Hands On_5

Based on the CEFR descriptors A key to success! evn eduvisión

COSTA RICA Prohibida su reproducción Edición para revisión del docente

Based on the CEFR descriptors A key to success! Hands on! 5 is a collective work created and designed by the Department of Educational Research of Editorial Eduvisión. Author: Jeannette Soto Segura Language Consultants: Jaime Morales Brenes Elaine Schlabach evn eduvisión

tBhaeseCdEFoRn Structure descriptors Hands on! is a six-level cohesive program that A key to success! guides students into the process of learning English in a developmentally age-appropriate pace through different evn eduvisión activities or tasks and specific meaningful contexts and real-life scenarios. By using the Communicative Approach and the Action-Oriented Approach, students will be able to interact and develop the four skills (speaking, listening, reading and writing) in a pleasant and exciting way through activities such as dialogues, songs, games, projects, among others. What is more, the program enables students to use the Information and Communication Technologies (ICTs) as a way to learn English in a world that demands fast and effective communication. Main components Hands on! includes essential questions, dialogues, songs, scenarios, vocabulary in context, work-in-pair activities, and surveys to keep students willing to use the language more and more. Age-appropriate exercises, appealing songs and games introduce young students to experience English by practicing the four skills. CEvery unit encloses –beyond the school activities– critical thinking tasks, cooperative OSTA Rlearning and systematic grammar activities integrating all four skills. As a consequence, ICAthese abilities favor linguistic competences in a pedagogical scaffolding that will allow learners to use their abilities when using English as a second language. At the end of every unit, they can self-evaluate their own progress using the CEFR descriptors in order to monitor their own development. Opening Unit: Each unit begins with nit Go Green su ProhibUi1dathe themes. A picture-scenario allows Themes Making the Connection 1. Our Environment: students to activate previous knowledge 2. Actions that Harm the Environment 3. Protecting my Planet 4. Solving Environment Problems C. Vocabulary Word bank town - recommend - farmer - parade - pilgrimage - province and introduces the main topic in a real- life situation. The essential question fosters 2 1 Across 5 reproducciónunderstanding and critical thinking. 3 4 5. cAomunatirnieds.ivision of certain L 1esson Our Environment: Making the Connection 6. Advised or suggested. 6 Down hear A. Let’s Talk 1. seApseppceuibcaillaicdllaypyroo.nceescseiolenb, rating a Let´s Unit 2 mLeet’as nTainlgk:aThnids stheectuiosnagpereovifetwhes tthaerget EssentialQuestion 1. Sing the song 43.2..nmAAaAnmappuneelriagrb.sgroaimenns’wasarhjeofoaaurronmthwea.ny.tshoar s a tahbisoturatdit.ition. Do you know any other Mother Earth D. Reading Mother Earth, Mother Earth, 1. tRraedaidtiotnhsethfoalltoywoinugctaenxts. hTaalrket?oTeyoll uyropuar crtnlaesrsmabaoteust it’s a great place to be. (Chorus) conversationEor adchainct. ión para revisiónWeshouldnotwastewater. Mother Earth, Mother Earth, vocabulary and structure in context by a Weclassifygarbage. home planet for you and me. tthihfnToDehdevTrciheiaemarTscuhicdtsyvGroleasteeoetunradmarfarGrssyemiantdtbaaa.irdoieetdemgninopnrtraosaenr3ie,igefnm,1fcotshsfihoneufatttesorsntt:,tthhthtotDtJoaeehaeameftekiDinvfntvesoheufied,lsiEesrgavmbiolgprhirileensfyJelta,opldutint2ehcCofrieo.egefeaasutsgehBbeasipnnoerrnnucroúottddnoh˘dusckeemsaelraeaóacBsmnhjtilcsoonhogiis,uomdrtuusbinoningacmeiDrtwieagytcthu.winheaaecnIeoitslcbio.teauBeihmelosnlpisstlroiaimuodtsthsoocessuetydsanndmeSttielhitpatybyirfnaneeoeagnentlvihniuzdseeedharsyge, How do our actions affect the environment around us? Look after our earth with care, ’cos it’s a planet we all share. We plant trees. Humans, animals, plants and trees, let’s live together in harmony. (Chorus) We save energy. Mother Earth, Mother Earth, home planet for you and me. 7 In ourselves we must take pride, for our future we need to strive. Vocabulary: Clearly, this division presents Bekindit’sworthwhile, and introduces vocabulary rdelateed tolthedocente homeplanetforyouandme. light the world up with your smile! (Chorus) Mother Earth, Mother Earth, 37 lesson. It’s a great place to be, in peace and harmony. By Love to Sing 8 2

Remember to Use: In this section, a brief Cultural and clear description of the structure of tip content studied throughout the unit is provided by controlled and personalized G. Remember to use btDoeidemnyoolrineukktehndoortwooutbhgeahtttceehraewtiwneiginggshl,ot wmwhlyaiciinshtaehlnasoasnalicnlskeoe?d practices. to useRemember I can statements Let’s Practice: This branch focuses on Prepositions speaking and writing activities using 1. Check the box that describes how you feel about your work. the vocabulary and grammar studied SAatphtunhpedsrrawelyosepecthroaettshhtiitoeafioontqlnlhoouaswfehsiasonstgwieposvneinesarfsrowaorrenlhmlpeaoaartreitoriatosn(ni.n.se.ho.Ai,pbntjhebsewceretetwir,netbhteieemnyeoeidxnoeedrrac)ssoipsireanw.cahees.enPnr(eti.epeno.,csbietie.ofPnorsereop,fotfeisrsintti)o,innatsrnouddsuuteaclelllyyaou throughout the lesson. Example: The turtle leans on the bush. Phrase List I can rtehseptoonpdictoofcsotumdpy.rehension Cultural Tip: This presents real-life about information about culture around the world Prepositional B. Let’s Practice questions Developing Good Very good Excellent in regard to the lesson and the topic. It On 1. helps by introducing folk wisdom, and/or By At For In on watch Write with your partner ideas to stay in shape. If you have timtIoetIecp,cxaiyctasonnouaofbccrsaoootulumluydtldpayth.rnmeeshwateoeknperdibcyasoohsufoicrsrottqurweudneay.sdtiinognss other conventions of the language. by degress In anticipation of info graphic on a poster and share it with your class. by design at a low ebb for a good cause on schedule and analyze by dint of in arrears about the at a moment’s for the benefit (of) in essence on the record by far in excess of by force notice for a reason in exchange for on the road by hand in existence be heart at a price for a change rbeoIvrsIfacoesciacntauansardctnboeyhrwuximunlcrasigtihinren.yaggsnt,ihmgqpaeulptaelhinensantfiososinernbmgnse,taeaeptnnniaocdrnsteitcrusaeidpusbpisaeoiontduiongt. snttehhaseenbtdoypic Let´s h in fact on oath by law at a rate of for certain in fairness to on pain of Unit 5 by marriage on the air Unit 4by means ofat a speed offor fear ofin favor ofon balance by mistake in fear of on a diet Unit 4by my watchat a standstillfor goodin flameson a journey in flower by nature at all costs for granted in confinement on a trip by no means in operation on approval at all events for hire on a average on condition that at an advantage for lack of I can faosllocwueas.set of clear-cut visuals at any cost for life instructions using at any rate for love epIqocusaiatnivl epwaionrrtdkiceoippnaeptniordoneje.ncctse,waitchcmoyuntetaabmilitsyhaonwding at night for my at noon for real 104 1. Underline the prepositional phrase in each sentence. Example: The turtle leans on the bush. a. Rachel’s books were in her backpack. b. My boots are under the wooden bench. c. I stood in line behind Stephen’s mother. d. The children sat in the car’s back seat. 101 93 ear Phonics Time: This section introduces E. Phonics Time 1. Study the following consonant diagraph sounds. church learners to the ability to listen, to identify or even to manipulate sounds in spoken words CHchair in order to achieve linguistic and phonemic awareness. GHghost F. wRIEerdintaeigodalmitshsheaentiiidtnceionUemcsxeesp.oTrraeylskostuioor oynowsunr 1. Reading: This uses a variety of real-world laugh dpeafritnnietior naboof uetatcheh emxeparensisniogno. f each expression; draw or phone D. Reading fsiAoagmuserceectrlhoeoiutn,stgm.etydhsatetbryyoooourkcpaunz’tzle: 1. Read about using connectors in a story. Think about the information you learn and share PHsome ideas with your partner. grapShentence Connectors. Use in Writing Compositions Pay attention to the position of each connector in the following examples. They indicate addition and alternatives: also shower You can pay your bills in cash. You can also write a check. ikssaonkmonewpetooanspebecoertuehnttabtebiscoaeauosskye tnoothing text types and adaptive songs and chants that develop a variety of reading skills such SHin aI hdadvietciotaonsshtudy this evening. In addition, I have to cook dinner. furthermore Pets need nutritious food. Furthermore, they need vaccinations. moreover they TH+vAoscyaomburuoplaruoryft.ehsso&r, I will teach you to write better. Moreover, I will increase your as skimming, scanning and/or inferring what is tmeoereth The police have found the missing money. What is more, they have arrested the thief. meaning from context. as well gymnastics 113 with honors as well. read sboomokeone COSTA RICAEnglish in Use: This offers idiomatic Mary won the full-time at competition. She graduated this, she is taking 18 like a expressions, proverbs and phrasal verbs to the unit as a way to achieve linguistic besides the school cafeteria. Besides credits atfsetooemluinengodneersitsatnhdinekainsiglyowr hat My sister works school. in fact Oregon has a very rainy climate. In fact, it rains there 65% of the time. 114 as a matter of fact You can have the rest of this chocolate cake. As a matter of fact, I hope you do. I need to lose weight. actually Jennifer has never liked swimming. Actually, she’s terrified of water and won’t go near it. 112 competence. stcIvRbpspPhutorereraucoreomocvdyrajactieuaoieesnctegcnbenw-uispsdthutsp:atsa-UlaadTtorwtthnthtEehririefseyiiiifleetst,lemi:incnbcosrsTettelechfarrdeaafunnieedssncctPstsrntdsesatarupauo:einppcdarrroToeciuatheocumij,ovpeibnstsiahrutictllaiegs-seenrptcaeni.idnstvoehtg.dFtetofóiienufecnsudutrsgtenoasmohr.sicrpnementcautpgrdiholmdateoeoInaeiarnCortainnuarsrTletdnaspltsl,hiatintthtyoandodatgtbatorgeuoavigeurewiadcMyrParcoejectvisióRsui6nónI cCanINFO evieuwnit ulturatlip3. YboTeEauD.bhh-o.TRacwAeb.vWLiTdeslbKlrWeiey.tmliihelb.fakifrknoP.iesgeiternyMreo.rcyae.ohutTstDohaaocaonu.ttCtueueokotgropgiiesIdrrsScncnntTeenhreeSrtaeevoeilveesladotoStpitaiuhinn.udetpSttptnereyaaemedeteterSt-peeosgedEpSttpr.i1w.geoaaeui.Sdtp2newWyd.ehtnSottrptlF3oov.khreFeitipSaco4stohc.ieDeuiohtpapt5cnt.eltaodChulpa6crreo.bdeipSybdtd7sel.oihivwdiPotkoenodu8tbea.aeeTlluuautelucntaa.aeeTiertnnltdewtrorhtycHhsiRtslacnrytktescieeypitehhmawtodt.mtwrTohoyneolsoiepaaaceiswaotietTatuurfantethesselehnahreunkrtghsiendTacsaydtrmaphyoheiatyysauo.tn.tinwo-ohtlsnoowdlnEciatTdpnuiboaghtbubWnEde-tthg/raaEefbieyDgbeoxveawTdrSrypsy-ielihrtTtiflent,tTa.oaonotoEieyutoadSnedsyeIuennD.wltctdwafll-ookuardetorts-.fteasauToumhewdtcarryaomoenlfnondokehichrlnSauvtoknusuenaahdhgspeagtThmyletrdtvarormssnahsieasoyeirThtwnlidttrbautkkfaendeieoohtfgit./dodell.topocrisuokhonaYcersTrlsmnohnitgdhowfnonwactoauoeramitagtbollaanrlpshiiwsmttikadfettvneieauencaroieyoenlvobnetladhnkoaaiilattzeurrjeydoaeaaeuenaeisnnsdnurcodlwpltnpkattiPteeolsehtindlthaetatacesr.dneaweae.tyoecrbneossrinbiYpcljetonlolocotlikt6hes.oduyuea1tsetoe.ynt.tyhanoropdbeeLtuueaeerrrbryitdaeoelulkaer iadcephalapyicintgupreblaawysiipnktheglatabythianwelglog-rvducidioftearooorkm-ingpgtaWham-eintoeatwinsrkorgdinr-dg-rbidblpisaiatnhengonnktk.iaonsgb-itkodeam-nwucsainictgc-h-rinperb1oeIvgaIlta.rIfsotcoaIdaceeIyTsccCapicVtiinaxbancnu•aa•int•ha•sco•nsrggHadntcbenoueeanyoTwhuD-scPoVtrrxPrbocfmiluylerorkcnoatrahieasocohtsgrhlerotityuiasosneucmhlynula.pttynrgcatesageodettnopitht,akomnrngyehgbqnra.spp-ndcereeioedpoauntsli-lhracimxewilpusmhstneietontnopsahterogentuhfntpbsyoisrfocdecmaiiifanfcnbrsobunonomtgtsgearuentstmdmoh,eanssdeaofeehpoinptectynsnrisocca.otrdtmcdeuqbsierrnayrtethduibisubrcelaaeeyedicueie.bpdsnsnisaspsetsoaiiin:nuoiodhtoutggsinon.oyntDessssownttoseqhhaauaeeysunrybonedobltoiufodsuyeuatpiftokenainctnaehnoslledywazcebthaoarueDtteetyrrvy?oeinulogrpwiunongrikq.uGeoohdobbVieersycgaonodimpExrocevlelent 146 148 vIiscuaanlsfaosllocwueas.set of clear-cut instructions using epIqocusaiatnivl epwaoinrrtdkiceoippnaeptnirodoneje.ncctse,waithccmoyuntetaabmilitsyhaonwding Let´s measurable learning outcome based on the CEFR Unit 6 149 del docentedescriptors. hear Audio-Icon: Represents the conversations and chants that you can hear on the Hands on Player app. 3

Scope and Sequence Units Themes Remember to use... Vocabulary and Phonology Unit 1 Go Green 1. O ur Environment: Making Modals: Can, should, have to Vocabulary: climate, plants, animals, Essential Question: the Connection forest, energy, habitat, forest, chemicals, How do our pollute, destroy, recycle, reuse, reduce, actions affect the 2. A ctions that Harm the organic, littering, garbage environment around Environment Phonology: Long vowel sounds: /ay/ /ey/ us? /i/ /u/ 3. Protecting my Planet Pages: 7 - 32 4. Solving Environmental Problems Unit 2 Pura Vida in 1. Pura Vida in Many Ways Adverbs of frecuency: always, Vocabulary: town, recommend, 2. What Makes your Province usually, often, sometimes, never farmer, paredes, pilgrimage, beach, Many Ways province, rainforest, mountain, popular, Essential Question: Unique? celebrations, community, country, city, How does the place 3. C osta Rica: “No Artificial unique, artificial where we live Phonology: Identify inflectional endings: define us? Ingredients” -s, -ed, -ing 4. In & Out of Costa Rica Inflectional endings funtions: tenses, Pages 33 - 58 plurality, comparison, and parts of the speech Unit 3 Connecting 1. Using Electronic Devices Vocabulary: gadget, chatting, texting, 2. A t the Electronic Devices tablet, cell phone, computer, desktop, Electronically smart boards, smartwatch, robot, Essential Question: Store expensive, cheap, SIM card, battery, How can electronic 3. What is Better a Tablet or a Comparatives and superlatives device, bluetooth devices help and Phonology: Vowel graphemes hurt us? Computer ? Contractions 4. O peration and Taking Pages 59 - 80 Care of Electronic Devices Unit 4 Healthy Choices, COSTA RICAVocabulary: meal, lunch, hungry, 1. Uhm! I’m Hungry vegetables, fruits, meals, meats, recipes, Better Life 2. What did you Cook? Essential Question: 3. Let’s Stay in Shape Prepositions: by, at, for, in, on. delicious, quantity, boil, grill, bake, How do we quantify 4. Healthy Lifestyles healthy, life, lifestyle our world every day to lead better lives? Phonology: Consonant blends Pages 81 - 104 Minimal pair sounds Prohibida suTellMeaStory Vocabulary: fables, short story, comic, poetry, legend, character, interesting, Essential Question: hilarious, entertaining, acting out, setting, What makes a good plot, conflict, connectors, sequence, stor y ? adjectives Phonology: Minimal pair sounds: s / z- nk reproducciónPages 105 - 128 / ng Unit 5 1. Once Upon a Time Simple past 2. What a Wonderful Story! 3. Acting it Out 4. Let’s Write a Story Digraphs Let’s Play Edición para revisiónEssential Question: How do people play around the world? del docentePages 129- 149 Unit 6 1. What do you do for Fun? Future with going to Vocabulary: hobbies, sport, activity, free 2. Sharing Hobbies and time, like, movies, outgoing, collecting, creative, fascinating, cheap, relaxing, Pastimes different, hang out, plans, weekend 3. Do you have Plans for the Phonology: Minimal pair sounds: s / th Weekend? 4. How Was your Weekend? 4

Learn to know Learn to do Learn to be and live in Learning community outcomes Modal “Can”, “Have to”, - D escribing nature at local, “Should”adverbs of Frecuency national and global level. - Describing environmental problems at local, national My Project and global level. Asking for and - R espect the environment. Cooperate among “Composting for Waste Disposal” giving information. Giving advice classmates. Develop creativity, collaboration for protecting the environment. p. 28 - D escribing ways to solve critical thinking and communication skills environmental psychosocial aspects. - R especting the environment. - D escribe my community, - Respect other customs and traditions. My Project province traditions, music, Celebrate the differences between cultures. “Campaigning occupations, foods, for the Festival” celebrations, dress code and people among other aspects. p. 54 - D escribe Costa Rica. Describe travel experiences in or out of Costa Rica. - Identify electronic devices. - Describe the uses of electronic devices in life. - C reate awareness of the negative effects of My Project “Secret - Describe advantages and electronic devices. Compare the ways people Message” Comparative and Superlative disadvantages of electronic socialize with or without electronic devices. p. 76 devices related to price and Develop creativity, collaboration, and critical My Project “TV Cooking usefulness. thinking and communication skills. Competition” - Describe the proper use of p. 102 electronic devices in my life COSTA RICA My Project “The Book” - Describe food likes/dislikes. - Describe habits and routines. p. 125 Past Simple Prepositional Phrases - D escribe similarities and - Respect other people’s customs and habits. differences. Lead a healthy life. - D escribe procedures for quantifying items. - D escribe healthy lifestyles. Prohibida su- Identify the components of a story. - Describe likes and dislikes. - R ecognize the importance of literature - Describe setting and in people’s lives. Gain multiple cultural characters. perspectives through the reading of literature pieces. - Describe the main events in a story. reproducciónPresent Progressive - D escribe past events. Edición para revisión- D escribe preferences related to hobbies and fun activities. My Project “TED-ed Student - D escribe hobbies and - Identify cultural differences among contexts Talk” Future with going to/ will pastimes. in terms of hobbies and sports. Compare del docente- Describe plans related to p. 146 hobbies. - Describe past events. traditional games in CR and around the world. 5

Welcome to Hands On! 5 Let’s meet our friends I am I am I am Felipe Luis Samuel I am Irina I am COSTA RICA Min I am Valentina Prohibida su reproducción Edición para revisión del docente 6

U1nit Go Green Themes 1. Our Environment: Making the Connection 2. Actions that Harm the Environment 3. Protecting my Planet 4. Solving Environment Problems COSTA RICA Prohibida su reproducción Edición pEssaentriaal Quresetiovn isión del docenteHow do our actions affect the environment around us? We classify garbage. We plant trees. We should not waste water. We save energy. 7

Let´sL 1esson Our Environment: Making the Connection hear A. Let’s Talk 1. Sing the song. Mother Earth Mother Earth, Mother Earth, it’s a great place to be. (Chorus) Mother Earth, Mother Earth, home planet for you and me. Look after our earth with care, ’cos it’s a planet we all share. COSTA RICAHumans, animals, plants and trees, let’s live together in harmony. (Chorus) Mother Earth, Mother Earth, home planet for you and me. In ourselves we must take pride, Prohibida sufor our future we need to strive. Be kind it’s worthwhile, reproducciónlight the world up with your smile! (Chorus) Mother Earth, Mother Earth, home planet for you and me. Edición para revisiónIt’s a great place to be, in peace and harmony. del docenteBy Love to Sing 8

B. Let’s Practice 1. Listen to the statement that the teacher will read and draw a picture illustrating the idea. When you finish, share your pictures and thoughts with your elbow partner. Felipe went to last week. The world’s climate Taking care of plants and is changing. animals in our rainforest is very important. We get our energy from There are many different Unit 1 different natural sources. types of animals in the rainforest. COSTA RICA Prohibida su Protecting the rainforest habitat is very important for Costa Rica. There are all sorts of colourful plants in the reproducciónrainforest. Edición para revisión del docente 9

Let´sC. Vocabulary 1. Read the following word bank. Discuss with your elbow partner the meaning of the words. Write at least three sentences using the words. Word Bank climate - plants - animals - forest - energy - habitat - forest - chemicals - garbage - pollute - destroy - recycle - reuse - reduce - organic - littering hear D. Reading 1. First, discuss in small groups the activities done in the school and/or at home to protect the environment. Second, read the following short text. COSTA RMy Trip to Canada ICAHer grandmother rinsed strawberries and put them in a bowl next to the milk and cereal. “Do you have mangoes, instead?”, Samantha asked. “Mangoes in Canada?”, grandma replied. “Can you imagine how much energy it Prohibida sutakes to ship a mango from Costa Rica to here?” Samantha was speechless. Grandma continued, “I buy my food locally. I bought these strawberries in the reproducciónfarmer’s market yesterday. This way, they are fresher, taste better and we don’t produce any pollution transporting them Edición para revisiónfrom one country to another”. Samantha tasted the berries. Grandma del docentewas right. They tasted terrific! 10

E. Phonics Time 1. First, listen to your teacher and repeat the words after her/him. Then, play bingo with the words below. Select ten words from the word bank and write them on the bingo card given. Listen to your teacher as s/he calls the words. Highlight them or put a bean on them. Good luck! Long vowel pattern /ay/ /ey/ /i/ /u/ /ay/ /ey/ /i/ /u/ Monday Key Ice Cupid Day Money Idea Human Hay Honey Item Unit Key Cupid Day Monday Hay Idea Honey Human Ice Item F. English in Use Unit 1 Idiomatic Expressions COSTA RICA1. Match the expressions to the corresponding illustration. •Answer the call of nature. • Prohibida su reproducciónDown to Earth. • • Edición para revisión del docente•To built castles in the air.• 11

G. Let’s Practice 1. Short talks: Get in groups of three or four. First, read the card with your team. Second, discuss the problem and give some examples that you have seen in your own community. Finally, propose a good alternative to prevent damage. Diminish Air Pollution Prevent Water Pollution Use of fossil fuels like petroleum, Water pollution is caused by waste natural gas, coal, and burning wood being discharged into rivers and produce greenhouse gas emissions. oceans. This problem also includes: soil All of these cause consequences on erosion, agricultural runoff loaded with the environment and people’s health. fertilizers and pesticides, and urban runoff containing oil, pet, and garden waste. Climate Change COCuSrbTIAnduRstIriCalAAgriculture Greenhouse gas emissions cause Large scale farming (monocultures), air pollution, and lead to climate supported by irrigation, and the use of change. The gas emissions are fertilizers and pesticides account for causing rising temperatures, melting polar ice-caps and glaciers, rise Prohibida suin sea-level and submergence of 70% of the water use in the world. Also, this is responsible for 75% of the water pollution. All this declines the state of coastal land, changes in precipitation patterns, and increase in extreme reproducciónweather events. These include biodiversity of bees, amphibians, and other beneficial species. hurricanes and droughts, and ocean acidification. Edición para revisión del docente 12

L 2esson Actions that Harm the Environment hear A. Let’s Talk 1. Listen to the song and follow along. Sing with the music of the chorus of I Don’t Care, by Justin Bieber and Ed Sheeran. Discuss with your partner different ways to protect the environment. Let´s Unit 1 I Don’t Care ’Cause we have to care about our environment, yeah All the bad things disappear COSTA RICAAnd you’re making a difference by changing small bad habits I can’t deal with the footprint When I’m saving the planet, yeah Ooh, ooh, ooh, ooh, ooh, ooh Prohibida su’Cause I don’t care, as long as you don’t use plastic bags You can bring your own reusable bags reproducciónAnd stop using straws I’m in love with saving the planet I can’t deal with wasting water Edición para revisiónWhen I’m composting, yeah Ooh, ooh, ooh, ooh, ooh, ooh del docente 13

B. Let’s Practice 1. Show and tell: From the following statements bank, pick one of them and make an illustration about it. Show it to your partner and discuss why this action is harming the environment. Statements Bank • O verpopulation is harming the environment. This is happening since mortality rates have decreased. • P ollution from the trash thrown out on the freeway, as well as millions of metric tons of pollution pumped into the atmosphere every year. • C limate change is specially due to industry and technology. As global temperatures increase, Earth’s weather patterns will drastically change. • Every year, garbage is dumped into the oceans. Also, excessive amounts of fertilizer finds its way into the ocean through rains, floods and winds. COSTA RICA Prohibida su reproducción Edición para revisión del docente 14

C. Vocabulary 1. Write a sentence using the target words. Environment Compost Harm / damage hear D. Reading 1. Read the text and discuss with your shoulder partner why global temperature rising is a problem in our world. Let´s Unit 1 Global Temperature Rise The planet’s average surface temperature has risen about 1.62 degrees Fahrenheit (0.9 degrees Celsius) since the late 19th century, a change driven largely by increased carbon dioxide and other human-made emissions into the atmosphere. Most of the warming occurred in the past 35 years, with the five warmest years on record taking place since 2010. Not COSTonly was 2016 the warmest year on record, but eight of A RICAthe twelve months that make up the year — from January through September, with the exception of June — were the warmest on record for those respective months. https://climate.nasa.gov/evidence/ Prohibida suE. Phonics Time 1. First, listen to the following long vowel sounds. Then, repeat them after your teacher. reproducciónLong vowel /ay/ Long vowel /u/ Long vowel /ey/ Long vowel /i/ Play Donkey Item Tube Stay Honey Ivy Cube EAdwayición paraMoney revIciosn ión Mute May Monkey Ideas Cute del docenteSay Few Valley Crisis Rescue Tray Parsley Pilot 15

F. English in Use Idiomatic Expressions 1. Complete the graphic organizer Cause and Effect. Write on the Effect column the damages to the environment. Discuss your answers with your team. Cause Effect Pollution, in whatever form, whether it is air, water, land or noise, is harmful for the environment. Air pollution and water pollution are caused by human bad habits. Deforestation is the cutting COSTA RICA down of trees to make way for more homes and industries. Rapid growth in population and urban sprawl are two of the major causes of deforestation. Prohibida suG. Let’s Practice 1. Using an old newspaper or a magazine, make a poster that shows different ways that humans harm the environment. Include pictures and reproducciónwrite at least one sentence for each bad habit. Include some pictures that show good habits to protect the environment. Edición para revisión2. Collect recycle items such as soda cans and boxes. Use these items to create something new. Share with the classroom. You may use del docenteYoutube or Pinterest to look at some ideas. 16

Let´sL 3esson Protecting my Planet Unit 1hear A. Let’s Talk 1. Sing the song. We’ve got the whole world, in our hands We’ve got the whole world, in our hands Chorus: We’ve got the whole world, in our hands (4 times) We should recycle now – all that we can Reduce, reuse, recycle – all that we can We should reduce, recycle – all that we can We’ve got the whole world in our hands Chorus: Be kind to plants and animals – in our land (3 times) We’ve got the whole world in our hands Chorus: Shake hands with sisters and brothers – throughout the land Join hands with sisters and brothers – throughout the land (2 times) We’ve got the whole world in our hands COSTA RICAWell you dream your bright dream – then do all you can Dream your bright dream – then do all you can Dream a bright dream – then do all you can Chorus By Dania Marmaluk Prohibida su2. Answer the following questions about the song. reproduccióna. Why should we recycle? b. What can we reuse? Edición para revisión del docentec. What materials could be reduced in your life? 17

B. Let’s Practice 1. Play charades. Find a partner and pick one of the actions in the Action Box below. Do not tell anybody the word chosen. Show with actions the word that you selected, but but without saying any words. Your partner has to guess which word it is. When you are finished, switch roles. Action Box: recycle reuse plant trees avoid plastic save water compost organic waste C. Vocabulary COSTA RICA 1. Read the following words and draw a picture in your notebook illustrating the meaning. pollution classify compost Prohibida su reproducción waste organic clean power Edición para revisión del docente 18

Let´s hear Unit 1D. Reading 1. Read the following text. Brazil Brazil has some of the world’s largest wetlands. Before ecotourism, these wetlands were used to raise cattle. Then, the Caiman Ecological Refuge was set up to protect the wetlands. The refuge helped ranchers find ways to raise cattle and protect wildlife at the same time. It also built lodges. Scientists stay in the lodges to do research. Tourists stay to observe wildlife and sometimes help to study the area. COSTA RICA 2. Think and then write about different ways Central America protects the environment. Mention some of the protected areas in our country. Have you visited some of these Prohibida suareas? Write these areas in the space below. Discuss them with your partner. reproducción Edición para revisión del docente 19

E. Phonics Time 1. Match the word with the corresponding sound. Monday • Cupid • Day • • Long vowel /ay/ Hay • • Long vowel /ey/ Key • Money • • Long vowel /i/ Honey • CO•STLoAngRvoIwCel A/u/ Ice • Item • Human •Prohibida su Unit r• eproducción DeaEl d• ición para revisión del docente 20

F. English in Use • Collect solar energy through Idiomatic Expressions the use of solar panels. 1. Match the idiom with the correct definition. • An area around cities where Go solar • no buildings are allowed Go green • in order to protect the countryside. Environmentally friendly • • To change one’s life to the Green belt • safety and benefit of the environment. • Decide not to harm the natural environment. G. Let’s Practice Unit 1 1. Answer the following questions. COSTA RICAa. What is recycling? What can be made from recycling things? Prohibida sub. Why is recycling important? reproducción c. Make a list of things that we can recycle every day. Edición para revisión del docente 21

Let´s L 4esson Solving Environment Problems hear A. Let’s Talk 1. Listen to the following dialogue. Practice together reading the dialogue. Switch roles. Irina: C an you tell me where we are supposed to take our trash? Luis: Put it in the dumpster next to that stairway. Irina: What day do they pick the trash up? Luis: They empty the trash every Wednesday. Irina: A re we supposed to mix our recyclables in, or sort them? Luis: We are supposed to sort our recyclables. Irina: Is there a special container for recyclables? Luis: Y ou should have a blue container in your kitchen. Empty that into the blue bin downstairs. Irina: What about plant material? COSTA RILuis: A nything that can be composted goes into CAthe bin with the green lid. Prohibida su reproducción Edición para revisión del docente 22

B. Let’s Practice 1. Sometimes the objects you recycle become new things. Look at the following pictures and draw a line from the different types of waste to the new one after recycling it. Then, discuss this with your classmate. •• •• •• Unit 1 • COSTA R• ICA Pro•hibida s•u repr•oducció•n Edición para revisión de•l docente • 23

C. Vocabulary 1. Look at the following words. Get in a group of four and illustrate a poster using the words below. Share your poster with the class. Word bank difference recycle Earth reuse tend electricity COSTA RICA Prohibida su reproducción Edición para revisión del docente 24

D. Reading 1. Read the following text. Then, discuss with your elbow partner the ways you care for Earth. Caring for Earth We care for Earth when we plant gardens and when we plant trees. We care for Earth when we reuse things and have organic composters. We care for Earth when we recycle materials that can be transformed into something else. Also, we care for Earth when we walk Unit 1 or bike to school instead of using a car and/or tell our parents not to use COSTA the car at least one day a week. We care for Earth when we save water by turning off the water when we are washing our hands or having a short shower. We care for Earth in many ways. Our care can make big differences! RICA Prohibida su 2. Answer the following question according to the story. reproduccióna. How do we care for Earth? Edición para revisiónb. What do you do to care for Earth? del docente 25

Let´shear E. Phonics Time 1. Read the following tongue twister. Make groups of 6 and sit in a circle. Play Broken Telephone: whisper the tongue twister to your shoulder partner and s/he listens and whispers to the next person. Repeat until all of you have played. The last person has to say the tongue twister aloud. Ivy eats five ices on a bike Bite, bite, bite alike the ice Fine, light, delightful ice Bite, bite, bite alike the ice On a bike 2. Write your own tongue twister. Let´s hear F. English in Use COSTA RICA Idiomatic Expressions 1. Read the following dialogue and highlight the idiomatic expressions that you can find. Then, discuss them with your Prohibida suyour partners. Min: My parents and I have been considering going solar. Even for our tiny house, hydro bills are pretty high. reproducciónFelipe: Yes, I’ve heard of this new trend, but I wonder if it is cost-effective because solar panels are very expensive. Min: We are just exploring the market, so we can’t tell for Edición para revisiónsure, but it seems to me it will be, in the long run. Felipe: I am amazed at how many of our friends choose del docenteto go green these days! 26

G. Remember to use 1. Study the following information and answer the activity. to useRemember modals We use modal verbs like: can, should, have to with another verb to show that an action is possible, necessary or certain. We also use modal verbs to ask permission or to give advice. Example: Positive: I can swim. Negative: I cannot dance. Question: Can you speak French? 2. Read the sentences. Find the grammatical error and write them in a correct way. a. You can to use it anywhere. Unit 1 b. My brother cans swim. COSTA RICA c. I don’t can speak Japanese. d. Does she should play tennis? e. I want to have to play guitar. Prohibida su reproducción Edición para revisión del docente 27

INFO My Project Composting for Waste Disposal One major way we can help Earth is through composting our food waste; the benefits are terrific. Generally, compost is made in large bins. On the Internet, research videos on different ways people are creating their compost spaces and why it is helpful for the environment. Next, you will look at the layout of a composting project you can start in your school and your home. There are two major components to healthy compost: green stuff (grass trimmings and food scraps) that provides moisture; and brown stuff (dry leaves, nut shells, or recyclable paper) that absorbs some of that moisture. You will want to layer these components in your bin along with a layer of soil. What you will need: • A large, airtight bin and lid • Soil • Something to drill holes in the container bottom COSTA RICA• Some sort of tray for potential fluid leakage • A way to keep the container elevated • A tool for stirring • A good place to store your compost container; it can be close to the Prohibida suschool cafeteria. Optional: 1. Decorating your bin can be fun! reproducciónWhat you will do: 2. Begin by setting up your tray and elevation pieces. This would also be Edición para revisiónthe easiest time to decorate! del docente 28

3. Next, drill about 15-25 holes in the bottom of the bin. Too much INFO moisture can make your compost rot, and you won’t be able to use it. Be sure to keep in mind the placement of the materials used to Unit 1 elevate the bin so they don’t block the holes. 4. Now you can begin layering. Start with about six centimeters of brown stuff (dead leaves, shredded/torn up newspaper, junk mail). Then comes the daily green – your banana peels, egg shells, vegetable peelings, and so on. Layer three will be brown again. You’ll always want more brown than green to avoid too much moisture. Layer four is three centimeters or so of soil. 5. Give everything a stir, and that’s it! Keep layering like this daily/ weekly until your bin is full. 6. Once full, stir occasionally and check for moisture (if it is too dry pour some water… not too much) for a couple of weeks until all you have left is a bucket of nutrient-dense soil! If you live in a dry area or don’t create much moist food waste, you may need to occasionally add water. You’ll know you’ve added too much if it leaks from the holes. For leaks and bad smells, add more brown stuff. Some people recommend having two sets of compost; while COone is full and processing, you can start filling up the other. If STA Ryou don’t have a yard with flowers and vegetables to use your ICAcompost material, try donating your compost to a community garden, using it for growing indoor plants, or starting a garden of your own! Prohibida su reproducción Edición para revisión del docente 29

R 1evieuwnit 1. Answer the following quiz. Am I Green Enough? 2. What happens when our lakes and rivers are polluted with chemicals? ( ) Fish swarm to the polluted areas. ( ) Plants and animals are killed. COSTA RICA3. What causes global warming? Write your opinion down. 4. What does it mean to “pollute” something? Cross out the correct (s) one (s). Prohibida su( ) Make it clean. ( ) Put it in water. reproducción( ) Make it dirty. 5. How can we keep people, plants and animals clean, healthy and happy Edición para revisiónwhile taking care of the Earth? del docente 30

6. In what ways can you take care of the Earth? Cross out the incorrect one (s.) a. Avoid using plastic bags and bottles. b. Never pick up any trash you may see on the street. c. Use glass bottles instead of plastic. d. Ask your parents to drive you everywhere instead of walking. 7. Why is it important to take care of the plane? 8. What can be recycled? 9. Write some simple ways you can protect the environment: Unit 1 COSTA RICA Prohibida su reproducción Edición para revisión del docente 31

Culturatlip Did you know that Qatar’s carbon emission per capita is the highest in the world? Check in google maps pictures of Qatar. Did you know that by October 1st, 2019, Costa Rica had run 100% renewable energy for 299 days? Research more about this topic and share it with your team. I can statements 1. Check the box that describes how you feel about your work.. Developing Good Very good Excellent I can respond to comprehension questions about the topic of study. COSTAI can comprehend short readings and analyze RICAtexts about the topic of study. I can orally answer basic questions about the topic of study. I can write simple sentences using the Prohibida suvocabulary that has been studied. I can exchange information about the topic of study using questions and responses by reproducciónbrainstorming, planning, participation and researching. I can follow a set of clear-cut instructions using Edición para revisiónvisuals as cues. I can work on projects with my team showing del docentepositive independence, accountability and equal participation. 32