail, contemplating moderate hikes, Clark Park Nature Center offers comfortable walking or hiking shoes, The asphalt trail winds along for educational displays and ranger- possibly a backpack and plenty of nearly 5.3 miles following the path guided walks. Contact the Center for water are necessities. Plan to dress of the Cape Fear River. Be aware the specific hours and programs or visit in layers, and consider tucking a trail is not a loop. Plan only to go out https://fcpr.us/parks-trails/parks/ disposable rain poncho in with your as far as you can walk back. If you are clark-park for more details. gear in case of unexpected showers. hiking with others, and plan to walk Always remember the ultimate the entire trail, plan ahead and try to Carvers Creek State Park hiker’s rule, “pack it in, pack it out” to park on car at the end of the trail so keep the parks beautiful and clean. Carvers Creek State Park has two access points in Cumberland Before hiking, always consult a map — carry a printed version if 16 | A P R I L 2 0 2 0


fVaisrittothgeseet poluatcdeos oneras.r and County and is open daily, except once roads during the peak of Long CARVERS CREEK STATE PARK, for Christmas, from 8 a.m. to dusk. Valley Farm in the 1950s. Both trails 910-436-4681; https://www.ncparks.gov/ Check posted hours before heading are level and flat. carvers-creek-state-park/home out. Free parking is available at both locations, the Long Valley The Sandhills access totals just over FAYETTEVILLE AREA PARKS AND Farm access at 2505 Long Valley Rd. 10 miles, composed of seven trails RECREATION There are more than 70 in Spring Lake and the Sandhills on sandy soil. Horses, hikers and parks and recreation facilities and trails in access at 995 McCloskey Rd. in bikers use the Sandhills access, Cumberland County, with amenities that north Fayetteville. adhering to the rule of “wheels yield range from green spaces, playground to hooves and heels.” Hikers yield equipment, dog parks, picnic and Opened in 2005, the Long Valley to horseback riders while bicyclists recreation areas and water features. For a Farm access includes the historic yield to both hikers and horseback complete list, go to https://fcpr.us/. retreat of James Stillman Rockefeller. riders, so all share the trail. Due to flood damage in 2016, limited NORTH CAROLINA PARKS AND activities exist at present. Rangers Well-marked hiking trails are open at RECREATION The state parks system lead regular interpretive programs Sandhills, with varying lengths and includes 34 parks, four recreation areas and special events. At Long Valley, features. These include the 1.4-mile and three staffed state natural areas. North hikers will find two trails, the 2-mile Wire Grass Loop Trail, the 1.7-mile Carolina has parks along the coast and James S. Rockefeller Loop Trail and Turkey Oak Loop Trail, the 1.5-mile the mountains in addition to the Sandhill the Cypress Point Loop Trail, which RCW Loop Trail, the 4-mile one-way gems. For a complete list, visit is three-quarters of a mile and Long Leaf Pine Trail, the 0.6-mile https://www.ncparks.gov/. branches off to the north. Both trails Dead End Spur Trail, the 1.10 Fox are for hiking and bicycling only. Squirrel Loop Trail and the 0.10 Little NATIONAL PARKS SERVICE The National Pond Spur Trail. At present, there Park Service encompasses 419 national From the Cypress Point Loop Trail, are no toilets or water facilities. This park sites in the United States, with 14 you can look toward the dam and area is known for its great birding located in North Carolina. Learn more at see the pavilion, a former sawmill opportunities, including sightings of https://www.nps.gov/index.htm and in the 1800s, and the grist mill, the red-cockaded woodpecker. https://www.nps.gov/carto/app/#!/parks/ which played a vital role in utilizing state/nc. waterpower in the 1900s. In total, Happy hiking with the words of there are just under 3 miles of trail, naturalist John Muir in mind: “Of all APPALACHIAN TRAIL There are 95.7 all offering an easy walk on sand the paths you take in life, make sure miles of the A.T. in North Carolina, but and gravel. These two trails were a few of them are dirt.” the Trail runs along the Tennessee/North Carolina border for 224.7 additional miles. Read details at https://appalachiantrail. org/home/explore-the-trail/explore-by- state/north-carolina. Becky Vohoska Rose is a Nebraska native who has called North Carolina home since 1987. Becky is married with two daughters and employed by Gill Security. 2 0 2 0 A P R I L | 17


Excellence in Education with the Envirothon Competition The Cumberland Soil & Water By Donna Foster Educators and those associated Conservation District is one with the Envirothon program can of 96 districts across North Sponsors and volunteers are key attend the Envirothon School Carolina that utilize every to this successful event. Last year, July 20-24, 2020. This is a great technical, financial and educational approximately 70 people came opportunity to participate in resource available to administer out and helped with the Area VII specialized training for Envirothon programs designed to encourage Envirothon at Jones Lake State Park team advisers and for teachers to individual responsibility to conserve, in Bladen County. earn continuing education or North improve and sustain our soil Carolina Environmental Education and water resources for future The Envirothon helps develop Certification credit. Please generations to come. environmentally aware citizens information call the Cumberland that can assume future leadership SWCD office at 910-484-8479 One of the educational programs roles. Emphasizing teamwork and option 3. sponsored by the Cumberland comprehensive thinking skills such SWCD in partnership with the as analysis and interpretation, Cumberland SWCD is proud of the North Carolina Association of Soil subjects studied for the Envirothon past teams from Cape Fear, Grays & Water Conservation District is competition include aquatic Creek and Pine Forest high schools the Envirothon competition. Other ecology, soil and land use, forestry, and those from Mac Williams, Gray's partners are Smithfield Foods, Farm wildlife and current environmental Creek and 71st Classical middle Bureau, Cape Fear Farm Credit issues, and more. schools. These teams have placed and many other local sponsors. in first through third place at the See the study materials and resources at http://www.ncagr.gov/ SWC/educational/envirothon.html. Donna Foster is a native of Fayetteville and the administrative program officer and education coordinator at the Cumberland Soil & Water Conservation District office in Fayetteville. 18 | A P R I L 2 0 2 0


Area VII Envirothon and gone onto New York, Massachusetts and state competition in prior years. Maine. The NCASWCD formed Last year, 71st Classical Middle a NC Envirothon committee to School placed first at the Area VII develop and run the program Competition and placed second at on behalf of the NCASWCD. The the state competition. first North Carolina Envirothon was held in 1991 with five teams The 2020 Area VII Envirothon participating. Today, over with teams from Bladen, 290 teams from across North Columbus, Cumberland, Harnett, Carolina participate in the State Hoke, Richmond, Robeson, Envirothon every year. For almost Sampson and Scotland counties 30 years, the Envirothon across was held March 19 at Jones Lake North Carolina has provided State Park in Bladen County. quality education, enrichment About 375 students and advisers opportunities and leadership skills and 80 volunteers participated in in natural resources, ecology and this fun, hands-on, natural science environmental education. academic competition. Of the 53 teams attending, the top seven for The National Conservation middle and high schools qualify Foundation Envirothon hosted to attend state competition. last year by North Carolina The top seven middle and high Envirothon at North Carolina school teams attend the state State University in Raleigh was competition in April. The top held the last of July and first of high school team at the state August. There were 53 teams competition will compete at the from across the United States, national competition in Nebraska China and Canada. The North this year. Carolina team from Davidson County came in second place in The North Carolina Association this national competition. The of Soil & Water Conservation 2020 NCF Envirothon will be Districts decided in 1990 to July 26-Aug. 1 at the University of participate in Envirothon with Nebraska in Lincoln, Nebraska. the states of Pennsylvania, Ohio, 2 0 2 0 A P R I L | 19


HEADING TO THE CLUB The Garden Club Igrew up hearing about the garden By Gwen Bell of garden club activity.\" These goals club. Our home and yard were speak of the GCNC's commitments. always full of flowering plants, shrubs Street for the annual tour of homes and lovely flower arrangements, and and working to award Blue Star The Garden Club of North Carolina I loved it. As a young girl, I would hear Highways. The Garden Club Council assists with the Daniel Boone Native my mother and grandmother talk of Fayetteville was active for many Garden, the Elizabethan Garden, the about going to the garden club. My years and helped to coordinate the Martha Franck Fragrance Garden, grandmother, Mildred Poole, was clubs and activities. the North Carolina Botanical Garden the first president of the Cross Creek and the North Carolina Arboretum Garden Club. As for me, I caught the Some of the garden clubs in and works to help maintain the state gardening bug as a junior gardening Fayetteville are members of The wildflower program. club member in middle school and Garden Club of North Carolina, a have been hooked ever since. I'm still federated association. The federation Being involved in a garden club has garden clubbing today. has 265 clubs and 6,500 members in been a wonderful aspect of my life. I 140 towns across the state. Resources have learned so much about so many Many garden clubs exist in they offer include curriculum, flower different things. In addition to learning Fayetteville. Most clubs meet during show schools and scholarships. about native plants and what plants the day; however, some meet in the do well in our area, I also have added to evening. Several of the clubs offer According to the GCNC website, my botanical repertoire how to prune, children's programs and feature www.gardenclubofnc.org/, \"The plant, condition and arrange flowers, varied and interesting horticultural objects of the GCNC are to provide graft, attract birds to my yard and the topics at each monthly meeting, a nonprofit, philanthropic and list goes on and on. I recommend such as pruning, flower arranging, educational association for the finding a garden club that meets when planting, soil testing and more. members; to study, in all its aspects, you can attend, and if you cannot find Many clubs also participate in the art of gardening, particularly one, start one, as we did over 30 years community service projects like horticulture and to cooperate with ago. Now three decades later, we are decorating the Veterans Affairs agencies furthering such interest; still learning and sharing gardening Hospital for Christmas and taking to encourage environmental information. I have met so many poinsettias to shut-ins and nursing improvement through civic wonderful and knowledgeable people home residents. Clubs also fulfill civic development, beautification, over the years ― gardeners willing to responsibility with activities such as restoration and the protection work with their hands in the dirt are decorating Heritage Square on Dick and conservation of our natural the best. Happy garden clubbing! resources; and to assist in educating the youth of our state in the areas Gwen Bell and her husband Stewart are the owners of Bell’s Seed Store in downtown Fayetteville. She belongs to both the Cross Creek Garden Club and the Lafayette Lady Slippers Garden Club. 20 | A P R I L 2 0 2 0


“The environment, after all, is where we all meet, where we all have a mutual interest. It is one thing that all of us share. It is not only a mirror of ourselves, but a focusing lens on what ”we can become. — LADY BIRD JOHNSON 2 0 2 0 A P R I L | 21


IBTepyhhmLrmaeAcouawtraplktbstaamhltneaibohnicihnsenwancfswlraoafobledetrgheutssauowneeaccteiltstpomtnsrrcahoekc-evDewsenoghdrrnhiearacnsawpahmhecisgesomsir.qvanucoaaaomiurMcbsiraunortmydseephcmldlisaagvtyaicnlhiehkaeeentleaafadtiooernaen-uycnnslsborsrsnydtls,deplt.psldibiaiuadooanfnomrhoselrlrorngrsgaiHtfaenf.gbdieoaaarcsFt’CpohiabctluelltnoheHrmlttbrascargoiaaeeodtcmlWntdndonasxchtedyotituheauhnsah,gmrlcrratgdiioeatnsnve,ssuntoegehginlyiyhndscpeecbhp,rpvobleoreKemrcroemdocraeesonxbaahudbecteamyipalaavhcehcluitpoepnotanbhaetme,cuiucisirnllytillnteoynrtrewaahnigaicagetddbbgcoceahilasvtaluonelnmuecytahelepsclnoltastnortew.aotietetnohdcLdfsahadnssmabihaeuywhnap.ienumvtynHlutAacanoiihreipocgnighnrssttovksieengomirorrdoehChegseeipbealaondnelmwlsokefhslyrmclsrlcdmlbytprgthterer,aouaai.rlohorhiheufeeraominaednesdmdgssasufoelyaaceerofoshhusutilurabsdfmisftannhopotkfdWrde,.ofcicateurineipeiaonUi.cneeulngltnrcieocitrsMtnuhsntiaanenstgehea,yttircdtleilgvikasflnao,td.narsohdowerhiaeWnkunttinstrair,sGodaoliyodkrt’“dnlgthitnustra.lt”trghloeoamoenvodeteotixwtan,gsM’aaaostdadtct,asihwrnexhhlra.eiihateensnsoialfHynhavoNcesyehoosh,unvietr,ypmucon,amoCdfaalieecodnahgontclualnemotdeheisEedetadaorsoeiukrsxdsfuamceemOrhwtdsmtreepprssa-atntra,ctawfepethshthaoonoebslo–aoktioeolstnnpalioeeusrnoadmrefaynas-eoc,cegrtpls,lmscoHryihdngkdisdlauahvniitaitaeousltvplcodeernireytaeeglcouamuasueeokraudvdkohtricrnshcoslrwtuqlhesaie.neauioakteethnidelheybulhnnaedsgivoenpmopatguoaoalbieygditadhia’pirelerctecucsnustieslonsCtmcmnharocpptrweargsceedasdaaohAlmtyrrvlielillorianensooloupynif.rdetipseps-lddsnnhDceddbcdenrdotappryyaiethtuaseIendoaclasa.Ylyebecmebfgay,Flreh.vtldskCtreoyraseapuhlselrrriaodsceneaidceluwehtttgatehryneto Allison Davis is the wellness manager at Apple Crate Naturals. Working in the natural industry for 11 years, she loves bringing the newest and best products to Fayetteville. 22 | A P R I L 2 0 2 0


Eco-Friendly Take a Homemade stand Cleaning Recipes against child GERM-BUSTING KITCHEN CLEANER abuse ½ cup white vinegar today 2 tablespoon baking soda 10 drops tea tree, lavender or lemon essential oil April is Child Abuse Prevention Month water to fill 12-ounce spray bottle Please join hands with us and become a partner in child abuse prevention. To learn how, visit: www.CACFayNC.org Mix the vinegar, essential oils and a little water before adding baking soda in the spray bottle. A glass bottle is preferred. Fill the bottle to the top with water. Gently shake to mix ingredients. Spray, wipe with a cloth and allow the area to dry. MIRROR AND GLASS CLEANER ¼ cup white vinegar ¼ cup isopropyl rubbing alcohol 1 tablespoon cornstarch 2 cups water 8-10 drops essential oil of choice, optional 12-ounce spray bottle Combine ingredients in the spray bottle. Mix well. Shake well to integrate the cornstarch, the ingredient that reduces streaking fully. Spray onto the glass surface and wipe clean. Shake before each new application. HAND SANITIZER ⅔ cup 99% isopropyl rubbing alcohol ⅓ cup aloe vera gel Combine ingredients in a bowl. Stir and pour into a clean soap or pump bottle. For an added boost, add any of your favorite antibacterial essential oils like tea tree, cinnamon, thyme or oregano. HOMEMADE SOFT-SCRUB CLEANER 1 ½ cups baking soda ½ cup environmentally safe liquid laundry soap such as Ecover 10 drops tea tree, lavender or lemon essential oil Airtight food container Mix the first two ingredients in a mixing bowl. Stir vigorously to combine into a paste. Add essential oil and mix well. Store in an airtight food container. If the mixture begins to dry out, add a small amount of water and mix well. 2 0 2 0 A P R I L | 23


Our Efforts Are Making a Difference By Beth Lee protect children, The one constant in this world is victims and change. The American psychologist survivors of child abuse Abraham Maslow identified the and sexual assault. primary and secondary needs of people, and the needs continue to be basic to all people, Cumberland County is a vibrant, regardless of the diversity of the population. growing community with future-minded leaders in all All children need love and security in a safe sectors of the community. environment with freedom from all abuse — The establishment of the physical, sexual and emotional. Abuse stunts Child Advocacy Center over growth and development, which causes a 25 years ago is evidence of problem not only for the victim, but also for great decisions made in our our whole society. This problem has grown in community. At the center, mammoth proportions; it dictates a sense of fostering close communication urgency and requires adults to take the lead, among agencies privy to a to step up to the challenge and to assist and child’s sharing of trauma persevere in combating this evil. protects and secures the child’s dignity. Trained and My strong concern is built on being raised in devoted professionals who this community, working in the school system demonstrate compassionate and knowing that working with children is in traits and techniques staff the my blood. I have witnessed caring teachers and center. Last year our community school personnel tirelessly comfort broken- reached what is known as the hearted and broken-spirited children during tipping point, where 5% of our and after abuse. The scars run deep, even when population was trained in child the children attempt to smile again. Child sexual abuse prevention leader abuse and sexual assault are real problems. Darkness to Light’s Stewards of Children curriculum. The tipping Senate Bill 199, an act to protect children point theory, based on Malcolm from sexual abuse and to strengthen and Gladwell’s book The Tipping Point, modernize sexual assault laws, became law suggests that once 5% of a population has in North Carolina in December 2019. This act a change in behavior, the momentum for requires anyone over the age of 18 who knows change becomes unstoppable. Cumberland or reasonably should have known that a juvenile County’s tipping point achievement signifies has been or is the victim of a violent offense, there is a culture shift in our community sexual offense or child abuse, to report that case concerning child abuse and sexual assault. immediately to the appropriate law enforcement Our community has over 100 agencies that agency in the county where the juvenile resides have earned the Partner in Prevention Seal, or is found. This expanded duty to report crimes the most Partners in Prevention of any one against juveniles is much broader and stronger community in the United States. than previous legislation that required only adults in specific professions to report. Now April is Child Abuse Prevention Month. The every adult has an obligation to report. The Pinwheels for Prevention campaign is the reporter’s identity is protected, and the reporter symbol of this designation across the nation. has immunity from civil liability for a report As spring brings new life, it is exciting to see made in good faith. Recent data and research our community unite with pinwheels spinning confirmed an increasing need for awareness in the wind to bring positive change to our and training so that part IV of the act requires community. So join us, Cumberland County, local boards of education and charter schools in working together for the bright and happy to adopt a sex trafficking training program future every child deserves. for school personnel who work directly with students in grades kindergarten through 12. This act of law made improvements to help Beth Lee is a assistant principal of Glendale Acres Elementary School and a board member of the Child Advocacy Center. 24 | A P R I L 2 0 2 0


A Beautiful Friendship Friends of the Cancer Center celebrates three decades of patient support By Lia Tremblay Rewind your mind for a moment, Lengthy treatments can also be costumes. “Hippies for Hope” made a back to the late '80s. Batman emotionally draining, so some money memorable showing last year, amid ruled the box office, and Milli goes toward programs that support unicorns in tutus and ladies in hot pink Vanilli topped the charts. The price of a a patient’s mental and spiritual feather boas. Survivors cross the finish gallon of gas was 97 cents and rising. well-being. Art therapy has proven line in tears of gratitude, to the cheers Unfortunately, cancer rates were a particularly useful way for patients of onlookers. also on the rise. Since the previous to channel some of the unpleasant decade, new cancer cases had feelings brought on by their bout with Now in its 12th year, the 2020 climbed more than 25%. Throughout cancer. Massage and gentle yoga are Ribbon Walk is sponsored by Gill 1989, there were more than a million a welcome complement to medical Security Systems Inc. and has new cancer diagnoses in the United treatments, encouraging mindfulness grown significantly since its humble States. And with each one, another that is not just a stress reliever but a beginnings. What was once a few family learned that cancer’s assault research-supported enhancement to hundred walkers has swelled into a on the body is just the beginning. It their overall health. few thousand. The event is so popular can also wreak havoc on emotions, that it’s by far the largest fundraiser for finances and family dynamics. Having their minds, spirits and even Friends of the Cancer Center. At Cape Fear Valley, that’s when finances tended to with these supports Friends of the Cancer Center was has inspired many a patient to pay it “We make about a third of the born. Now 30 years old, the program forward once their bodies have healed. funding needed for the year from has maintained a focus on providing this one event,” says Dickerhoff. “It support to patients and families caught “Many of our patients and families has raised hundreds of thousands of in the whirlwind of cancer care. become donors,” says Brooks. “They dollars, and this year we are planning to That’s What Friends Are For want to help people going through the break the $1 million mark.” same things they did.” “Most of the resources go toward A Walk to Remember Today, a diagnosis of cancer is a much less terrifying idea than it was in patient assistance,” says Sabrina Another way patients and 1989. Breast cancer, for example, now families celebrate their survival is has a death rate that’s 39% lower than Brooks, Executive Director of Cape the annual Ribbon Walk. Held each it was that year. April in Fayetteville’s Festival Park, Fear Valley Health Foundation, which the fundraising event is a festive But cancer is still a serious threat that one indeed. often requires lengthy treatments. And oversees Friends of the Cancer Center. patients find it as necessary as ever to “It’s a celebration of life,” says Brittany be handled with care for their bodies, “Cancer treatment can take weeks at Dickerhoff, the Foundation’s Annual minds and spirit. Giving Coordinator. “The focus is on a time, so when you have to take time survivors, and it’s an uplifting, fun day.” Brooks says the Friends of the Cancer Center will continue doing that for as off work, you might need help to pay Participants often walk-in teams, long as it’s needed. even competing to see who can come the mortgage, pay the light bill, things up with the funniest, most outlandish “When patients can relax and focus on their treatment,” she says, like that. It can be a huge stressor, so “it’s life-changing.” we want to take care of that for people who need it.” 2 0 2 0 A P R I L | 25


Eggcellent LOADED DEVILED EGGS ABOVE Easter Eggs You’ve heard of a loaded baked potato. Well, here is the egg version. Filled with cheese By Hannah Willoughby and bacon, these eggs offer a twist on traditional deviled eggs. Spring may fall on a mid-March date, but Easter is the official kick-off to the season. 12 hard-boiled eggs Gathering with family and friends over a 1 cup sour cream delicious spread of food, with birds chirping, A dollop of mayonnaise kids scrambling to find the most candy-filled 4 strips crispy bacon Easter Eggs — what’s not to like? When I think 2 tablespoons chopped chives or scallions of Easter food, I think of ham and deviled eggs. 1 tablespoon shredded cheddar cheese With the help of my mom, we set out to make Sriracha-10 drops or to taste the best deviled eggs. Out of the three recipes Salt and pepper to taste we tried, these were the two winners. After carefully slicing the hard-boiled eggs First, let’s start with the basics, in half, combine egg yolks with sour cream, how to boil eggs. You will need mayonnaise, cheese, Sriracha, salt, pepper, 1 dozen eggs half the chopped chives or scallions and ¼ cup vinegar bacon. Mix well. Spoon the yolk mixture 1 tablespoon salt back into the egg whites or pipe using a zip-close bag. Top with remaining chopped Pick a pot big enough to chives or scallions and bacon. Make a drizzle hold all the eggs. Add room- by mixing the Sriracha and sour cream. temperature water to cover the eggs by at least an inch. Add ¼ cup of vinegar and bring to a boil. Add 1 tablespoon of salt once at boil and carefully stir the pot until the salt has dissolved. Reduce the heat to a low simmer for 13-15 minutes. Remove eggs and place them in an ice bath to stop the eggs from continuing to cook. Begin peeling once the eggs are cold. Dyed eggs are good to use, too, with all the festive colors and designs. Also, when in a time crunch, there is no shame in purchasing pre-hard-boiled eggs from the grocer. Hannah Willoughby is a North Carolina native. She displays delicious dishes from across the state via her food Instagram,@ncfoodfinds. 26 | A P R I L 2 0 2 0


CLASSIC DEVILED EGGS BELOW These are my favorite deviled eggs, a tried- and-true recipe. These eggs are delicious and easy to make. This is the recipe my mom uses, so I might be a little biased. 12 hard-boiled eggs 7 ½ tablespoons mayonnaise 4 ½ tablespoons relish; Wickles original relish is preferred 1 ½ teaspoon yellow mustard salt and pepper to taste paprika for garnish After peeling, carefully slice the hard- boiled eggs in half. Combine yolks of 12 hard-boiled eggs with all ingredients. Mix well. Spoon the yolk mixture back into the egg whites or pipe using a zip-close bag. Sprinkle the paprika on top for color and a little kick. You can always use this basic recipe and elevate the eggs with a variety of garnishes. Set up a deviled egg bar and let guests choose from bacon, ham, smoked salmon, dill, cherry tomatoes, chives, cracked black pepper and Himalayan salt, to name a few. HARMONY Become part of our family at Harmony and enjoy time well spent with your loved ones in your new home. The Harmony Lifestyle is waiting for you! Call today 910.849.2306 ASSISTED LIVING | SECURED ASSISTED LIVING 7051 Rockfish Road | Fayetteville www.HarmonyAtHopeMills.com 2 0 2 0 A P R I L | 27


April Is World Autism Month LET'S CELEBRATE OUR DIFFERENCES By Alena Barosa $300 Spring is in full bloom, and it is AuThtiusrmsdAawya, Arepnreils2s, D2a0y20 GOLDEN associated with many fresh EGG and inspiring ideas. One of change is a simple reminder of the GIVEAWAY the things that makes April so complexity of human relations. significant is that it represents HOME OF THE and encourages Autism Awareness. Building relationships with people 30-MINUTE WORKOUT Some of us might have heard about who have special needs can be extra \"lighting it up blue\" and considered complex. You might be their caregiver, CLASSES donating to the nationwide funds friend, neighbor or coworker. Relating related to the autism spectrum to others, who see and process the Monday - Thursday: disorder. The less-known fact remains world differently, may be perceived 5:30am/6:15am/8am/10:30am the difficulties individuals on the as impossible. Many people with Autism spectrum face every day. While disabilities may appear intimidating: 4:30pm/5:30pm/6:15pm it is, in fact, a spectrum, each difficulty you might not be able to relate to Friday: is unique. While some affected might their inability to walk, to talk, to have limited vocal and functional stick to a topic of a conversation, to 5:30am/6:15am/8am/10:30am communication skills, for others, the understand emotions and to adjust Saturday: differences might be limited to less their behaviors according to the cues 8am/8:40am noticeable, socially significant aspects. in the environment. When developing Nonetheless, most autistic individuals relationships with others, the fact that Each NEW Membership and their families face the dilemma of some have special needs should not comes with a TICKET relating to others. have as much weight as the fact that everyone needs to be cared for, loved that will enter the and accepted. GOLDEN EGG RAFFLE DINAH One of our most basic needs is to Find it within yourself to get out of your GOODMAN belong. We want to make and keep comfort zone, expand the standards friends, to be admired by our family of a typical relationship and be the Master Coach members, create new families and change you want to see in the world. Personal Trainer belong to a community. Relationships Differences can be intimidating. are hard, complex and complicated. However, we should celebrate them. 3039 Boone Trail Ext. We try to be ourselves while striving Past the state of acceptance, there 910-889-1155 for acceptance. The constant struggle will be a state of learning, growth and between being oneself and accepting wonder that makes all the difference. www.facebook.com/FitBodyBooneTrail/ Alena Sergeevna Barosa is a 32-year-old Fayetteville resident originally 28 | A P R I L 2 0 2 0 from Siberia, Russia. Employed as a board-certified behavior analyst at Autism Therapeutic Services, the single mother has a first-grade son and is an active member of the community.


Leap into Spring with a Great Book The Women’s View Magazine Welcome back, book lovers. We are continuing our seasonal seasonal book review book recommendations. For this review, we have used is here for spring. resources such as Goodreads, The New York Times Best Sellers list, and Bookish Must-Reads Books. Additionally, we would like to By Alison Shirley recognize the Cumberland County Public Library & Information Center for the resources that they provide readers. As we go through spring with renewal, freshness, awakening and gardening on our minds, we hope that you will take these books with you. INGRID FETELL LEE, JESSICA FRANCIS KANE, RHYS BOWEN, JEFF BLUMENFELD, Joyful: Rules for Visiting The Victory Travel with Garden Purpose: The Surprising Power of With the influx of social Ordinary Things to Create media over the last few Rhys Bowen is no stranger A Field Guide to Extraordinary Happiness years, friendships have to historical fiction and Voluntourism changed. Friendships mysteries. The Tuscan Spring is often thought of have become more Child was her 2018 novel In recent years, I’ve read as a time of new life and dependent upon set during World War II. articles about voluntourism. renewal. However, some social media and In The Victory Garden, the Many of these articles people find themselves in connectedness and less setting changes to The led me to believe that situations where renewal on one-on-one time Great War — World War I. it may not be a great is not evident during together. In this book, Here, Bowen exposes her idea for those at the spring. If this is the case Kane writes of May readers to many of the receiving end and can be for you or someone you Attaway, a woman of 40 hardships and triumphs very financially draining know, this is an inspiring who is more interested of living and falling in love for those voluntouring. read. Lee is a designer in her plants and less during a time of war. The However, Blumenfeld gave who uses neuroscientific interested in friends main character volunteers a broader perspective. He and psychological and neighbors. With as a land girl in England. wrote of extensive travel, insights to explain how an unexpected change Not having heard of this places with very limited one setting can give us at work, Attaway finds term, land girl, previously as resources and ways to anxiety while another herself with some time with so much vocabulary in conquer those obstacles. may provide delight. She on her hands and decides historical fiction, I was led to He also wrote of some also shows how we can to reconnect with four some interesting research. opportunities closer in use the strength in our friends. The contrast This research assisted proximity for those, such as various surroundings between the digital and me in forming a deeper myself, with less of a sense to live more joyful lives. analog lives of these understanding of the novel. of adventure and a limited Lee’s book appears on friends is both interesting The way that these women budget. I appreciated the Listopia’s 2019 Best and inspiring and begs stepped up during a great way that Blumenfeld gave Motivational/Inspirational readers to consider their time of need to continue pros and cons and also Books list. connections and bring ensuring that there would dangers to consider before them new life, myself be some crops for people to voluntouring. This was a included. eat is inspiring. great nonfiction read. Alison Shirley is an elementary school library media coordinator with Cumberland County Schools. She appreciates the opportunity to promote reading throughout Cumberland County. 2 0 2 0 A P R I L | 29


CLASSIFIEDS DISCLAIMER Beware of fraud. Please check on the tub and installation! FREE LeafFilter estimate today. Reader Advisory: with the Better Business Bureau Call us at 1-855-534-6198 15% off Entire Purchase. 10% The following classifeds or Consumer Protection (N) Senior & Military Discounts. have been purchased by the Agency before sending Call 1-888-927-8649 SAPA National Trade Association money to any company in SAVE BIG on HOME we belong to. Determining these listings. INSURANCE! Compare BATHROOM the value of their service or 20 A-rated insurances RENOVATIONS. EASY, ONE product is advised by this EMPLOYMENT/TRAINING companies. Get a quote within DAY updates! We specialize publication. In order to avoid minutes. Average savings in safe bathing. Grab bars, no misunderstandings, some AIRLINES ARE HIRING - Get of $444/year! Call 866- slip flooring & seated showers. advertisers do not offer “em- FAA approved hands on 695-8390! (M-F 8am-8pm Call for a free in-home ployment” but rather supply Aviation mechanic training. Central) (N) consultation: 877-925-9682 the readers with manuals, Financial Aid for qualified SAPA directories and other materials students - Career placement Stay in your home longer designed to help their clients assistance. CALL Aviation with an American Standard BATHROOM establish mail order selling Institute of Maintenance 888- Walk-In Bathtub. Receive up RENOVATIONS. EASY, ONE and other businesses at home. 686-1704 (N) to $1,500 off, including a free DAY updates! We specialize Under NO circumstance toilet, and a lifetime warranty in safe bathing. Grab bars, no should you send any money MEDICAL BILLING TRAINEES on the tub and installation! slip flooring & seated showers. in advance or give the client NEEDED! Train online to get Call us at 1-855-481-3969 Call for a free in-home your checking, license ID, the skills to become a Medical or visit www.walkintubquote. consultation: 877-661-6587 or credit card numbers. Also Office Professional at CTI! com/national (C) SAPA beware of ads that claim to 1-833-766-4511 AskCTI.com guarantee loans regardless (N) **STOP STRUGGLING ON REAL ESTATE/VACATION of credit and note that if a THE STAIRS** Give your credit repair company does COMPUTER & IT TRAINING life a lift with an ACORN DISCOUNT AIR TRAVEL. Call business only over the phone PROGRAM! Train at home to STAIRLIFT! Call now for $250 Flight Services for best pricing it’s illegal to request any become a Computer & Help OFF your stairlift purchase on domestic & international money before delivering its Desk Professional now! Call and FREE DVD & brochure! flights inside and from the service. All funds are based in CTI for details! 888-449- 1-866-471-1334 (C) US. Serving United, Delta, US dollars. 800 numbers may 1713 (M-F 8am-6pm ET) (N) American & Southwest or may not reach Canada. Eliminate gutter cleaning airlines. Call for free quote THE FOLLOWING America’s #1 Home Based forever! LeafFilter, the most now! Have travel dates ADS HAVE NOT BEEN Business! Up to $20k/mo. advanced debris-blocking ready! 855-638-3462 (N) SCREENED BY THE SOUTH- Perfect for Introverts, Never gutter protection. Schedule a Call Anyone, Text “INFO” FREE LeafFilter estimate today. SPRING TRAVEL SPECIAL! EASTERN 800-343-6297 or Call for 15% off Entire Purchase. 10% 7 Day / 6 Night Orlando + ADVERTISING Prerecorded Msg (C) Senior & Military Discounts. Daytona Beach Vacation with ASSOCIATION (SAPA); Call 1-855-402-0373 (C) Hertz Rental Car Included. Therefore, any discrepan- HOME IMPROVEMENT Only $398.00. Call 1-866- cies thereof shall not be Eliminate gutter cleaning 494-3020 (24/7) to Reserve. the responsibility of the Stay in your home longer forever! LeafFilter, the most 12 Months to use. SAPA aforementioned association. with an American Standard advanced debris-blocking Your publisher has agreed Walk-In Bathtub. Receive up gutter protection. Schedule a to participate in this program to $1,500 off, including a free and run these ads at no toilet, and a lifetime warranty charge as a service to the Southeastern Advertising Publishers Association. Compiled by the following organizations: Want to advertise in the Women’s View Magazine classified section? Email [email protected] or call 910-484-6200. 30 | A P R I L 2 0 2 0


Venus & Freddie “ONE STOP BRIDAL SHOP” Woman & Veteran Owned ”Donde tenemos todo lo que necesita para su evento” VENUS VOGUE Formerly known as DAMAC Wedding World WEDDINGS, Proms & FORMALS WEDDING TUXEDO PAGEANT & QUINCEANERAS PACKAGES RENTALS PROM DRESSES GALAS $395 Wedding Package $99 Tuxedo Rentals 30% OFF90%PROOffMSelDecRtECSleSaEraSnce Promociones Fiestas 2000+ Dresses in Stock Various Colors & Styles 300+ Dresses in Stock www.marysbridal.com 7000+ Dresses in Stock www.marysbridal.com Same Day Pick-up 40% owffitShecloeucptoFnormals THE VENUE Fayetteville Limousine Service & Airport 24 HR Service Text/Call 910-922-8585 • Venue Rental-120 Capacity • Dance Floor, Laser Lighting • Rentamos Local • Audio & Wide Screen Video • $50/hr Weekday Venue Rental • Décor Rental • Hail & Farewells, Meetings • Catering & Fine Dining Want a night on the town or need airport transportation • Parties, Receptions • Parking, Full Kitchen to Raleigh, Charlotte or Myrtle Beach? • Accommodates 120 People • DJ for Hire Ask about special pricing. • Tables & Chairs Rental • Discount Packages No route is too short or too long. Let us make your special occasion perfect. Please come visit our store. HABLAMOS www.VenusVogue.com OPEN MON - SAT ESPAÑOL 10AM - 8 PM 910-426-2009 or text 910-922-8585 & BY APPOINTMENT 2739 Bragg Blvd, Fayetteville, NC 28303 2 0 2 0 A P R I L | 31


provides your HIRE education! With over 280 academic programs of study to choose from, Fayetteville Tech can help you pursue a rewarding career in the fields of • Arts & Humanities • Business • Computer Technology • Engineering/Applied Technology • Health • Public Service • Math & Sciences Admissions counselors available to provide counseling & enrollment services! Program Spotlight: PHARMACY TECHNOLOGY Become an important team member in the pharmacy! Gather data used by pharmacists to monitor drug therapy Maintain inventories Mix intravenous solutions & other specialized medications Package medications in unit-dose or med-card form Prepare prescription medications Update patient profiles Learn more! Enter “Pharmacy Technology” as a search at www.faytechcc.edu Or call (910) 678-8400 to speak with a Health Programs Admissions Professional. Make the SMART choice for your education! www.faytechcc.edu • (910) 678-8400


Like this book? You can publish your book online for free in a few minutes!
Create your own flipbook