Support Materials catalog

SUPPORTMATERIALS for Health Professionals

Copyright © Transformation Enzyme CorporationAll Rights Reserved

CONTENTS Books Manuals Brochures Shelf Talkers / Conversation Starters Posters Additional Resources / Accessories Technical Services / Comparison Charts Product Samples / Info Pages Product Cards / Custom Materials Webinar / Video Library

BOOKSThe Healing Power of Enzymesby Dr. DicQie Fuller-LooneyThis landmark book by the pioneer of Enzyme Therapy andTransformation Enzyme Corporation’s Founder and CSO is nowavailable in a newly revised edition with 6 additional chapters! Item # 1000020Living Longerby Richard Couey, Ph.D., with Dr. DicQie Fuller-LooneyBaylor University’s Dr. Richard “Dick” Couey joins Transformation’s Dr.DicQie Fuller-Looney for this complete guide to all the answers abouthealth concerns, nutrition, and enzymes for the whole family. Item # 1000011The M Clubby Wendy Everett Cooke with Dr. DicQie Fuller-LooneyA scientific yet personal account of the way lifestyle choices andenzyme nutrition can help rejuvenate the body on the cellular leveland positively contribute to women’s health. Item # 1000023The Ripple Effect of Toxicityby Lisa Helffrich Hudson, RD, LDLisa draws from her years of clinical experience and research on thedetoxification process to show you how supporting healthy digestionhas a positive “Ripple Effect” on the overall health of the entire body. Item # 1000024

MANUALS PRODUCT CATALOG Product Catalogfor Healthcare Professionals for Healthcare Professionals Take the next step to supporting your patients’ good health with this overview to Transformation’s Professional Protocol™, Genesis of Good Health™, and Zymes 4 Kidz™ product lines, plus more! Item # 2000040 Practitioner Reference Guide for Health Professional Use Only Looking for more details on product usage, including clinical applications? Refer to this complete guide to Transformation’s products for digestion, nutrition, detox, weight loss, and more! Item # 2000132Phase I Thrive in 63 Patient Workbooks (Day 1-21) Phase II A Program Designed to Restore Health from the Inside Out (Day 22-42) Phase III Get your patients started on their own Thrive in 63 Program! Our (Day 43-63) patient workbooks are complete with meal plans, daily menus, recipes, a food journal, and supplement protocol instructions. Phase I: Item # 2000058 Phase II: Item # 20000582 Phase III: Item # 20000583 Thrive in 63 Practitioner Reference Guide A Program Designed to Restore Health from the Inside Out This reference guide gives the step-by-step process including scripts and forms that you and your staff can use to more effectively and efficiently communicate the Thrive in 63 program to your patients.

BROCHURESETOXIFICATION* GETTING STARTEDprovide nutritional support Our philosophy is simple — give the body the nu- detoxification process.* trients it needs, clear away the waste, and allowOUd herbal extracts known for their the body to manage its resources.* o eliminate metabolic waste and Starter Kit includes a two-week supply ofW?oz) Transformation’s Professional Protocol™ Digest (45 caps), e0hn0bsy0eaesssnuispztpyinomgrtetshsgeebnotldeyc’shenloartmioanl, What are aicbitoy.u* t(6200ca,0p0s)0 Protease (30 caps), and Probiotic (15 caps).* Supplement Facts mafumanicninttiaoiAnn.iCtsomplex includes n of antioxidants plus herbs and TPP Foundation Kit includes a one-month supply of Transformation’s Professional Protocol™ Digest (90 caps), nmymouunre msysoteumth.*, (60 caps) Protease (60 caps), and Probiotic (30 caps).* Serving Size: 1 Capsule Soothing and effective Servings Per Container: 90/180 mtainllcliundteesshtienreb,s, nutrients, ca- ENZYMES?Zyme Foundation Kit includes a one-month sup- Amount Per Serving % Daily ValueOeaetonspbz.tar*iymosAmasaludellrTsdre.raiagTmnnePgassePfxtoiioomDrnfmiusgiamspeteisdoqctenuifpi™inacecliinttlfiuyodedresamenntsotudulhhanpiasguonhtanrdlirytleeieoafcfnaceaatlclirlvtefieeovfufoefeeldlndyczpitgpiyrveremeesfnepetieravsesrewnescd.i*t-h epbcapobfDroufruefeoedlirtpegcdiyivcfantye.iia*oerveseitndAenrtedgcZnldelmyeeytnT,onfsmaozratsaxaryrne.ainsm*modtssiepseuufadtosmuirimdrefnmirnudiiomnqamimtguhatiimeeoexdmslinmyimTtg™yirofueucaonnsomnrftemolosiovrqffgsumeounuilrcaauaumpatllctpeialrattodyisisetvirooantiatto.unyntr*ser™dacTi,nscephnsasptreuhiorrstseeohrdtpifditutuhgiehuocluhclecntymliiytfoaiclanlinanelly Supplement Facts 2M9A0N0UWFIALCCTRUERSETDDFR.O,RSTUIRTAEN2S2F0,OHROMUATSITOONN,ETNXZY77M0E42CORPORATIONsuppor t for moreSSSeerrvvuiinnggpsSPipzeer:lC2oeCnatmapinsuelree:s1n20 t F a c t s ,ophaenlpcprreoamsotaenindternal bacterial ENZYMEply of Transformation’s DigestZyme (240 caps), PureZymEenzymes are energy-rich protein molecules Serving Size: 1 Capsule 2M9A00NUWFILACCTRUESRTEDDFR.,OSRUTITREAN22S0F,OHROMUASTITOONN,ETNEZXYAMSE7C70O4R2PORATION ulnaesssysotfemmfiulkn.ction.* (60 caps) TzyPm(r4eo7™te,1aE0s4nezHByUlmeTned/B1(lee0nn0ddUo/SePxo/ p5r0o0teDaPsePs-)IV) 327063 mmgg PEROnDFzEySSmiIOegNALe†PRsOTtO*COLARmacaESTTBadaEenhtzhnsiopgSzCyaeidmrseysmelOaOmGsupaoetltLritIlieM™lgvroehltUehprasMaaatcrciTplnsicmyteanEritaEvaotsrdoasNicceeLtttryuerakaytYDaapsnbilsdebwsElkrtNeedlameeaiDomteOnicnnehnfndatdaUitzarbaFtsoekiyimSuoycftImpoLrohnpAliefseeodiLaegdTspGlar,hErrtwioias.dnlEssyRnotraCyFyf:saonS8stoofcepOrtoeomtnilorriammdvn.mtuzceeeiClem.ac,an.thoft(ibueetoKe1fsendndme)nlceimitEeiqtacocpiofnauataietenzolspiynsyadul.ysh*mltC,bauooepaoenlrfHdefcCrtaereeeobewxsartramhcp(ildmtFhaeohoCinrroiavcxeCefteeiiccv)onddhteun,gein.lrfddyriwtrosebi.mntyh.ABSOLUTELY NO FILLERS Servings Per Container: 90 bwmReiEethpaCulaOlodleMredaqMsauEpadaNtierrDetlciaEqtneDuddidUi.bnSVygAeraegGdheEietea:anbTlttlswheomctwa(ix2roee)-pdcpiaerwapcicteshtuictlfieaoospnosedwur..ilteThsaekmveearyy APhlpyhtaa-sgealactosidase 59205 FGTaUlUS90uCpApPlSeUmLEeSn††t*EANCTVDOUHAMTRELISEUINNE,AITSOTSETRETNRDAPDATRBTEEYEIDMOVTNETEHON.NETTTDHSFIAIAOSHNGOAPYNDVRDOEOAISSNNDEEDOU,ATCTDSRTBREEEIU.SAEGTN, CNAE*TUODVHRAMTELEIINSUN, EIOATSTERSTENRTPDDAARTETBEEDIYOVMTTENEOHN.NTETDTHAFISAIONSGHYOPANDRDVOOEIASSDNNEEUD,AOTCSTDRTERBE.IUESAEGT,N Amount Per Serving % Daily Value (200 caps), and Plantadophilus (90 caps).* Tzyme™ Protease Blend (55,131 122 mg † Amount Per Serving % Daily Value (Protease and peptidase) HUT + 11 SAPU) † Enzyme Proprietary Blend 372 mg † 67 mg Amylase 12,200 DU † that are vital for life. They catalyze and THELipase (7,518 FIP) 66,500 HUT † Stress Management Kit includes DigestZyme regulate chemical reactions and are an GENESIS OF GOOD HEALTHTzyme™ Polysaccharolytic Blend Protease 1000 FIP † 270 mg † 1320 CU † NUTRITION(360 caps), PureZyme (200 caps), TPP Probiotic (60 caps)e, ssential part of every activity in the body. complete digestionLipase Amylase 20,000 DU † 200 SU † Cellulase 500 DPº † Phytase 438 Gal U 800 ALU † Invertase milk) 20 mg † *Glucoamylase Diastase 6 mg † DigestZMacerase Alpha-galactosidase Lactase ymePectinase 42 FTU † Lactobacillus acidophilus (grown Beta-glucanase 25 AGU † of proteins, fats, andBifidobacteriumlongum 400 CU † 14 endo-PGU † 25 BGU † LactaseEnzymeCellulase 610 ALU † Diastase 295 CU † on SupplemeInvertase 168 DPº † ntHemicellulase 56 SU † † Daily Value not established 28 HCU † c a r b o hy d r a te s .*AONTDHEWRAITNEGRREDIENTS: CELLULOSE 240 CAPSULES† Daily Value not established StoreCEhnezymmicealascCtivoidtyeixs(mFCeaCs)uurenditsi.n Food OCTAHLCEIRUMINGCRITERDAITEENTS: CELLULOSE, WATER, Keep otiugthotlfyrseeaaclhedofinchailcdoreonl,.dry place.teivde, reapnidzylymasessimilated liquid and Transcendence ReZEN (90 caps).* Digestive enzymes help break down thenossuwphpoilert itnheouurirnary system and Thrive in 63 Kits for Phase 1, 2, and 3 each include food we eat, releasing nutrients for energy Amylase 3495 DU †uancfteiotnu.s* .(1 oz, 4 oz “refill size”) Pectinase 30 endo-PGU †Get ZMYMAEXS 4IMKIDUZMnazhsftoi“ecrrtlelbosofyaiwslnllteesoinximzrtgemra”a)cbnatdilsriztskheunpopwonrtfoorpttihmeiarl e puberty years.nutrition with-Acetyl Cysteine supplement with a 21-day supply of Transformation™ supplements and a production, cell growth and repair. Glucoamylase 12 AGU † Systemic protease patient workbook with meal plans.* Lipase 340 FIP † However, due to genetics, stressful lifestyle, Diastase AaAclhpiassBPunlirlssygleouStTsushidrvOritarlseeauyaertLZmncetspemUtsyiiuctdcofmhaToorneifxEbrnfeoimiaoemLcbrilYfedasoaouentdnpuemiNntoyctrnniOenaemizqiqr™nt.yuge*uFummaydmTeIf,LloelihafytaLrdrsyexonmEfiigmoiamdpnRuernrmualotsSmdahmittdsuieeynvlocaauideTnolrttiyregrealiaitomdetciniccgostmawisitvnacifrioiuoacaetthyntnrllfimuveesiponlioflatrffsyyueottunhirpctoipeuncetrnipeatevrP™hosspieeuueransntmrp.repett*eorssaeZodT,sncpydh.itmr*ufobeoiccoematdloyly.t*e Supplement Facts enzymesSupplement Facts support healthy Invertase 42 DPº †TsfaouPnrpPmdpunPolurratotssrtitheaioearenasalectlhaieysrfefbaefulcoultlonyivdiqeprunrheeeepspoasrlr.ooe*gtdeyo.t*olyAtailcsl Tseurnarzenysmmfoaerxmbimaletuniomdn™tqhuaatlity tmtcotRwhaieExeoreen-CmpdhpOiaoerwMnarcniecctMhietnictEgfiatoohNpaonesDndeudd.Er.liTegDrTwisegaUsohmkteSti(ao2bAwyn)eGibfoctohEeafrpp:eapsrTdubouweletlleqeeodiudsn(oa2smart.)ep*aacaylsairqtpbduaseiirnduetd.laceVtksieneedfgngirrebsewtytdaittiabhhelinehnmtegseaianltlhs Serving Size: 1 Capsule Lactase Servings Per Container: 60 Protease 3.0 14140 ASLUU PPROFrESSoIONtAeL ††PaROsTOeCOLARoacswESBKnEamhnitepStCoaezhaesrOnyaOlepulmmlLetMlatoehieeUmgumMahatcaTpoltoacnEslEtyutfrdyiNeLvtnrsoeisYtDtetapayteaooEkrcNilnfamseheDOhtcdnmeoataUiifpcFbetnnicSihaoyIdcahLsAnewisuwLlcedGprotiEarrteho.oheEtRdeolneC,:8Sn.irddnoO.oriniOgFymnzteoepen.moslneoad(tetif1cso(Cdew)1nmi.h)caaeoactatemefpaylrpspiycbrousaoaerluletfsletareeeCtiswnrmmosdmodo.aie*ritvyexixmeicbn(dtFeegeCsfdrtwCaoabikm)tydheuannayits.CNAE*TUODVHRAMTELEIINSUN, EIOATSTERSTENRTPDDAARTETBEEDIYOVMTTENEOHN.NTETDTHAFISAIONSGHYOPANDRDVOOEIASSDNNEEUD,AOTCSTDRTERBE.IUESAEGT,N environment and diet, we are all at risk for Cellulase % Daily Value Hemicellulase 602 CSAUPUES60unCpzAypmPleSemULeEn††St*EANCTVDOUHAMTRELISEUINNE,AITSOTSETRETNRDAPDATRBTEEYEIDMOVTNETEHON.NETTTDHSFIAIAOSHNGOAPYNDVRDOEOAISSNNDEEDOU,ATCTDSRTBREEEIU.SAEGTN, 641 mg † (600,000 PU) T G OF G HHE ENESIS OOD EALTHAmount Per Serving circulation, detoxification,SSeerrvviinnggsSPizeer:C2oCnatapinsuelre:s100 Tz((yp3me5p5et,™i0d1aP7sreHostU,ebTarso+em1Be8lelaSniAnd)PU) Amount Per Serving Protease (370,000 HUT) Calcium Citrate PurOTHER INGREDIENTS: CELLULOSE, WATER, % Daily Value eZymeCALCIUM CITRATE compromised digestion. This is why many † Daily Value not established 616 mg † 79 mg † and immune system†DailyValuenotestablished With the prevalence of processed foods and people benefit from the support of a EnzymeMESNUAZNITYUEMF2AE2C0CT,OUHRROPEUODSRTFAOOTNRIO, TTNRX, A27N970S004F2WORILMCARTEIOSTN DR., 2S0u0pCpAlePmSUeLnEt STTadzhnigyidsemGspetrIi™votepraripsicertaotascttrerayasbdbsleeleamennndadzrokiymfmohpfeiagTsrhrtialssynyfsaosfcrtoemtrimvmueilac,atftibueoendnnctEetoiofnietnzsnya.h*ml,aepnHcCeobtrahplaeonracteiodn, . OTHER INGREDIENTS: CELLULOSE & WATER function.*SEMUNAIZNTYEUMF2EA2C0C,TOHURORPUEOSDRTFAOOTNIRO, TTNXR, 2A797N00S04F2WOIRLMCRATEISOTNDR., GMOs in our children’s diets, the need has never been greater for our children’s product line.*pieenrtss otonhhelaprcboournster exposure to digestive enzyme supplement.* Enzyme activity is measured in Food Chemicals Codex (FCC) units when possible.digestive enzymes*minecnttasl tpoexicciiteys.* o(6f0 caps) Store tightly sealed in a cool, dry place. Keep out of reach of children. 60 HCU †dgcseuoslytanotsiyuowsntaheamtenerdi.ceopyprotoitmueaasl eimfomrmunuelation Herbal Blend 63 mg † Kidz Digest Powder is a gentle formula of Fennel (seed), Ginger (rhizome), Flax seed, effective, GI stable digestive enzymes designed to Peppermint (leaf), Artichoke (leaves) extract A safe, non-habit forming encourage optimal digestion of nutrients and healthy Bifidobacterium infantis 6 mg †TogAmPfallamnPTxiisriPcmamrrnouossombferoignoqrahmtuniacaainsltiimcitsoyensaat™fhnfroeiderfmonenrdcuumoltlyraluiotttliiogaooisnncthaaaoellrfeebhafaucfelcamacarnaetricevnfeufeuGlnlolyleIfypstfrmrrsaiee.ci*pxntea.d*drlyeTsdhbeeatloescectaetsioroisran-u.*reAab“PfsBarlsicaeSutnneOrtedraLilaydmU.”o*aTbpAxEahilmLlciTYtlueurmraNsiunOiqmssfuFaoatIrhLslmiattLyataEbetaiRionnlinhzSde™andnucfctoeruristlmitouthunreelaalseoecfafolfraeleoccgtctoiiavcbreaaenlcfeubilslalluyslas.p*nprcelaepnaotraferfrduiemtno,daly Supplement Facts CORPORATION alternative for populatingSupplement † Daily Value not established PROFESSIONAL PROTOCOLARbctaBeaEkdrSCeetOiOnmpLMrbeaUyMcwTstEiiEpttihNooLnoYDaentENrl.ieDmOCaUmsoFtSneI8LtAdeLioGnaEzttEse.R:lomSyfOaawnfytaeebtre(e1rm)roeicxrmaianposgsvduweildreitehfucratopemosdnmbcraayislplainsaughmleeooarualtannhttd mVdReiirExgeeCecdttOeawMdbiltMebhyEtfwoaNoohD-dpeE.iaeMDlctuheUscSctaaAbrpeGespEurerl:eafTsrcithgmitreieoarenyaet(be3r.ed)Tcpatauokplelresewudtlaieathispnaaaordttpebatqeinmuddatuiitmnemgelriaqeocudrtiiadievs.nittsy. Serving Size: 1 Capsule 77042 elimination for infants and toddlers.* (41.5 grams) Servings Per Container: 60 SSeerrvviinnggsSPizeer:C3oCnatapinsuelre: s30 of tepid water. CNAE*TUODVHRAMTELEIINSUN, EIOATSTERSTENRTPDDAARTETBEEDIYOVMTTENEOHN.NTETDTHAFISAIONSGHYOPANDRDVOOEIASSDNNEEUD,AOTCSTDRTERBE.IUESAEGT,N Facts Amount Per Serving % Daily Value 2M9A0N0UWFIALCCTRUERSETDDFR.,ORSTUIRTAEN2S2F0,OHROMUASTITOONN,ETNEZXYAMSE OTHER INGREDIENTS: CELLULOSE & WATERP ro b i o t i cR*SK*EtGeoFeurepRartoIaiGgunhtEtteolRyefAdrseTemaaEcilnehFidmoOifunRcmahOiplcdPoortoeTelnI,nM.dcyUryaMptltaAhcCeeT.timIVeIToYf manufacture. r sensitive individuals who have PS60ruoCpbApiPloeStmUicLeEnSt*EANCTVDOUHAMTRELISEUINNE,AITSOTSETRETNRDAPDATRBTEEYEIDMOVTNETEHON.NETTTDHSFIAIAOSHNGOAPYNDVRDOEOAISSNNDEEDOU,ATCTDSRTBREEEIU.SAEGTN, Tzyme™ Probiotic Blend 442 mg † Amount PerServing %ain, papain, or would prefer to 3 billion cfu** † plantarum cfu**) THE GENESIS OFLactobacillus plantarum380 million cfu** † the gut with “friendly”Lactobacillus Kidz Digest Chewable is Transformation’s “Zymes GOOD HEALTHLactobacillus sporogenes300 million cfu** † (6 billion Daily Value 200 million cfu** † 600 mg † Lactobacillus salivarius 225 million cfu** † † Daily Value not established Bifidobacterium longum 1 billion cfu** † Lactobacillus casei † naturally occurringKS*O*etGoeTrupeHaotrEiuagtnhRottelfyIerNsdeeaGmaclhRiendioEmfinDucmhaIiElcdpNoroeotTnel,.nSdcr:yyCaptlEathcLeeL.tUimLeOofSmEan&ufWactAurTeE. R 20 mg bacteria.*SEMUNAIZNTYEUMF2EA2C0C,TOHURORPUEOSDRTFAOOTNIRO, TTNXR, 2A797N00S04F2WOIRLMCRATEISOTNDR., PlantadophiLactobacillus acidophilus † lusJerusalem Artichoke tuber 10 mg Lactoferrin (from milk) Probiotic† Daily Value not establishedm.* (60 caps) 4 Kidz” digestive support formula as berry-flavored tablets S90uCpApPlSeUmLEeSntOTTtpizohrToynismHcaepleEsrm™osRipcarirsniIoeNdoatariGtgmrryaaRpndbaieElsermtmnDsdasyIrEsokistfeNoGfmofTIrTimctSrraaub:ncleasCtntfseoeEtdrfaimLtbtsoaLl.e*tUei,onhnLhigOaEhnnlSyczeEyamctht&eievCedW,oigarAepnsTodtriEafvuetRinocn-. for children and young adults.* (30, 90, 180 tablets)ulated with herbs, vitamins,e blend for supporting a healthy TransformationEnzymes.com *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOODs) AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED Transformatio8nE0n0zy-m7e7s7.c-o1m474 TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE.protease blend for a gradual for Healthcare Professionalsh benefits of proteolytic enzymesd tolerance.* (120, 200 caps) *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Why Enzymes? Get maximum nutrition with digestive enzymes Item # 2000041 Enzyme Nutrition at a Glance! Overview of all Transformation™ products Item # 2000050 Wellness Foundation The Foundation Formulas Item # 2000153ment Facts Skeletal System* Carbo-G Gluten Digestion just got easier! % Daily Value Give your body Item # 2000053 the nutrientsd rosehips fruit ext.) 20 mg 33% it needs Joint Healthydrochloride) 10 mg 500% Intro for Health Professionalsacid chelate 100 mg 10%m amino acid chelate) 20 mg 5% 12 mg 80%mplex) 100 mcg 143%e citrate) 5 mg 250% Nervous System*olynicotinate) 100 mcg 83% Item # 2000057 152 mg † Transformation’s Professional Protocol™ Joint Health Mineral Complex supplies the mineralsptidase, Phytase, Glucoamylase, and nutrients for good skeletal, muscular, An Active Life You Deservemicellulase, Cellulase) cardiovascular, endocrine, reproductive, 116 mg † and nervous system health.* 25 mg †odosum) 150 mcg † 5 mcg †edCELLULOSE & WATERMENDED USAGE Minerals are essential for a healthy balanced diet. Supplement Facts Item # 20000575%DailyValueManufactured for Transformation Enzyme Corp. Transformation’s Mineral Complex is a multi-mineral formula.* Serving Size 1 Capsule 2900 Wilcrest Dr., Suite 220, Houston, TX 77042 e daily or as directed by a All Transformation formulations are carefully prepared to assure Servings Per Container 30 ner. Not recommended for maximum quality and nutritional effectiveness.* Amount Per Servingpregnant or lactating, please ABSOLUTELY NO FILLERS Cellular Nutrition* your physician. RECOMMENDED USAGE: One (1) capsule a day or as directed Vitamin C (from acerola and rosehips fruit ext.) 20 mg 33% by healthcare practitioner. Contents may be removed from ottles of 30 capsules. capsule and taken by spoon immediately after mixing with a small PROFESSIONAL PROTOCOL Vitamin B6 (as pyridoxine hydrochloride) 10 mg 500% amount of tepid water. /NON-ALLERGENIC Mineral Complex Calcium (as calcium amino acid chelate Store tightly sealed in a cool, dry place. Keep out of reach of Mineraland calcium carbonate) 100 mg 10% children. Mineral Supplement Complex Tzyme™ is a trademark of Transformation Enzyme Corp. This with Enzymes Magnesium (as magnesium amino acid chelate) 20 mg 5% proprietary blend of highly active, functional, pH balanced, and GI tract stable enzymes is formulated to enhance the digestive 30 CAPSULES Zinc (as zinc citrate) 12 mg 80% process and impart systemic benefits.* Selenium (as selenium complex) 100 mcg 143% TransformationEnzymes.com*THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. THIS Manganese (as manganese citrate) 5 mg 250% PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Chromium (as chromium polynicotinate) 100 mcg 83% *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. Tzyme™ Enzyme Blend 152 mg † THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. (Protease, Pectinase, Peptidase, Phytase, Glucoamylase, Alpha-galactosidase, Hemicellulase, Cellulase) Give116mg Your Body the Nutrients It Needs Flax Seed † Alpha-Lipoic Acid 25 mg† Kelp Algae (Ascophyllum nodosum) 150 mcg† Boron (as boron citrate) † 5 mcg † Daily Value not established Other Ingredients: Cellulose & Water Item # 2000063

health Kidz Digest* Health Zymes 4 Kidz benQeuafliittysMatters Powder digestive enzyme dwDieigglelesasttsiiovsenuforopeaevfopnnesWodozuqrdriymrulttitmnthwnasuut.tleeThl*iotatnrsoryAalstiespleynilhrsernsayoaofttewnfovomaaecTirptrmorvehsbapatsaeenrowi.til*escooaiiofntcrpbohniatturi™ylscmisim.,ioteoaOyynudnotusaimauocirsslnlkptin’enrsionocpbtwa,riloopltytbhriocifaoovttericn supplements for ecxoinmteprnlealx internal heQaulatlihty Mattersenzymes andWith Transformation™, you know that Supplement Facts probioticBs aenndefits: quality is top priority. Our protease childrenality Mattersaoymoen twheay on the Serving Size: 332.7 mg (app. 1/8 tsp or 1/2 scoop) Supplementing with digestive benefits digestiveformulas have been used clinically for Servings Per Container: about 125 mnvoHeir.tro,mWiaswlnlhaeboevtotniedoryi,ntai™sll,nbyoootduy know that digestiveenzymes assists with the digestion nreitthowerefioteoynd. tOheufrododigestive enzyme In additioovnertotwsuepnptyo-rthtirnegeayehaearslthwyith consistent, Amount Per Serving % Daily Value of food, allow*ing the body to maintain svacebasnboorecbcesunrc. aunsoecdcucr.linically for healtha healthy digestive system.* ears with consistent, proven healthimmune sypsrteomve,norpetismulatls.f*loArall osuf pTpraonrtssformation’s Polysaccharolytic Blend 131 mg † penfhoefcTeerocemrliebarauvmalnlcealyakstnuenfifndolscoaryermssmbtuegalamcaukttaseiio,dnrnan’stedeig: estive Amylase, glucoamylase, alpha-galactosidase, e do not use any fillers in sbb. aeTtcthkeretocbeeltlutelrose and water invertase, lactase, pectinase, diastase, phytase, sor.u“Arodstokhcyteoorrurindgorcetodrients” are In additioncelltuolases, uhepmpiceollurlatsieng delivery chvoeevpgeoerwttehareripaonwcear psules. of nutPreiepPtirndoattessaes,BeleTnrdansformatio5n0,0™01019HmUTg † SdtigaTnpekesreoTtcnDiEthe•oeiwesnginNss•i•e,•tLPehashasoaaHE,HferCattftbdtobtyimecPfauoecevhefsiPrfosaogltreofamaioeleteu2iotracdlrretvhlerlaaunmberrutaceltuespditllhhhnoaolnctDttrs,atiouaihyimyyaihzlntycvanroerlostooyeanyedyyoD-nIgpn-tnNmffudmticeoWodobanA,yi-TifvarutreognoxerrerromcTalaieifftpmlnteaitsrdsrolstoudnrtafumTarhuu.snedsitirpnuydoslritcditnmeOnrysisonatucnilubtieatesaisio,iuoyutonmltdgipitntttfa.insnaottnreyGhoso*iKipohissgu-gtno**l*mfgpnreIioetiueoeTmmcndzuarauteruiisrhspaor*rcatrlpnmapfttasir:atbeaarisamritoibevctacaioroitcosepoetsentisntndatctitinnefsi(vtipouenrrvcceto™reioinrpcyiatfsgetffoyoudt™ybief:.gscthr)iilsrpsl.gsueealaa.ceuraas,*vttolrrsnerehosbvtaidisiasibigmnivoenmnehettseedelissycenDs IGEFSOPlTrcraeaoorRhcleIbncietedtiosVaoMifutnsltifetcepgirhcxEeoayLpcsfiasmCnotUaeHsEiamtrtoooptsbEhnPmfooaodnlursbPafoiedloocLsi,eraeueyunrNcgbcttxoeadtrlnlppraeaaebaaAaliacniftrehrr(tmdsncetosnsioyncFouozmZmyaiycrcaareycuCodrttipSnyeynaa-semtpsnel-nnuCYlyhcaklcWidaa,dA-Tadaco)eeeelssc,eearTtlluseneuMbltenstealrastnsGvordainTlah.dstnmoecodoffefIlr“iinTeoyoootctgdaalonddiieshssrrhirevntsntdgEianimt.GnfiehaiiostoaeonsoigttoKacg-rIececyfumtfpgcrhrtotreoeTiotrcmdl.heteiiolruau*ierhsaianmyiaclenmnmwanrstlspsinuacaeiasFftgbeiviubaogtiolt,rsgcocerooes.hmyturantotese*aotinsnotiapotenrasdvdp,e™eraanrrepyliesfeboamCcad,™uiadfgnctlntfahn“iiftelsbiiposlueDuhGettnivlteAd.nsesceorasne*saietimtloOt”olgervdsohwc.rhncotyarasterea:uaslain.eteezsaaabecpisncrriylgeaottalannaasphbetfolhmtecsnsioof,neldbrwroevowseroeoauwaeedledaaliiera,lntbssniewly,nhdteutcdondhhaminsbhadpguyazecdteyrTtattyimoorlatosoniRmtihebnethnbiadeiAnfienverogbiroohegestwNetensfeaiaaaaceSuiTesskastscsrnrtFtsuce,Rtiaraidzde•Ovhcie•yrnleotes,wheimhnlsRewnN.EasSahpezfvatWenMnoaoiyytsrees•scrurotdmsGiadf•euim,eatAvotrtKhl.bnHheeroctit•*oTanOBFL†taaSTSASPheOTagseeipeialohidUpeeemaDmfHteIlRS(Slipte.tsslapWrrdxtD5aaiaymOeaI*vvpuuohfustoe0iodSliiAet.SniiiigglpmsedumnnblCi,ya”nria0eaaedRatnreggPnaiNm(ateVa0errppsh3nscfelLttTdRrtsuS0adsate’tatt,booiPnee0PIlsdoyiOlss™ohuFaHzc,Bnr0lieyeprheieorIdDxUp,u0llrAryCelymih:enPmpnTUSCdnniFo2IorzeoclfArdeIeloCaeiaprstPCfuinsnrinLnettecTf)lovfeirhttdadRCysalasifCseecanaHntai3sbaimwntsOmegc0uAinbtessetaD0Llii*rSiieblstI:oohOmeDalhsie1eNmPeoRnT5nttuTOdPa/Siain4enc*-pocbp5AItV*ly/oeisYnpD9r)wtt0soDr*oo*gyEcrf3DF%1eta0t1:0eS4hsD<<<aUDb111mase53PGigggg031l*cPyAsmmml-VIR<Vgggtea1l%tus**†††e††**“G*aTptibOvdhchrhAaTeualeoeepreelldrtoabartaaobbhodncninrloxoeberotgcsithedanfirefiobywycsewoyeitosstrnfiaiimbhtminidcgcnyaheestyaiagrelattdneippthhtseldhiiaHlteeg*ofabahieTiOasgasgennnthhynaenwbatienunesneda’eoatcatuonsaosaKdoteschuleDnitselitddtstetsevdeariedtavasisrdruytriaervhipnatmeselgi,ficvtiazrfeegle,apvoai,dtwseeheAoanneansniDrolahdonurmiserrnkadoistutmsyordnnoezcilenyseeoaisgptpainnyguatdsec,nonilcte,iaipmbtmiseesrlionstwsrhbetnthsiceostshrhngnerbeairhenteetearaonmttt.igesnrveet,ohtsltn*riiapseo,ooyceotoa.nesgbub”n.su,nfkdni*r.oongsteetpsT,t,dtryhnh,phgbooiaymeeeorsadewi’prspnsnirpormrtteeioetwcnvashvdsmoeegannunodalmcluudtluitinisaannngsitrnsbdetteeacydnloeoosenrdosbfseitastdyssyitopetintisotahtimctainesentnhicniesaprFgee.da.-ollem*.ye-o*dd*THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD etgioinnwbitehgin with the quality and purity of every batch of the quality and purity of every batch of Polysaccharolytic Blend 90 mg **AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED Our core belief has always been D I G E S T I V E E N Z Y M E PAC K TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. “Give the body the nutrients it needs, ransformation™ discloses Tran1s-f8or0m0at-i7Toran7nE7snfoz-r1ymm4aet7ios4n.c™opmroducts. LypoZyme DigestZyme Tra1Dn-si8gfeos0rtm0a-tC7iTaorranb7noE-s7Gnfpoz-rry1moKmiddaz4uDeticgieos7sttsn.c.4™om Plantadophilus wPPSuroprwbpiolToetmwbircenai.totn1trisac-fn8os†LF*Br*0PiliPfDpafmApieadxaoremrsoicoclS0yyteebbrilaneanaV(iamest3coasedtD,t-let,e0ui,aig7e0rcdaiiloluu0iyn4acmoF2sotVn7tt.aIaa5iiPemnlsEuos)feyaet7,laasnnnibnTstavileisrsrez-p,ehralat1yeabnrcsdataesmoss,b4eecdti,eoealeolu7ltnpliashacasae4-.2sg,c,ah031lee0a120om0ct.mmmioccmcseagggilldlouoarlasieesme,di***e***t Tranwswfowr.mZyamtioens4EKnzidymz.ceosm.com*THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD activity in Food Chemicals clear away the waste, and help units whenever possible. www.transformationprobiotics.com OXythliteorl,InNgarteudriaelnMtsi:xeFdruBcteorsrye,FVlaevgoert,aNbaletuCraelllSultoraswe,bGerrraynFullaavror, 1-800-777-1474AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED the body manage its resources.” meenszymes TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. nnTbwreaitghnisnfowrimthation™ digestive Digestive enzymes and probiotics sym.muelas.s include a blend of support optimal digestion, but what , functional, pH balanced, about clearing the waste and supporting stable enzymes formulated the digestive process and the other systems of the body?* t systemic benefits.* Transformation™ protease enzyme blends sting - This step guarantees play a vital role in detoxifying the body, nd purity of every batch of ormation™ products. supporting optimal immune health, blood circulation, and managing a healthy ms.com inflammatory response.* adnmdinDistrruagtioAnd. ministration. *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD pdriesevaesnet. any disease. AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Optimal digestion is dependent upon effective digestive enzymes. MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION Supplement Facts Plantadophilus is a stabilized culture of lactobacillus plantarum, a TPP Probiotic is a formulation of a carefully mixed selection S u p p l e m e n t F a c t sTPP Probiotic 42.5 includes 10 strains of bacteria totaling Supplement Facts 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 of microorganisms friendly to the human GI tract.* These or- 42.5 billion cfu per capsule and the prebiotic Jerusalem DigestZyme is uniquely formulated to assist the body in TPP Digest includes highly active enzymes with a broad range of TPP Carbo-G is an enzyme blend with probiotics designed to help MANUFACTURED FOR TRANSFORMATION ENZYME CORP.Serving Size 1 Capsule Supplement Facts “friendly” bacterium that enhances the ecological balance of friendly ganisms enhance the ecological balance of friendly bacteria.* ServingTSPizPeT:r1anCsabpiosutilce™ is formulated with PreforPro® Supplement Facts Supplement Facts 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042Servings Per Container 60 Serving Size: 1 Capsule All Transformation™ formulas are carefully prepared to assure Serving Size 1 Capsule S u p p l e m e n t F a c t smaintain optimum digestion of all foods with a special focus on en- MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION Servings Per Container: 90 maximum quality and nutritional effectiveness.* CAbaartlipacnhscouekleeo.fs**“fTriehnisdfloy”rmbauclatehreialpins maintain the proper Serving Size: 1 Capsule Servings Per Container 30 couraging more complete digestion of complex carbohydrates found 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 the GI tract and supports Servings Per Container: 30 ABSOLUTELY NO FILLERS Manufactured for Transformation Enzyme Corp., THE GENESIS OF GOOD HEALTHRECOMMENDED USAGE: One (1) capsule upon rising or at 2900 Wilcrest Dr., Suite 220, Houston, TX 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION bedtime with at least 8 oz. of water or as directed by a health 2900 WILCREST DR., SUITE 220, HOUSTON, TEXAS 77042 care practitioner. Contents may be removed from capsule and MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATIONtaken by spoon immediately after mixing with a small amount 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042of tepid water. Store tightly sealed in a cool, dry place.REFRIGERATE FOR OPTIMUM ACTIVITY Keep out of reach of children. PreforPro® is a registered trademark of**Guaranteed minimum potency at the time of manufacture. Deerland Enzymes, Inc. LypoZyme is uniquely formulated with lipase for healthy fat maximum digestion of nutrients, production of energy, and specificities to handle all food preferences.* All Transformation™ Transformation advocates breastfeeding as the optimum source bacteria.* All Transformation™ formulas are carefully prepared to ProbioticStore tightly sealed in a cool, dry place. Serving Size: 3 Servingsa PpreerbCiooticntsahinoewrn: 6to0promote the growth of digestion.* The highly purified enzymes in the Transformation™ aid in immune support.* The highly purified enzymes in formulas areScaruefulply ppreplaeredmto aessunretmaxFimaumcqutalsity and Amount PerofSneutrrivtioinngfor healthy growth and developm%entD. WaeilycreVaatelduKeidz Supplement Faacstssure maximum quality and nutritional effectiveness.* Keep out of reach of children. product line are concentrated from mycological sources specifi- the Transformation™ product line are concentrated from ServinginSgirzaein: s2, Cseaepdssu,lelesgumes, vegetables, and other plant materials.* Tzyme™ PrDboritegeaeassttsfebeeedcBianluges.*neWdwheeuthnedrebrsretaansdt ftehderoera1for2erm2cuirlcmaufmgedst,atnhcisefsotrhmaut†laptrieovnent Amount Per Serving % Daily Value Serving Size 332.7 mg (app. 1/8 tsp or 1/2 scoop) Servings Per Cohnetaalitnhyedr:ig3es0tion and intestinal balance.* AmounbtthePeneesrmfiScaiealllravpnirndobglaiortgice sintrtaeisntsin%we.iDt*hTainoilgyheoVtuhareslruitnehebsoeth cally cultivated for optimum digestive activity in the human body.* Servings Per Container aAboButS12O5 LUTELY NO FILLERS Supplement*THESE STATEMENTS HAVE NOT BEEN All Transformation™ formulas are carefully prepared to assure mycological sources specifically cultivated for optimum nutritional effSeecrtvivinegnSeiszse.:*1 Capsule ServingTshiPseforrCmounlataainlseor:in6c0ludes herbs to help reduce the symptoms of (Proteaseasasnisdts wpiethpdtiigdeastsioen)to(5al5le,v1ia3te1sHymUptTom+s 1of1ocScaAsPioUna)l gas and EVALUATED BY THE FOOD AND DRUG PROFESSIONAL PROTOCOLAmount Per SerRAvEBiCSnOOgLMUMTEENLDYENDOUFSILALGEER:%SOnDe a(1i)lycaVpsaullue eupon rising maximum quality and nutritional effectiveness.* occasional food intolerances.* For those who are considering a glu- PROFESSIONAL PROTOCOLLipase (7,51ab8lsosaFutriInePgm.)*aAxlilmTuramnsqfuoarmlityataionndfnourmtriutiloansaalre6ef7fceacmrteivfgeunllyespsr.e*pared†to Tzyme™ Enzyme Blend 373 mg 90ANDOCMTAIINPNSITSUETNLRDEAETSIDOTNO. TDHIIASGPNROOSDEU, CTRTEISAT, Lactobacillus plaoanrhtaaetarbultehmdctiam(r6ee pbwriiatlhlciotaitntiolencaefsru.tC*8*oo)nzt.eon6fts0wm0ataemyr obgrearse†mdiorevcetdedfrobmy digestive activity in the human body.* All Transformation™ Servings Per Container: 60 Tzyme™ PoAlyBsSaOcLcUhTEaLrYolNyOticFILBLlEeRnSd 270 mg † Daily Value notacaespmsstuaallelbaalminsodhutenatkdeonf tbeypisdpwoaotnerim. mediately after mixing with PROFESSIONAL PROTOCOLTzLyamceto™baofPrcrireiglolnuabsdniolipytsilcmabnBastlaceprtnuerdomrima.o*te o†f Amount Per Serving % Daily Value ABSOLUTELY NO FILLERS T G OF G H THE GENESIS OF GOOD HEALTHformulas are carefully prepared to assure maximum quality ABSOLUTELY NO FILLERS PROFESSIONAL PROTOCOLAmountetnP-ferereSdeirevt,inCgarbo-G includes b%otDh athileyeVnazlyumees that break down the Protease 46,890 HUT † CURE, OR PREVENT ANY DISEASE. the44n2omrmgal balance † P PTzymRe™OPFrobEioSticSBIleOndN(4A2.5LbillionRcfOu**T) O3C23OmLg † Amount Per Serving % Daily Value Zymes 4 KidzDipeptidyl peptidase IV † Amount Per Serving RECOM%MDEailNy VDaElueD USAGE: Three (3) capsules at bedtime or as 3 billion cfu** RECOMMENDED USAGE: One (1) capsule with every meal or HE ENESISand nutritional effectiveness.* Amount Per Serving % Daily Value EnzymenpeoPlcryoespsarscieactrahyraytroiBddleeisgnedwshtigchluteenncapsroetegilnust3e.7*n2amsgwell a†s the DPP-IV protease Phytase 500 DPP-IV † PoAlymsyalcacshea, rgolulyctiocaBmleynladsed, airlpehcat-egadlacb1t3oy1siadmaghsee, a†lth care practitioner. Take with adequate liquid. as directed by a health care practitioner. Vegetable two-piece ABSOLUTELY NO FILLERS OOD EALTRHECOMMENEDnEzyDmeUPSrAopGriEet:arOynBele(n1d) capsule20w8ithmgevery meal or Alpha-galactosidase 90 FTU † Probiotic Blend (1 billion cfu) 299 mg † capsules may be pulled apart and ingredients mixed with food. snack with at leLaipsats8e oz. of liquid or as dire6c,t2e5d0 bFyIPa healt†h care APmroytelAaasBseeSOLUTELY NO FILLERS 12,200 DU † 525 GalU † LactobaRcEillCusOsMpoMroEgNenDeEsD USA38G0Em:ilOlionnec(f1u*)*cap†sule Bacillus coagulans, Bifidobacterium longum, Lactobacillus acidophilus, Bacillus subtilis, Store tightly sealed in a cool, dry place. 66,500 HUT † † LBaifcidtoobbaauwccpaitloeltuernsirursmoisarillinoavngasgroiduurimsreact tbeeddbtiym3200ae00hwmmeitiiallhlliilootahnntcccleaffuuar**es**tp8rao††czti.tioofner. Lactobacillus casei, Lactobacillus plantarum Keep out of reach of children. RECOMMENDED USAGE: Two (2) capsules with every Amylase RECOMMENDED USAGE: Mix 1/220sc,0oo0p0(aDppU. 1/8 tsp or 33†2.7 mg) Amylase 3495 DU † invertase, lactase, pectiVnaesge,edtiaasbtalsee,twphoyt-apseie, ce capsules may be pulled apart and ingredients Bifidobacterium bifidum, Lactobacillus plantarum, *Alpha-galibanycaytosoumsraihdlleaaamlsthoecuanrteopfrtoefpeisdswioantaelr. jDuostnpor4ito3ard8tod GfteoeaadlibnUogttoler oafsfdoirrm†ecutlead Pectinase *30 endo-PGU † Pecpetlildualassee,Bhleenmdicellulasemixed wit1h19fomog d.†Must be refrigerated to retain optimum activity. Lactobacillus acidophilus, Lactobacillus salivarius, ™ *THESE STATEMENTS HAVE NOT BEEN meal or as directed by a health care practitioner. Take with *practitioner. CoAnmteynlatssemay be removed fro5m,0c0a0pDsUule and †taken by *LipasReECOMMENDED USAGE: One 1(10)0c0aFpIsPule a†t the beginning of every Glucoamylase 12 AGU † OTHER INGREDRIEEFNRITGESR:ACTEEFLOLRUOLPOTIMSUEM&ACWTIVAITTYER Bifidobacterium infantis, Lactobacillus bulgaricus, PreforPro® 15 mg † EVALUATED BY THE FOOD AND DRUG adequate liquid. Vegetable two-piece capsules may be Phytase or mix in food because it will break down4t2heFfoToUd in the cont†ainer † Protease 50,000 HUT Store tightly sealed under refrigeration. ADMINISTRATION. THIS PRODUCT IS pulled apart and ingredients mixed with food. spoon immediaPterolyteaasfteer mixing with a sm2a0l,l0a0m0 oHuUnTt of tep†id water. ICnevlelurmcbtlaaayessreesaeplpoororanscntiimatiocmkneewdr.iitaChteoalntytleeanafttsestrm8maoixyzi.nbog1ef23wrl02ieqi00tmhuSCiodaUUvosemrdaafsrl††ol dmaimrecocautpensdtuoblefytaeanphdidetaawlktahetner. Glucoamymlaaksineg it less palatable. 25 AGU † Lipase 340 FIP † ProbioticLLaaccttoobbaaRRccEEiillllFCuussROcaIMGacsiMdEeoRiEpANhiTlDuIsEODNFNOOR21T2bO5RillPmEioTQinllIiUMocfnIuUR*c*MfEuD*A* CBTUI††TVITY Lactobacillus rhamnosus, Lactobacillus casei NOT INTENDED TO DIAGNOSE, TREAT, † **Guaranteed minimuKmeepootuetnocfyreaatcthheoftcimhiledroefnm. anufacture. CURE, OR PREVENT ANY DISEASE. † *THESE STATEMENTS HAVE NOT BEENDipeptidyl peptidase IV Jerusalem*ATrHticEhoSkEe tSubTeArTEMEN2T0 SmgHAVE NOT B†EEN LH01 - Myoviridae, LL5 - Siphoviridae, † Lipase (3,000 FIP) Store tightly sealed in a cool, dry place. ESntozryemtieghatclytivsiety†alieDsdamiilneyaaVsauclorueoedl,nidnortyFeopsoltaadcbCeli.shKheeemdeicpaolsutCoofdreexac(FhCoCf c)huinlditrse.n. Diastase 500 DPº † MaceraseEponszsyimblee.aScttoivrietytiigshmtlyeasseuarleedd in FaocoodolC, hderym4picl0aac0lse.CCKoeUdeepxo(FuCt oCf)reuanciths†wofhcehnildren. PowderDiastase 42 DPº † 300 DPP-IV Jerusalem Artichoke tuber 10 mg † T4D - Myoviridae, LL12 - Myoviridae LactapEsoneszsyimblee.aScttoivrietytiigshmtlyeasseuarleedd in FaocoodolC, hderym8p0icla0aclAse.LCKUoedeepx o(†FuCt oCf)reuanciths whenever in 100 USP † 53 mg † Keep out of reach of children. EnzymeTzyme™ is a OtraTdHemEaRrkINofGTRraEnDsfoIErmNaTtiSon: CEEnzLyLmUeLCOoSrpEor&atiWonA. TThEiRs proprietary in of children. Pectinase 14 endo-PGU † Alkaline protease Enzyme*THESE STATEMENTS HAVE NOT BEEN EnzymeBLDCaeeiactllsatuat-algsaselsueecaCEAN*nTVDOUaHAsMRTEeLEIISUNN,EAITOSTESTRENTRDPADATRBTEEEIYDOMVTTNEEHO.NNETTTDHSFAIIAOSNHGO216YPAN6291DVRD8550OEOAIACDBSSNDNLGUPEEUDUOºU,ACTTSDRTEBRE.IEUSAEGTN††††, Invertase 14 SU † Flax Seed EVALU30 AmgTE† D BY THE FOOD AND DRUG Probiotic† Daily Value not established SupplementEVALUATED BY THE FOOD AND DRUG blend of highlyEnazcytimve,afcutnivcittyioisnaml,eapsHurbeadlainnFcoeodd, aCnhdemGicIatlrsaCctosdteaxble enzymes is ADMINISTRATION. THIS PRODUCT IS EnzymeLactobaTcziyllmuse™aciisdaoptrhaidluesma(grkroowf Tnraonnsfmorimlka)tion E2n0zymmge Corp†oration. This proprietary EnzymeLactase 140 ALU ADMINISTRATION. THIS PRODUCT ISBifidobacterium infantis Store tightly sealed in*aTcHoEol,SdErySpTlaAceT.EMENTS HAVE NOT BEEN CNUORTEIN, TO6ER0NPCDREAEDPVSTEUONLTDEAIASNGYNDOISSEE,ATSREE. AT, Supplementformulated to (eFnChCa)nucneitsth.e digestive process and impart systemic benefits.* Protease 3.0 2 SAPU † Daily Value not established MANUFACTURED FOR TRANSFORMATION Bifidobabcletendriuomf hilgohnlyguacmtive, functional, pH balanced6, mangd GI tr†act stable enzymes is 60 CU 1 mg † † Daily Value not established *THESE ESNTZAYTMEEMCEORNPTOSRHATAIOVNE, 2N9O00TWBILECERNESETVALUAT- formulated to enhance the digestive process and impart systemic benefits.* SupplementCellulase 60 HCU 120 CAPSULESED BY TDHRE.,FSOUIOTED2A20N, HDODUSRTUOGN,ATXDM77I0N42ISTRATION. Hemicellulase Keep out of reach of cEhiVldAreLnU. ATED BY THE FOOD AND DRUG THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, † Daily Value not established Supplement SupplementMANUFACTUREDADFMOINRISTTRRAANTSIOFNO.RTMHAISTIPORNODUCT IS 60 CAPS*UTLHEES SE STATEMEN30TCSAHPSAUVLEES NOT BEEN EVALUATED BY THE FOODSENUIZTYEM2E20C,OHROPUOCNSROUTAORTTENIIN,O,TOTNERX,N2P7D97RE00ED04V2WTEONILTDCAIRANEGYSNDTOISDSEER,A.,TSREE.AT, SupplementOTHER*EITNDHGBERYSEETDHSIEETANFTTOESOM: DCEENALTNLSDUHDLAORVSUEEGN&AODWTMABITNEEIESRNTREAVTAILOUNA.T- SupplementInvertase NET WEIGHTHerbal Blend 63 mg ABSOLUTELY NO FINLLOERTS INTENDED TO DIAGNOSE, TREAT, LactoferrinE(fVroAmLmUiAlkT) ED BY TH1E0 mFgOOD AND DR† UG OTHER INGREDIENTS: CELLULOSE & WATER OTHER INGREDIENTS: DELAYED RELEASE CAPSULE THIS PRODUCT HASCNUO RADEDE, DOSRUGPARREVENT ANY DISEASE. † Daily ValANueDOnMTotIINeNsITtSaETbNlRisDhAeETdDIOTNO. TDHIAISGPNROOSDEU, CTRTEISAT, (HYPROMELLOSE, WATER, GELLAN GUM) (EFnCzCym) uenaiTTtcstRH.iviIEtSyAisPT,mRCeOaUsDuRUreECd,iTnOFIRSooPNdRCOEhTeVmIENicNTalTEs CNAoDNdeEYxDDTISOEDASIAEG. NOSE, 56 SU † Fennel (seed), Ginger (rhizome), Flax seed, OTHER ICNGURREED, OIERNTPSR:ECVEELNLTULAONSYED&ISWEAATSEER. **Guaranteed minimum potency at the time of manufacture. MANUFACTURED FOR TRANSFORMATION ENZYME CORP. 41.5G (1.46 OZ)Peppermint (leaf), Artichoke (leaves) extract 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 Hemicellulase 28 HCU † Bifidobacterium infantis 6 mg OR ARTIFICIAL COLORS Tzyme™ is a trademark of Transformation Enzyme Corporation. 30 CAPSULESTzyme™ is a trademark of Transformation Enzyme Corpo- This proprietary blend of GI tract stable, highly active, and func- ration. This proprietary blend of GI tract stable, highly active, TREAT, CURE, OR PREVENT ANY DISEASE. 60 CAPSULES 90 CAPSULES† Daily Value not established † Daily Value not established tional microorganisms is formulated to enhance the digestive and functional microorganisms is formulated to enhance the OTHER INGREDIENTS: CELLULOSE, WATER, OTHER INGREDIENTS: CELLULOSE, WATER process and impart systemic benefits.* digestive process and impart systemic benefits.* CALCIUM CITRATE AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Magnesium Stearate, Silica 1/17/11 1:51 PMStep 2 Quality Matters.DigestivePEAnzyImNe Pack S u p p l e m e n t F a c t sOur digestive enzyme formulas have been used clinically Supporting proper nutrition and living a fTorarnosvfeorrmtwSSaeteeinorrtnyvv’siiynnedggaigrsesSsPwitziveiteehr:ecC1nozonCysnmiasteatpeifnsnotu,remlpre:ruol4avse5ng/1ur2easr0aunlttse.*e:All of preventative lifestyle is vital for promoting With Transformation™, you know that quality is top priority. overall muscular, skeletal, and tissue health.*Item # 200M0A08N1AGEMENT* Purity - We do not use any fillers in our products. The The body needs a variety of nutrients and amino acids cellulose aAnmd owuatnetr PliseterdSuenrdveinr g“other ingredie%ntsD” arielyfoVralue to heal properly. In order to get this nutrition, we must PROGRAM the vegetaEriannzycampesuPlerso.prietary Blend 30 mg † completely digest our foods. Supporting digestion isDigestive Family Food ChemicCaelsllCuoladseex (FCC) units whenever pos2s8ib0le.CU † therefore key to promoting the body’s natural recovery and Potency - TrLanipsafosremation™ discloses the enzyme14ac0tivFityIPin † healing process.* This is especially important for those who experience: Efficacy - AAll mTryalnassfoermation™ digestive enzyme56fo0rmDuUlas † • muscle fatigue after exercise* • strained muscles or tendons*Item # 2000056 include a blenPdrootfehaigshely active, functional, pH 1b,a7la4n0ceHd,UanTd † • general aches and pains* GI tract staBbrleocecnzoylim(eflsowfoermriunlgatehdeatode)nhance the 9d5igemstigve † • occasional inflammation*Probiotic Family process anCdaimrroptart systemic benefits.* † • recovery from sports injuries* 95 mg † PAIN • oxidative stress* † LaboratorSypTiensatcinhgL-eTahf is step guarantees the qu9a5litymangd † The goal of enzyme supplementation is to promote purity of evGerryapbeatcSheoefdTrEanxstrfoarcmt ation™ products. 50 mg † optimal cellular function and support muscular health, function, and repair.* Mojave yucca 55 mg Butcher’s Broom (root) 36 mg PRroosperiHetiaprsy(Kfrueiltp) & Mineral Blend 53.56 mmgg †† • pDrigoepsetrivbereeankzdyomwens atankdendewlivitehrymoefanlsustruiepnptosrtthtehebodyTPPGastroisanenzymeandherbalproductformulatedtoas-Find Relief in Regularity (Kelp, Calcium Ascorbate, Magnesium Citrate, MANAGEMENT function.*AllTransformation™formulasarecarefullyprepared Supplement Facts TOPpPtimDaigl deisgteisntciolundiessdheipgehnlydeancttivuepoennzeyffmecetsivweitdhigaesbtriovaedernaznygtmoeeoasf.ssure maximum quality and nutritional effectiveness.* Serving Size: 1 Capsule needs to continually heal and repair.*specificitiestohandleallfoodpreferences.*AllTransformatioAn™BSOLUTELY NO FILLERS Servings Per Container: 60 sist occasional gastrointestinal discomfort and promote digestive Enzyme activity is measured † Daily Value not established P R O G R A M Digest ProbioticStoretightlysealedinacool, S u p p l e m e n t F a c t s TPP Probiotic is a formulation of a carefully mixed selection MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION % Daily VaSlueu p p l e m e n t F a c t s 2900 WILCREST DR., SUITE 220, HOUSTON, TEXAS 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORP. 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION 2900 WILCREST DR., SUITE 220, HOUSTON, TEXAS 77042 * • Systemic enzymes taken between meals supportspsnpraoaccotknitiwoimnitemhre.adCtiloaentaetselytn8atsfotemzr.amoyfibxliiqenugriedwmoitorhvaeasdsdmfirroeamclltaecmdapobsuyunaltehoaefnatedltphtiadckawe(EFrnaenCtbzeyCyr.m) uenaitcst.ivity is measured in Food Chemicals CodexServing Size 1 Capsuleof microorganisms friendly to the human GI tract.* These or- Amount Per Serving 2250 IU 4S5e%rving Size: 1 Capsule Servings Per Container 60 ganisms enhance the ecological balance of friendly bacteria.* 1.5 IU S5%ervings Per Container: 60 Vitamin A (100% as beta carotene) formulas are carefully prepared to assure maximum quality aRndECOMMENDED USAGE: One (1) All Transformation™ formulas are carefully prepared to assure Vitamin E (as d-alpha tocopheryl succinate) nutritional effectiveness.* with at least 8 oz. of water. Contents m%axiDmauimly Vqaulauleity and nutritional effectiveness.* Zinc Gluconate, Manganese Gluconate) PROFESSIONAL PROTOCOLABSOLUTELYNOFILLERS Amount Per Serving capsule with every meal may be removed from Tzyme™ Protease Blend 12A2BmSgOLUTELY†NO FILLERS PROFESSIONAL PROTOCOLTzyme™ Polysaccharolytic Blend 150 mg A†mount Per Serving % Daily Value (Protease and peptidase) (55,131 PROFESSIONAL PROTOCOLLipase (7,518 FIP) Tzyme™ Polysaccharolytic Blend Amylase Alpha-galactosidase Phytase capsule and taken by spoon immediately after mixing with a 2H0U,204T06734tRobca+70082aefEkrtd1DmmGFeCeet1TnpiUaggOmpUiSlbdrMeUaAywcMPwstaiUEiptttiheoo)NronaD.ne††††tErli.emDCamUsotneS8tdAeioanGzttesE. lo:ymfOaawfnytaeebtre(em1r r)oiexcrmianapogssvwdueilidretehfcuraotpemosdmncbarayilsplaisanumhgleeooauraltnanhttd (Phytase, Alpha-galactosidase, Amylase, Glucoamylase, Pec- Tzyme™ Probiotic Blend 442 mg † 3 billion cfu** † RECOMMENDED USAGE: One (1) capsule with every mealsomr all amount of tepid water. tinase, Diastase, Invertase, Lactase, Cellulase, Hemicellulase) Lactobacillus plantarum Tzyme™ Protease Blend 79 mg †Lactobacillus sporogenes 380 million cfu** † Lactobacillus salivarius 300 million cfu** † Tzyme™ is a trademark of Transformation Enzyme Corporation. This pTrozpyrimetaery™ is a trademark of Transformation Enzyme Corporation.* (Protease, peptidase) (44,383 HUT + 3.6 SAPU) proper blood flow throughout the body.* G a s t roblendofhighlyactive,functional,pHbalanced,andGItractstableenzyTmheissisproprietary blend of highly active, functional, pH balanced, formulated to enhance the digestive process and impart systemic beneafitns.d* GI tract stable enzymes is formulated to enhance the Enzyme*THESE STATEMENTS HAVE NOT BEEN EVALdUigAeTs-tive process and impart systemic benefits.* Enzyme SupplementSupplementETHDISBYPRTHOEDUFOCTODISANNODTDINRTUEGNADDEMDINTOISTDRIAAGTNIOO*NST.EH, ESE STATEMENTS HAVE NOT BEEN *Macerase Marshmallow root extract 80 mg †Bifidobacterium longum 200 million cfu** † Store tightly sealed in a cool, dry place. Glucoamylase 2R5EAFGRUIGERAT†E FOR OPTIMUM ACTIVITY in Food Chemicals Codex (FCC) units. Keep out of reach of children. Papaya (leaf) 80 mg †Lactobacillus casei 225 million cfu** † dry place. Keep out of reach of children. 40**0GCuUaranteed m†inimum potency at the time of manufacture. Pectinase 1S4toerendtiog-hPtlGy Usea†led in a cool, dry place. Ginger (root) 70 mg †Lactobacillus acidophilus 1 billion cfu** †Item # 2000051 TRANSFOOTRHMERATINIOGNREEDNIEZNYTMSE: CCEOLRLUPLOORSAET&IOWNATER TRANSFORMATION ENZYME CORPORATION • Probiotics taken at bedtime support a healwthityh Herbs60CAPSULESTREAT,CURE,ORPREVENTANYDISEASE. EVALUATEDBYTHEFOODANDDRUG ADMINISTRATION. THIS PRODUCT IS Beta-glucanase 2K5eeBpGoUut of rea†ch of children. ProbioticTurmeric (root) 60 mg Je†rusalem Artichoke tuber 20 mg † 40 mg La†ctoferrin (from milk) 10 mg † Lactase 610 ALU † Gotu kola (aerial part) extract Cellulase 295*TCHU ESE S†TATEMENTS HAVE NOT BEEN Diastase 168EDVPAº LUAT†ED BY THE FOOD AND DRUG Invertase 5268ANHSDOUCMTU IINNITSET††NRDAETIDOTNO. TDHIIASGPNROOSDEU, CTRTEISAT, SupplementFennel (seed) 40 mg ††Daily Value not established Hemicellulase 30 mg O†THER INGREDIENTS: CELLULOSE & WATER Artichoke leaves extract † Daily Value not established 60 CAPSULESTzyme™ AntiOx Blend 24.6 mg RTTohz†oyismt)per™oprisieatatrryabdleemndarokf CURE, OR PREVENT ANY DISEASE. (Flax Seed, Alpha-LipoicAcid, Asian Ginseng Root, Eleuthero of Transformation Enzyme Corporation. GI tract stable, highly active, and func- OTHER INGREDIENTS: CELLULOSE, WATER, CALCIUM CITRATE Aloe vera (leaf) 15 mg tpior††oncaelsmsicarnodorimgapnaisrtmssysistefmorimc buelanteedfitsto.*enhance the digestive Irish Moss 15 mg NOT INTENDED TO DIAGNOSE, TREAT, Lipase (125 FIP) 12.5 mg † balance of gut flora in the GI tract.* 60 CAPSULESCURE,ORPREVENTANYDISEASE. Peppermint (leaf) 10 mg † † Daily Value not established OTHER INGREDIENTS: CELLULOSE, WATER, CALCIUM CITRATEProtease Family 2T9r0a0nhWTesaialVcklferteeho8gsaoetcprn0tDaaamerrrb.0e,tR(l1eSaapE-)unrttCiawc7dteiacOooitp27n-iMts2pngiuo70irMenEelec•de-EenpriHe.1NecTnzorDaaut4yspdksEtseam7moDuynwil,4xeoUeiTestrehSdsxamaAasw.sadcGdiy7ethiEo7qrbe:u0femcoa4topt2eedud.llliebqdyuiad. 2T9r0a0nWsilcfreo8str0Dmr.0, Sa-uti7teio272n70E•-nH1zou4ystm7on,4eTesxa.sc7o70m4wtfAirs2eodser•dukeriattsoid,Oogiacpnenattaidlmhldemasarlmuuwpspaiecthpgrlfeeootshrr.ame*tnTafedrhnnosecRzmueyrpmevopsiefEtouastrlmhttiaentPinhngmdes,bupAhemsrenocianeublefiIliniaotrsgarRtilcsisons,yfcsatZlctuoneeddmlplesYrh*:,eevrebMnst E*TPPProteaseIFCisauniqueproprietaryformulationofactive RepairZyme is uniquely formulated with phytochemicals and S u p p l e m e n t F a c t sTPP Joint Health encourages increased flexibility, joint Supplement Facts Supplement Facts proteolytic enzymes, vitamins, minerals, and herbs designed to rebuilding nutrients for good muscular, skeletal, and tissue health.* SSeerrvvmociinnofggemcsmaSfPorbiztrerieltaar,:ngaC1eenoCdtanoatnrapsadiusnncupgeolperen:oon6rtfe0jmcotioinvtteiomtnisowsbuiitleihty.*NaTEnhdMisth®seynbherearagnlitdshtiyecgpfgorosrmhdeuulcllati-on Serving Size 1 Capsule Serving Size: 1 Capsule Plant enzymes maximize digestion of nutrients, production of ener- Servings Per Container: 30 • Enzyme-delivered nutrition*supportahealthymuscularsystem.* gy, and aid in immune support.* The highly purified enzymes in the Servings Per Container 120 ABSOLUTELY NO FILLERS Transformation™ product line are concentrated from mycological Amotuionnt aPlesor Sinecrlvuidnegs highly active lipas%e aDnadilpyroVtaelausee enzymes Amount Per Serving % Daily ValueProtease Keeps You CoAvvailaeble irn beottlesdof 45 & 120 capsules. NUTRITIONAL BUILDING BLOCKS TORECOMMENDEDUSAGE:One(1)capsule3timesaday VViittaammtpiionnrosACdu(u(p1ac0pst0oimo%rntapagosnrfoebepsenieutaermrbcgaalyors.oo*ctodernbfelao)twe) for ef7fe,9c0ti0veIUnutr1ie5n8t%delivery and Enzyme Proprietary Blend 30 mg † Amount Per Serving % Daily Value taken on an empty stomach or as directed by a health care 9 mg 15% Lipase 140 FIP † Cellulase 280 CU † practitioner. Contents may be removed from capsule and Amylase 560 DU † Protease 1,740 HUT † taken by spoon immediately after mixing with a small amount † Broccoli (flowering head) 95 mg † • Overall wellness and vitality*oftepidwater. Carrot 95 mg † Spinach Leaf 95 mg † *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION.Enzyme activity is measured in Food Chemicals Codex (FCC) units. Grape Seed Extract 50 mg Store tightly sealed in a cool, dry place. NO FILLERS/NON-ALLERGENIC Protease IFC* RepairZyme* Joint Health REPAIR CELLS, TISSUES & MUSCLES*THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENTANY DISEASE.Keepoutofreachofchildren. Tzyme™ is a trademark of Transformation Enzyme Corporation. This proprietary blend of highly active, functional, pH balanced, and GI tract stable enzymes is formulated to enhance the digestive process and impart systemic benefits.* Enzyme Supplement Enzyme Supplement with Enzyme Supplement*THESE STATEMENTS HAVE NOT BEEN with Vitamins Herbs & Minerals with NEM See inside for more on our Joint Health,EVALUATEDBYTHEFOODANDDRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT,Item # 2000055 60 CAPSULES 30 CAPSULES RepairZyme, and Protease IFC support formulas!*CURE,ORPREVENTANYDISEASE. sources specifically cultivated for optimum digestive activity in the human body.* All Transformation™ formulas are carefully prepared PROFESSIONAL PROTOCOL THE GENESIS OF GOOD HEALTH PROFESSIONAL PROTOCOLto assure maximum quality and nutritional effectiveness.* ABSOLUTELY NO FILLERS *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND D* RUG ADMINISTRATION.RECOMMENDED USAGE: One (1) capsule per day or as directed by a health care practitioner. Take with adequate liquid. Vegetable THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE.two-piece capsules may be pulled apart and ingredients mixed with food. VitamNinOEA(aRsTdI-FaIlCphIAa LtocINopGhRerEylDsIuEcNcinTaSte) 2 IU 7% Tzyme™ Protease Blend 175 mg † SZienlcen(RlaeiusEamsCzti(nOa8csMcosiMzter.laEeotneNfi)uDlimqEucDiidtrUaotSre)AasGdEir:eOctneed(b11y0)6.c5amamhpceggsaullteh p2c3e3a%%rredapyrawcittihtioanter. (Protease and peptidase) (68,750 HUT) Lipase (250 FIP) 25 mg † TzymCeToMnPteronttesasmeaBylebned removed from ca1p8s2ulmegand ta†ken by spoon NEM® brand eggshell membrane 500 mg † (proimteamseeds,iabtreolmyealaftienr, pmaipxaining) with a small amount of tepid water. (3,108,000 FCCPU) (58,359 HUT) † Daily Value not established Other Ingredients: Cellulose, Beet Root Fiber, Water TzymSeTtoMrAenttiiOghxtBlylesnedaled in a cool, dry p2la7c2em. g † (KeKlpe, eIrpishoumtoosfs,reRauctihn,oGfrcahpieldsreeend. extract, Mojave yucca 55 mg † Enzyme activity is measured in Food Chemicals Codex (FCC) units. Quercetin, Alpha-lipoic acid, Citrus bioflavonoid † Enzyme activity is measured in Food Chemicals Codex Store tightly sealed in a cool, dry place. Keep out of reach of children. comp*leTxH, REosSe EhipsS(TfruAitT), SEOMD,EHNesTpeSridiHn cAomVpElexN, OT BEEN Butcher’s Broom (root) 36 mg † (FCC) units. TumeEricVrAooLt,UL-gAluTtaEthDioneB, AYsiaTnHgiEnseFngO(rOooDt), AND DRUG † *THESE STATEMENTS HAVE NOT BEEN EVALUAT- EtelaeuetAxhterDarocMt(,roCIoaNtt)a,IlSCasoTeQ,R1F0lAa, xGTsienIegOdk,oNGb.iinlogTbkaHolbeIiSalof,bGParlReeeaOnf DUCT IS ®Rose Hips (fruit) 36 mg Tzyme™ is a trademark of Transformation Enzyme ED BY THE FOOD AND DRUG ADMINISTRATION. extraNct,OLyTcopINenTesE, LNuteDinE) D TO DIAGNOSE, TREAT, Proprietary Kelp and Mineral Blend 5.5 mg Corporation. This proprietary blend of highly active, THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, functional, pH balanced, and GI tract stable enzymes is TREAT, CURE, OR PREVENT ANY DISEASE. 120 CAPSULES† DailyCVaUluRe nEot,eOstaRblisPheRdEVENT ANY DISEASE. (Kelp, Calcium Ascorbate, Magnesium Citrate, formulated to enhance the digestive process and impart systemic benefits.* OTHER INGREDIENTS: CELLULOSE, WATER, Zinc Gluconate, Manganese Gluconate) NEM® is a trademark of ESM Technologies, LLC and CALCIUM CITRATE is registered in the United States and other countries. † Daily Value not established OTHER INGREDIENTS: CELLULOSE & WATERZymes 4 KidzItem # 2000049Pain Management ProgramWeallknowwhatitfeels How do you Ask your practitioner reverse it?Transformation’s Transcendence product line today about theItem # 2000040 like to be stressed. Thrive in 63 program was inspired by the belief we are uniquely and and how you canRepairZyme For some of us we may wonderfully made, and that within each of us is feel anxious or tense. Our R Z E NEbenefit from it.Item # 2000059 muscles may become stiff, the potential for greatness. calm your world maybe even sore. vsibyOrnauenrrgtd,eTaciretialhcitlcahnaoirntqybfguisetsrauehlpctdiethpoiyelesrenoirmtfggesleniocdfnestoetesasdaidsgannnnradeaeendtcwsudrytersoemat–hstineupugdtptseuopwnmotmditrdehtasdyan.cs*yafunifnbnceotiton All Trainmsfporrmovaetiodno™rfoerlmimuilansaateredc.arefullyGastro Sometimes our stomach prepared to assure maximum quality and gets in knots and we feel Renmuotrvitiniogntahleefofeffcetinvdeinnegssa.*gents is the firstItem # 2000054 sick. And for others, our priority, which involves changing and adhering to a clean, nutrient-dense, regenerative diet. The tempers may flare. second step is supporting the digestive process and replacing the beneficial bacteria. You must ensure optimal and complete digestion or even the healthiest of foods will continue to cause problems. This second step of supporting the W W W . TdRigAeNstSivFeOpRrMocAeTsIsOisNkEeNyZtoY MadEdSr.eCsOsinMg the gut dysfunction fast and effectively. “The Time to Change is Now”Transcendence ReZENStress is an everyday thing A Program Designed To – running late, bad drivers, Restore HealthItem # 2000410 car issues, etc. Some things This program will provide you with a 21-day From The Inside Out are within our control and meal plan, food lists, recipes and a food and supplement journal. The meal plan can be Meal Plans • Daily MenusThrive in 63 others simply are not. followed exactly, but does not have to be. You Food Journal • Shopping List may swap out any food item for another food It is how we handle the item in the same category. If the recipe is too SupplementsProgram Overview for Patientsstress that is important. complicated, simply cook the food item in your favorite way.Item # 20000585 *ATNHDESDERSURTGAeTAEcDMiMpEINNeTISSsTHRIAAnVTEIcONNlOu. TTdHBIEeSEP:NRSEOVDmAULCUoTAoTISEtDNhOBiYTeTINsHT,EEFENODgOEDDgs, Entrées TO DIAGSNOaSlEa, TdRsEA/TV, CeURgE,eOtRaPbRElVeEsNT, ASNoY uDIpSEsASaE.nd Snacks Copyright © Transformation Enzyme Corporation

SHELF TALKERSDigestive Enzyme Enzyme support for a Proteolytic Enzymes support the digestion of healthy digestive system. proteins for reduced risk of food sensitivities, toxins,Your Next and free radicals.Step forMaximum Lipolytic Enzymes encourage more completeNutrition digestion of fats and lipids to support pancreas, liver, and gall bladder health and wellness. Polysaccharolytic Enzymes support the digestion of carbohydrates for reduced food intolerances and relief from occasional indigestion and gas. Take one capsule with every meal. These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease.Is something Get Your Balance Back Beneficial bacteria often become imbalanced by poormissing in diet choices and environmental lifestyle stressors.your digestive Issues can arise when opportunistic microorganismshealth? feed on undigested food molecules, creating gas.Probiotics ƒ Carefully selected GI stable microorganisms mirrors those found in a healthy GI tract. ƒ Organisms enhance the ecological balance of friendly bacteria, benefiting digestion, elimination, and immune function. ƒ Populate the gut with “friendly” naturally occurring bacteria. ƒ Restoring gut health could start with just one a day. These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease.Vitamins & Herbs Get Back in the Action Specific herbs, glandulars, nutrients,Plus Enzymes antioxidents, and enzymes help give extra support to the lymphatic system for optimalNourish and immune function.Support HealthyImmunity ƒ Fend off infections brought on by stress, such as the flu or common cold. ƒ Use when traveling or more susceptible to illness and keep your immune system ready. ƒ Shorten the duration of acute infections. These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease.When the Natural Viral Defense Your immune systemCold & Flu are deserves a fighting chance.Just Not for You ƒ Viral detoxification ƒ Supportive antioxidants ƒ Specific herbs ƒ Enzyme delivery blend ƒ No fillers For short term use as viral prevention or accelerated recovery. These statements have not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease.Digestive Enzyme Shelf TalkerYour Next Step for Maximum NutritionProbiotics Shelf TalkerIs Something Missing in Your Digestive Health?Protease IM Shelf TalkerNourish and Support Healthy ImmunityImmune AV Shelf TalkerWhen the Cold & Flu Are Just Not for You

CONVERSATION STARTERS Rising concerns over health risks associated with the chemical We are our environment!Bisphenol-A (BPA) prompted us to research our current packaging.Transformation™ is excited to announce our bottles are BPA Free! We don’t always have control over the environment we live and work in, but we can support our body in dealing with the toxins we may encounter. This in turn can support the health of our immune system. Discover the secret to healthy, Discover the secret to healthy, gentle detoxification with diet gentle detoxification with diet and enzymes from a clinical and enzymes from a clinical dietitian’s perspective! dietitian’s perspective! Buy 2 Detox Programs Buy 2 Detox Programs and get a free book! and get a free book! For more about BPA and Transformation™ visitTransformationEnzymes.com/products/quality and Call 80F0o-r7m7or7e -in1fo4rm7a4tion on our Call 800-777-1474 TratnosnfogartmeurtaatlsioDtneaEtonrxztysemudpeps!o.crot mpr/oegdraumca,tgioont#odetox to get started! DrDicQie.com/bpa-harmful-to-americas-children Visit DetoxByLisa.com for a Visit DetoxByLisa.com for a special sneak preview! special sneak preview! The Ripple Effect The Ripple Effect Discover the secret to healthy, of Toxicity of ToxicityDiscover the secret to healthy, gentle detoxification with diet and enzymes from a clinical gentle detoxification with diet and enzymes from a clinical dietitian’s perspective! dietitian’s perspective! Buy 2 Detox Programs Buy 2 Detox Programs and get a free book! and get a free book! And what you youCall 800-777-1474 Call 800-777-1474 to get started! can do about it Atno gdet stwarthed!at VissiptceDceaiatolnxsBnyedLaiksaop.creovamiebfwo!roa ut it Visit DetoxByLisa.com for a Lisa Helffrich, RD special sneak preview! Lisa Helffrich, RD Professional Protocol The Ripple ELifverfSuepporct t The RippleDkEinDffoeywcot?uorsnackwith Professional Protocol DkinDoywo?uof Toxicity DkinDoywo?uof Tomofoxtdenenirenrceeddspiifeoottrnadsyniibgdleelsiftfeoivsretayslneuiphnpacobrerittas.saerdefromcapsuleLiver Support* Professional Protocol Professional Protocol *Professional Protocol Professional Protocol Professional Protocol Professional Protocol Professional Protocol Professional Protocolor snack with at least 8 oz. Professional Protocol with at least 8 oz. of water. Contents may be removed from capsule and from capsule and taken byN-Acetyl Cysteine Supplement at least 8 oz. ospf oliqounidim. Cmoendtieantetslymaaftyerbme irxeinmgowveitdh- Digest* at least 8 oz. ospf oliqounidim. Cmoendtieantetslymaaftyerbme irxeinmgowveitdh- Digest* Protease Probiotic sopfolioqnuiidm. mCoendtiaetnetlsymafateyrbmeixreinmgowveithd a Digest*with Herbs & Enzymes and taken by a ProNt-Aecaetysl eCysteine SupplePmrenot biotic or snack with and taken by a Gastro* ESunpzypmleement from capsule ESunpzypmleement Enzyme SPuropbpiloetmicent Probiotic 42.5™ - 60 Capsules 60 Capsules 60 Capsules Supplement Enzymweith Herbs & Enzymes SPuropbpiloetmicent 60 Capsules tract Enzyme Supplement Probiotic SEunpzpylmeme ent 6S0uCpapplseumle6ens0t Capsules 60 Capsules 60 Capsules with Herbs Supplement 60 Capsules 60 Capsules n. se, 30 Capsulesfactors such as poor diet, processed Professional Protocol factors such as poor diet, processed Professional Protocol Transformation’s Professional Protocol Professional Protocol foods, stressful lifestyle and the Liver Support* foods, stressful lifestyle and theTheGenesisOFGOOdhealThTheGenesisOFGOOdhealTh environment can put additional Nw-itAhcHeteyrlbCsy&steEinnezySmupeps lement L Drain K Drain Liver Support* Professional ProtocolTheGenesisOFGOOdhealThTheGenesisOFGOOdhealTh Protease Carbo-G* environment can put additionalion. L Drain K Drain Enzymenzyme activity is measured in FaocoodolC, dhreympiclaaclse.CKoedeepxo(FutCoCf)reuanciths whenever Enzymedemands on our detoxifying organs. Nw-itAhcHeteyrlbCsy&steEinnezySmupeps lement tore tightly sealed in of children. Supplement gnose, 60 Capsules Herbal Herbal Herbal Herbal Supplement ion. Supplement ion. Supplement nose, Gastro™ion. Supplement is an enzyme New & gnose, nose, Supplement Improved 60 Capsules Net CoNteNt: 1 FL oz 29.574 mL Net CoNteNt: 1 FL oz 29.574 mL Net CoNteNt: 1 FL oz 29.574 mL Net CoNteNt: 1 FL oz 29.574 mL - 90 Capsules Formula demands on our detoxifying organs. 60 Capsules se, supplement with herbs rteadflolwermvitihautlaaethoeecdcatalotshhiyoenlpalfo Tgoengtelteydoeutropx,actiaelnl tTsTrLrasaifnvotnaesrsmfrrfotoSeurrmdulmapawtapitoitiotionhorntnoa™™’fsithhnoPeecdralroaublftydseh!e*syassniaodnsnayulntPerirreogntisottscicol formagatisotnro™itnotdeastyi!n*al discomfort and supportTransformation’s Professional Protocol r sLiver Support™ includes a synergistic formulation of herbs and nutrients known for their ability to protect the And what you And what you (800)liver and support detoxification.*777-1474That’s why this product is prominently can do about it can do about itfeatured in Transformation’s new g et yoPruofresspioanaltiPerontotcosl more information on Transformatio n ’ n tle detox, call T* r Digestive Health Program™ please tract Enzyme Supplement ask for a Program Brochure™.* with Herbs To sta ans Gastroge (800) 777-1474known for their ability to protect the (800) 777-147460 Capsules liver and support detoxification.* the healing of the [email protected] lining.* moreinfo@teTcheant’szywmhyetsh.iscopmroduct is prominently [email protected] featured in Transformation’s new That’s why this product is prominently featured in Transformation’s newHealthy Detox Program™.* Healthy Detox Program™.* Lisa Helf frDiicgehs,tiRveDHealth Program™.* Lisa Helffrich, RDwww.TransformaTionenzymes.com www.TransformaTionenzymes.com www.TransformaTionenzymes.com *These sTaTemenTs have noT been evaluaTed by The Food and drug adminisTraTion. *These sTaTemenTs have noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease. *These sTaTemenTs have noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease.

MMINISSEINRG AYOLURS? • Whole food sources with NO Fillers • Enzyme blend for improved assimilation • 20,000 HUT’s of protease for additional systemic support* Now there’s Transformation’s a better way Bioavailable,Supplement Facts to get your Minerals are essential for a healthy balanced diet. Manufactured for Transformation Enzyme Corp. Transformation’s Mineral Complex is a multi-mineral formula.* Serving Size 1 Capsule 2900 Wilcrest Dr., Suite 220, Houston, TX 77042 All Transformation formulations are carefully prepared to assure Servings Per Container 30 maximum quality and nutritional effectiveness.* Amount Per Serving ABSOLUTELY NO FILLERS % Daily Value RECOMMENDED USAGE: One (1) capsule a day or as directed by healthcare practitioner. Contents may be removed from Vitamin C (from acerola and rosehips fruit ext.) 20 mg 33% capsule and taken by spoon immediately after mixing with a small amount of tepid water. 10 mg 500% PROFESSIONAL PROTOCOL Enzyme-DeliveredVitaminB6(aspyridoxinehydrochloride) Store tightly sealed in a cool, dry place. Keep out of reach of Calcium (as calcium amino acid chelate 100 mg 10% children. Mineral Complex and calcium carbonate) Tzyme™ is a trademark of Transformation Enzyme Corp. This Mineral Supplement Magnesium (as magnesium amino acid chelate) 20 mg 5% proprietary blend of highly active, functional, pH balanced, and with Enzymes GI tract stable enzymes is formulated to enhance the digestive Zinc (as zinc citrate) 12 mg 80% process and impart systemic benefits.* 30 CAPSULES Selenium (as selenium complex) 100 mcg 143% *THESE STATEMENTS HAVE NOT BEEN EVALUATED Manganese (as manganese citrate) 5 mg 250% BY THE FOOD AND DRUG ADMINISTRATION. THIS Chromium (as chromium polynicotinate) 100 mcg 83% PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, Tzyme™ Enzyme Blend 152 mg † CURE, OR PREVENT ANY DISEASE. (Protease, Pectinase, Peptidase, Phytase, Glucoamylase, Multi-Miner alAlpha-galactosidase, Hemicellulase, Cellulase) Formula Flax Seed 116 mg † † Alpha-Lipoic Acid 25 mg † † Kelp Algae (Ascophyllum nodosum) 150 mcg Boron (as boron citrate) 5 mcg † Daily Value not established Other Ingredients: Cellulose & Water Professional Protocol daily minerals. Professional Protocol Immune AAV * Immune AAV **THIS STATEMENT HAS NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. a Vitamin A Complex Herbal Supplement with THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Vitamins & Minerals a Vitamin A Complex 60 Capsules Learn more about Mineral Complex at TraHnersbafl SourppmlemaenttiwoithnEnzymes.com Vitamins & Minerals 60 Capsules New! got water?New! The Urinary SystemFamily Size Family Size Carbo-G™ Carbo-G™ Nearly every function in Professional Protocol the human body takes Professional Protocol place in water, requires Immune AAV * a Vitamin A Complex water or produces water. Immune AAV * Herbal Supplement with Vitamins & Minerals Water is the main com- a Vitamin A Complex 60 Capsules 180Now get 180Now getponent of every body Herbal Supplement with fluid such as saliva, Vitamins & Minerals K•Drain capsules! blood, and gastric juices. 60 Capsules Formulated to helpProfessional Protocol Professional Protocol One of the main avenues of natural detoxification The Genesis of Good Health the kidneys performCarbo-G* Carbo-G* capsis uvialethse!kidneys and K•DrainThe Genesis of Good Health their daily function urinary output – this of detoxification, fluid / pH balance,Enzyme Enzyme cannot be effectively Dietary K•Drain and the productionSupplement Supplement accomplished without Supplement Dietary 180 Capsules proper fluid intake. 4 oz. Supplement180 Capsules 1 oz. Family Size Family Size of urine • Concentrated herbal extracts in a glycerin NDeigwes!tZyme™ NDeigwes!tZyme™ base makes K-Drain an easy to use, well- tolerated, and very effective support productFamily Size Family Size • asparagus, Goldenrod, Juniper, and Buchu are anti-inflammatory, diuretic, and immune supportive ingredients • Beneficial for fluid retention, urinary infections, kidney stones, and a “flushing” of the urinaryC a r b o - GTheGenesisOFGOOdhealTh C a r b o - GTheGenesisOFGOOdhealTh system (Herbal Physician’s Desk Reference) 240DigestZyme™* 240DigestZyme™* ™ ™ 800-777-1474 11S Y S T E M Enzyme Now get Enzyme Now get capsules! capsules! [email protected] CaTaLYST www.transformationenzymes.comSupplement Now get Supplement Now get240 Capsules 240 Capsules180800-777-1474Professional Protocol 180800-777-1474Professional Protocol TransformationEnzymes.com TransformationEnzymes.comCarbo-G* Carbo-G* capsules! capsules!Enzyme EnzymeSupplement Supplement180 Capsules 180 Capsules

find relief in REGULARITY with TRANSFORMATION™ Probiotics Plantadophilus is a stabilized culture of lactobacillus plantarum, a TPP Probiotic is a formulation of a carefully mixed selection S u p p l e m e n t F a c t sTPP Probiotic 42.5 includes 10 strains of bacteria totaling Supplement Facts MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION “friendly” bacterium that enhances the ecological balance of friendly of microorganisms friendly to the human GI tract.* These or- 42.5 billion cfu per capsule and the prebiotic Jerusalem 2900 WILCREST DR., SUITE 220, HOUSTON, TEXAS 77042 bacteria.* All Transformation™ formulas are carefully prepared to ganisms enhance the ecological balance of friendly bacteria.* Artichoke.** This formula helps maintain the proper Serving Size: 1 Capsule Supplement Facts Supplement Facts assure maximum quality and nutritional effectiveness.* All Transformation™ formulas are carefully prepared to assure Servings PeaTPrpPCreTobrinoattnaicsinbsheioort:wic6n™0toispforormmuoltaetethdewgirthowPtrhefoofrPro® MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATIONServing Size 1 Capsule maximum quality and nutritional effectiveness.* Serving Size: 3 Capsbualleansce of “friendly” bacteria in the GI tract and supports Amount PebthreenSseemficraviallilnapngrdoblaiortgicesintrtaeisnt%sinweD.it*haTiinolygheoVtuhareslruitnehebsoeth 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042Serving Size: 1 CapsuleServings Per Container 30 ABSOLUTELY NO FILLERS Servings Per Containheera:lth3y0digestion and intestinal balance.* Servings Per Container: 30 ABSOLUTELY NO FILLERS Store tightly sealed in a cool, dry place. RECOMMENDED USAGE: Three (3) capsules at bedtime or as PROFESSIONAL PROTOCOLABSOLUTELY NO FILLERS PROFESSIONAL PROTOCOLTzyme™ ProobriogtaicniBslmensdpromote th4e42nmorgmal balance o†f Keep out of reach of children.P PAmount Per Serving% Daily ValueAmount Per Serving% Daily Value directed by a health care practitioner. Take with adequate liquid. THE GENESIS OF GOOD HEALTHRECOMMENDED USAGE: One (1) capsule upon rising or at PreforPro® is a registered trademark ofTzymReO™FPrEobSioSticIOBleNndA(4L2.5 biRllioOn cTfuO**)CO3L23 mg † Vegetable two-piece capsules may be pulled apart and ingredients bedtime with at least 8 oz. of water or as directed by a health Amount Per ServingRECOMMENDED US%AGDE:aOilnye V(1a) cluapesule upon rising Lactobacillufrsiepnldalnytabraucmteria.* 3 billion cfu** † Deerland Enzymes, Inc.Probiotic Blend (1 billion cfu) 299 mg † mixed with food. Must be refrigerated to retain optimum activity. care practitioner. Contents may be removed from capsule and Lactobacillus plantaruaormhaeta(b6ltehdbctiiamlrlieeopwnriatchcftaiuttio*len*a)esr.tC86oo0nzt0.eonmftswgmataeyr†obrearsemdiorevcetdedfrobmy Probiotic 42.5LactobacilluuRspEosCnpOorriMsoigMnegEnoNersDaEtDbeUdSt3im8A0GemEwi:iltlOhionnaetclf(eu1a*)s*cta8pos†zu.leof Bacillus coagulans, Bifidobacterium longum, Lactobacillus acidophilus, Bacillus subtilis, Plantadophilustaken by spoon immediately after mixing with a small amount Lactobacillus casei, Lactobacillus plantarum Find the *THESE STATEMENTS HAVE NOT BEEN of tepid water. P ro b i o t i ccapsule and taken by spoon immediately after mixing with Lactobacilluwsastearlivoarraiussdirected b3y00amheillaioltnh ccfaur*e* prac†titioner. Transbiotic™Bifidobacterium bifidum, Lactobacillus plantarum,Perfect Balance EVALUATED BY THE FOOD AND DRUG BifidobacteRriuEmFRloIGngEuRmATION N2O0T0RmEilQlioUnIRcfEu*D* BUT† Lactobacillus acidophilus, Lactobacillus salivarius, PreforPro® 15 mg † ADMINISTRATION. THIS PRODUCT IS REFRIGERATE FOR OPTIMUM ACTIVITY † Daily Value not estaabslmisahlleamdount of tepid water. LactobacilluRsEcCaOseMi MENDED FO22R5OmPilTlioIMnUcfMu*A* CTI†VITY Bifidobacterium infantis, Lactobacillus bulgaricus, LH01 - Myoviridae, LL5 - Siphoviridae, NOT INTENDED TO DIAGNOSE, TREAT, REFRIGERATE FOR OPTIMUM ACTIVITY Lactobacillus rhamnosus, Lactobacillus casei T4D - Myoviridae, LL12 - Myoviridae CURE, OR PREVENT ANY DISEASE. **Guaranteed minimum potency at the time of manufacture. ProbioticJerusalem Artichoke tuber 10 mg † Store tightly sealed in a cool, dry place. OTHER INGREDIENSTtoSre:tiCghEtlyLsLeaUleLdOunSdeEr re&frigWerAatTionE.R ProbioticJeLruascatolebmacAillrutisE*cThVaHocAkiEdLeSoUtpuEAhbiTSeluErTsADTBEYMTE21HN0bETimllSiFgoOnHOAcfVDu*E*ANNODTDBR††EUEGN **Guaranteed minimum poKteeenpcyouattotfhreeatcimh eofocfhmildarennu.facture. SupplementLactoferrin (froAmDmMilIkN)ISTRATION1.0TmHgIS PRODUCT†IS † Daily Value not established † Daily Value not established ProbioticKeep out of reach of children. SupplementOTHER INGREDIENTS: CELLULOSE & WATER Supplement*THESE STATEMENTS HAVE NOT BEEN Store tightly sealed in a coo*lT, dHryEpSlaEceS.TATEMENTS HAVE NOT BEEN † Daily Value nNCoOUt eRTsEtIaN,bOTliEsRhNePDdREEDVTEONTDAIANGYNDOISSEE,ATSREE. AT, OTHER INGREDIENTS: DELAYED RELEASE CAPSULE Keep out of reach of childreEnV. ALUATED BY THE FOOD AND DRUG **Guaranteed minimum potency at the time of manufacture. (HYPROMELLOSE, WATER, GELLAN GUM) EVALUATED BY THE FOOD AND DRUG 30 CAPSULESOTHER INGREDIENTS: CELLULOSE & WATER 30 CAPSULESTzyme™ is a trademark of Transformation Enzyme Corpo- MANUFACTURED FOR TRANSFORMATION ENZYME CORP. 90ANCDOMATIPINNSITSUETLNREDASTEIDOTNO. TDHIIASGPNROOSDEU, CTRTEISAT, SPuropbpiloetmicentEMNAZNYUMFEACCTOURRPEODRFAONACTRDIOUOMRTTNEIRIN,N,A2ITOS9NERT0SNR0PFDAWROETEIRDIOLVMCTNEOAR.NTTETDHISOAIIASTNNGYPDNRRDOO.ISS,DEEU,ACTSRTEE.ISAT, ration. This proprietary blend of GI tract stable, highly active, 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 Tzyme™ is a trademark of Transformation Enzyme Corporation. CURE, OR PREVENT ANY DISEASE. SUITE 220, HOUSTON, TX 77042 This proprietary blend of GI tract stable, highly active, and func- and functional microorganisms is formulated to enhance the tional microorganisms is formulated to enhance the digestive 60 CAPSULES process and impart systemic benefits.* digestive process and impart systemic benefits.*Digestive disorders affect more than The beneficial bacteria known as probiotics play a vital role in 95 million Americans every year. detoxifying the body, helping to balance the pH and maintaining a healthy intestinal environment. With 4 different probiotic formulas, Along with digestive enzymes, probiotics we have all you need to address every individual’s probiotic needs. are at the very core of Transformation’s approach to addressing digestive health.* Plantadophilus - A gentle introduction to probiotics.Try Professional Protocol™ Probiotic today! TPP Probiotic - #1 Practitioner recommended probiotic formula. TPP Probiotic 42.5 - Our most therapeutic probiotic blend. TPP Transbiotic™ - Highly durable with an innovative prebiotic. Professional Protocol Probiotic Probiotic Supplement 60 CapsulesFind the *THIS STATEMENT HAS NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE.Perfect BalanceT r a n s f o r m a t i o n E n z y m e s . c o m 8 0 0 - 7 7 7 - 1 474*This sTaTemenT has noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease.Digestive disorders affect more than Professional Protocol Worried about Worried 95 million Americans every year. your probiotics your pro Probiotic beating the heat? beating Along with digestive enzymes, probiotics Probiotic No need! No ne healthyare at the very core of Transformation’s Supplement approach to addOrnesTshineg dInigseIsdtieve health.* 60 CapsuleshappyTry Professional Protocol™ Probiotic today! On The OuTsIde* With Our Clinically Proven Probiotic FormulasTransformationEnzymes.com 8 0 0 - 7 7 7 - 1 474*This sTaTemenT has noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease.With Transformation™, you know that quality is top priority. Our probiotic formulas have been Probiotics should be refrigerated for optimum activity. So are Probio used clinically for over twenty years with consistent, proven results.* We use only GI stable they still safe to ship in the heat of summer? To find out, we they st strains and we don’t add any other ingredients.* conducted an independent study during one of the hottest cond In addition to supporting a healthy immune system, Transformation’s single and multi-strain summers ever. The results? Our best-selling TPP Probiotic™ summprobiotic formulas support relief from occasional GI discomfort, reduce problems associated showed less than a 1% decline in colony count. Contact show with lactose intolerance, and encourage healthy and timely elimination.* us at [email protected] for more details u about our probiotic heat stability study! Order today and receive 20% Off a case of any of our probiotic products. Plus receive a FREE copy of The Healing Power of Enzymes by Worried about Worried Transformation’s CSO Dr. DicQie Fuller-Looney. (while supplies last) your probiotics Professional Protocol your pro Professional Protocol The Genesis OF GOOd healTh ™ Plantadophilus™ P ro b i o t i cwith at least 8 oz. of water. Contents may be removed from capsule and with at least 8 oz. of water. Contents may be removed fro Probiotic Supplement 90 Capsules beating thPerobiohtice42.5at? beatingProbiotic Probiotic Supplement Supplement n. 60 Capsules No n80e0-7e77-d147!4 TransformationEnzymes.comNo n80e0se, 30Capsules Our #1 PraCTiTiOner a mOre TheraPeuTiC a GenTLe STarTreCOmmenDeD PrObiOTiC* SOLuTiOn* TO PrObiOTiCS*1-800-777-1474 or [email protected] / TransformationEnzymes.com Probiotics should be refrigerated for optimum activity. So are Probio they still safe to ship in the heat of summer? To find out, we they st conducted an independent study during one of the hottest cond summers ever. The results? Our best-selling TPP Probiotic™ summ showed less than a 1% decline in colony count. Contact show us at [email protected] for more details u

neTvheerdbeemenangdrehaatser Zymes 4 Kidz™ Lilly, age 5 The need for healthy alternatives for our Zymes 4 KidzodccmKviahgeiaredebrxwaszoimtlahliDobyhuinldegmeraaeawlndsttheiditlg™lsaeaa,nsssawtdssinoaiimdwsnsteiflcoyaallroftbtesiunoea.ru*nitnetcSrgodhiue.fi*lptnndoptu’ssoat.r*rsditesiiTngnishgettisssacthihbomeienlldorprorrsyeef-ntfpoclarwoopvmitroteohprimenledsot,ete SSSeeurrvvpiinngpgsSlepizeemr3C3eo2nn.7tatminFgera(aacpbpotus1t/812ts5p) Supplement Facts Enzyme Kid children begins with the foods we eat, the Serving Size 2 Chewable Tablets environment in which we live and the ability Zymes 4 KidzApmoAinloymvsueyanrlctatacpssheeea,r,rgoSlallueyccrttivoaciasnBemgl,eypnlaedsceti,naalspeh,ad-igaasltcatsoes,idpahsye%t,asDe1a,3il1yvalue Servings per Container 15 fnomervatenhraebgbeeoeidnt sygtrreeosactoleuerarcrfeoasrw.TaTryhaentshdfeeomwr maansadtteihoaannsd.™BgbbabaTsrrerslosereoocsaswaaauaiunssstturihrtsttncsesffmegeaeowme.nir*owlidkdmatAfheixnidnalsildgumetuTit.invghoturWdreeaenmielsntoh™birtsopqseieofnmtutosaanhartdenfemtlosindovrtoarytob.tautihcriaTnlroeleacnerfnarateadve™esnniaotsnsattffusffreeboonet.drrrrsuiemmctytoiairomruarisctnltifpautoiaooftsmnleronmeeam™sfofdrtufaseerilcanncaocrcgteffaiceevaorahesdetcsine,lftcduhedttah’lhasslsyKistseiho.ipp*dfeonorrazeeparlmpvlttDhieagmuiynragleautsedtmsiaottnon™d mg † KtidozaDsisgiessttin smuapinptoartinsinhgeainlttehsytdinigael satnidon™ ARohocESfBeEronttaonSmCzerltypOteOaihmxiitdLcMnieigaUnewhMarrTtebcalEymEtatipveNsbLairretYyDokyaofiEfilneNrseogDsdpoOmsldiiaUietnoFcablSaneIeseLasAucdcLslroG.aeEoopDduElnR,asoi:dnlSteahr1nFytei/oato8ptbwotloatadlsiencldlpC.egdb.hu(rK1eteeome/a2oeaikcprsabdcaolsooosutwotCtdlopoenifr)derotemehcfxaetibexc(FafhedoCbdoobyCfdiync)fohiyunaironlmdtiustrhseprue.nola.on amount per Serving thime smyumneptsoymstseomf ohcecaaltshioannadl itnodirgeedsutcioen,*EAnCTvDouHAMTrEliSEuinnE,AiTSoTSETrETnrDApDATrBTEEyEiDMovTnETEHon.nETTTDHSFiAiAoSHngoApynDvrDoEoAiSSnnDEEDou,ATCTDSrTBrEEEiu.SAEgTn, Transformation™ advocates healthy food choices Total Carbohydrates % daily value for children. <1 g <1%† gas, cramping and bloating.* ™cellulase, hemicellulase Sugar FpplaoexplapySetSmsiucdaegytacielansacdraehssaeabel,rcol,geoldlynhuitdaocicslo(st5baa0mlse,e0yn,0ldai0nsveHe,urltaTacstaean,sdcee,3la0lul0plahdsape-,gpha-ielcvmt)oiscied1l91alu04sl<<aemm11s, egggg ** *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD *mREeaClOoMr aMsEdNirDecEteDdUbSyAyGouEr:hTewaolth(2c)artaebplerotsfewssiti™honeavle.ry peptidase Blend (50,000 HuT Dpp-iv) 119 mg † ** AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED Kidz DigestEnzyme activity is measured Kidz DigestFlaxSeedand 300 53 mg † 30 mg † ** TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Store tightly sealed in a cool, *lipase (3,000 Fip) † ** idnryFopoladceC.hKeemeipcaolsutCoofdreeaxc(hFCofCc)huilndirtes.n. 1 mg ESunpzypmleemPeonwt derCnaE*TuodvHraMTElEiinSun, EioaTSTErSTEnrTpddaarTETbEEdiyovMTTEnEoHn.nTETdTHaFiSaionsgHyopandrdvooEiaSSdnnEEud,aoTCSTdrTErbE.iuESaEgT,n Berry FlavorBifidobacterium infantis Chewable† Daily value not established lipase (3,000 Fip) 30 mg ** 3SE0unpTzpyalmebmeleentTsTOMEShRnuAIznSiATyuERpMFRT2AEI2OCF0CDIT,CouUHIrArCopLETu.,DSCh2TOF9Aoo0LS0nrON,WRTTOirSXlAAC7nDr7S0ED4FSE2oTDrDSMrUA.,GTiAoRn bifidobacterium infantis *†*dbaaislyedvaolnuean2o,0t 0e0stcaablloisrhieeddiet 11 mg ** 2 mg ** N41e.5tgw(e1.i4g6hotz) MMoaiTXgHEEndrEbSiEniurgMrryESdTFEliEaanvrToasTr:E,F,nrSauiTlCuiCTroaaSlEs,TXryalWiTBoElr, nrayTFulraavlor, 2M9a0n0uWFialCCTruErSETddrFo., rSuTirTaEn2S2F0o, HroMuasTTioonn,ETnXzy77M0E42Corp., Order Today! www.Zymes4Kidz.com TransFormation Do not use if you The Genesis OF GOOd healTh The Genesis OF GOOd healTh habavdeomorindaelvpealoinpbdeiacraruhseea,ClaosocsaerastSoaoglsr,aodra conditions and be harmful to your health. ReleaseZyme™Two (2) capsules with every meal. GastroZyme™* Enzyme Supplement wEnitzhyHmeerSbus pplement with Herbs 100 Capsules 100 CapsulesTransFormation TransFormation Professional Protocol The Genesis OF GOOd healTh Protease IFC* RepairZyme™* Enzyme Supplement HEnerzbyms &e SMupinpelreamlsent with with Vitamins 45 Capsules 60 Capsules 33% of AmericAns suffer from occAsionAl heArtburn And spend over $10 billion A yeAr on products Aimed At relief. odds are, 1 in 3 of your patients exper- iences heartburn on a regular basis. transformation’s Gastro™ provides all-orsnackwithatleast8oz.ofliquid.Contentsmayberemoved Professional Protocol Professional Protocol Professional Protocol from capsule and taken by spoon immediately after mixing with a - Digest* Gastro* Probiotic Enzyme natural relief for occasional heartburn.* Supplement tract Enzyme Supplement Probiotic with Herbs Supplement 60 Capsules 60 Capsules Give your pAtients 60 Capsules A better choice!* (800) 777-1474 transformationenzymes.com *These sTaTemenTs have noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease. 33% of AmericAns suffer from occAsionAl heArtburn And

POSTERS Haaswihtilbee?en Ask your healthcareprofessional today about effective relief with Probiotics.*TransFormation TPP Gastro is an enzyme and herbal product formulated to as- S u p p l e m e n t F a c t s TPP Probiotic is a formulation of a carefully mixed selection Supplement Facts sist occasional gastrointestinal discomfort and promote digestive Serving Size: 1 Capsule www.TransformationEnzymes.com function.* All Transformation™ formulas are carefully prepared Servings Per Container: 60 Optimal digestion is dependent upon effective digestive enzymes. to assure maximum quality and nutritional effectiveness.* MANUFACTURED FOR TRANSFORMATION ENZYME CORP. Supplement Facts TPP Digest includes highly active enzymes with a broad range of Serving Size 1 Capsule of microorganisms friendly to the human GI tract.* These or-2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 Amount Per Serving % Daily Value Serving Size: 1 Capsule specificities to handle all food preferences.* All Transformation™ ABSOLUTELY NO FILLERS Servings Per Container 60 ganisms enhance the ecological balance of friendly bacteria.* MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION Servings Per Container: 60 formulas are carefully prepared to assure maximum quality and 2900 WILCREST DR., SUITE 220, HOUSTON, TX 77042 nutritional effectiveness.* RECOMMENDED USAGE: One (1) capsule with every meal Amount Per Serving All Transformation™ formulas are carefully prepared to assure MANUFACTURED FOR TRANSFORMATION ENZYME CORPORATION Vitamin A (100% as beta carotene) 2250 IU 45% with at least 8 oz. of water. Contents may be removed from m%axiDmauimly Vqaulauliety and nutritional effectiveness.* 2900 WILCREST DR., SUITE 220, HOUSTON, TEXAS 77042 Vitamin E (as d-alpha tocopheryl succinate) 1.5 IU 5% ABSOLUTELY NO FILLERS P PROFESSIONAL ROTOCOLcapsule and taken by spoon immediately after mixing with a Tzyme™ Protease Blend 12A2BmSgOLUTELY†NO FILLERS PROFESSIONAL PROTOCOLTzyme™ Polysaccharolytic Blend Amount Per Serving % Daily Value RECOMMENDED USAGE: One (1) capsule with every meal or 150 mg † snack with at least 8 oz. of liquid or as directed by a health care small amount of tepid water. (Protease and peptidase) (55,131 Tzyme™ Probiotic Blend practitioner. Contents may be removed from capsule and taken by Lactobacillus plantarum spoon immediately after mixing with a small amount of tepid water. Enzyme activity is measured in Food Chemicals Codex PROFESSIONAL PROTOCOLLipase (7,518 FIP) Lactobacillus sporogenes Lactobacillus salivarius Enzyme activity is measured in Food Chemicals Codex (FCC) units. Digest *(FCC)units. Tzyme™ Polysaccharolytic Blend Bifidobacterium longum Store tightly sealed in a cool, dry place. Keep out of reach of children. Amylase Lactobacillus casei Store tightly sealed in a cool, dry place. Alpha-galactosidase Lactobacillus acidophilus Tzyme™ is a trademark of Transformation Enzyme Corporation. This proprietary Keep out of reach of children. Phytase blend of highly active, functional, pH balanced, and GI tract stable enzymes is 2H0U,024T07634tcRboa+00782aefEkrdt1DmmFGeCeet1TnipUaggOmpUiSlbdrMeUaAywcMPwstaiUEiptttihoeo)NronaD.ne††††tErli.emDCamUsotneS8tdAeioanGzttesE. lo:ymfOaawfnytaeebtre(em1r r)oiexcrmianapogssvwdueilidretehfcuraotpemosdmncbarayilsplaisanumhgleeooauraltnanhttd (Phytase, Alpha-galactosidase, Amylase, Glucoamylase, Pec- Jerusalem Artichoke tuber 442 mg † formulated to enhance the digestive process and impart systemic benefits.* Tzyme™ is a trademark of Transformation Enzyme Corporation. tinase, Diastase, Invertase, Lactase, Cellulase, Hemicellulase) Lactoferrin (from milk) 3 billion cfu** † This proprietary blend of highly active, functional, pH balanced, 380 million cfu** † *THESE STATEMENTS HAVE NOT BEEN EVALUAT- Tzyme™ Protease Blend 79 mg † 300 million cfu** † ED BY THE FOOD AND DRUG ADMINISTRATION. Enzymeand GI tract stable enzymes is formulated to enhance the P ro b i o t i c(Protease, peptidase) (44,383 HUT + 3.6 SAPU) 200 million cfu** † THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, G a s t roBeta-glucanase † 225 million cfu** † TREAT, CURE, OR PREVENT ANY DISEASE. digestive process and impart systemic benefits.* *Macerase Marshmallow root extract 80 mg † 1 billion cfu** † Glucoamylase 2R5EAFGRUIGERAT†E FOR OPTIMUM ACTIVITY Papaya (leaf) 80 mg † 20 mg † Supplement*THESE STATEMENTS HAVE NOT BEEN Ginger (root) 70 mg 10 mg † 40**0GCuUaranteed m†inimum potency at the time of manufacture. EVALUATED BY THE FOOD AND DRUG 60 CAPSULESADMINISTRATION. THIS PRODUCT IS Pectinase 1S4toerendtiog-hPtlGy Usea†led in a cool, dry place. Turmeric (root) 60 mg † NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. 2K5eeBpGoUut of rea†ch of children. ProbioticGotu kola (aerial part) extract Lactase 610 ALU † Fennel (seed) 40 mg † 295*TCHU ESE S†TATEMENTS HAVE NOT BEEN 40 mg † 168EDVPAº LUAT†ED BY THE FOOD AND DRUG 2568ANHSDOUCMTU IINNITSET††NRDATEIDOTNO. TDHIIASGPNROOSDEU, CTRTEISAT, CURE, OR PREVENT ANY DISEASE. Cellulase SupplementArtichoke leaves extract 30 mg † † Daily Value not established Diastase 24.6 mg † Invertase Tzyme™ AntiOx Blend OTHER INGREDIENTS: CELLULOSE & WATER (Flax Seed, Alpha-Lipoic Acid, Asian Ginseng Root, Eleuthero Root) Enzyme SupplementHemicellulase Tzyme™ is a trademark of Transformation Enzyme Corporation. This proprietary blend of GI tract stable, highly active, and func- † Daily Value not established tional microorganisms is formulated to enhance the digestive with HerbsOTHER INGREDIENTS: CELLULOSE, WATER, Aloe vera (leaf) 15 mg † process and impart systemic benefits.* CALCIUM CITRATE 15 mg † 60 CAPSULESIrish Moss 12.5 mg † Lipase (125 FIP) Peppermint (leaf) 10 mg † 60 CAPSULES † Daily Value not established OTHER INGREDIENTS: CELLULOSE, WATER, CALCIUM CITRATE*This sTaTemenT has noT been evaluaTed by The Food and drug adminisTraTion. This producT is noT inTended To diagnose, TreaT, cure, or prevenT any disease.

ADDITIONALRESOURCESZymes 4 Kidz by Patient Fulfillment Program Practitioner Intro Brochure Item # 2000193 Patient Fulfillment Script How to Recommend the Program to Patients Item # 2000192 Patient Fulfillment Patient Information Card Item # 2000191 Zymes 4 Kidz Booklet with Testimonials Item # 2000044Professional Protocol Professional Protocol Professional ProtocolProtease Digest* ProbioticEnzyme Enzyme ProbioticSupplement Supplement Supplement 90 Capsules 60 Capsules60 Capsules The Genesis OF GOOd healTh The Genesis OF GOOd healTh Healthy Detox Program L Drain K Drain Patient Instruction Card Herbal Herbal ion. Supplement ion. Supplement Item # 2000093gnose, nose, Net CoNteNt: 1 FL oz 29.574 mL Net CoNteNt: 1 FL oz 29.574 mL Professional Protocol Liver Support* N-Acetyl Cysteine Supplement with Herbs & Enzymes 60 Capsules

ACCESSORIESTransformation™ Pens Transformation™ Thank You CardTransformation™ Pill Boxes With EnvelopeItem # 2000031 Transformation™ Note CardTransformation™ Plastic Bags Blank, with EnvelopeSmall Transformation™ FoldersItem # 2000100 White, GlossyTransformation™ Plastic Bags Item # 2000052Large Transformation™ Table RunnerItem # 2000101 WhiteTransformation™ Paper Bags Item # 200D101Brown (5” x 9”) Clip BoardsItem # 2000102

TECHNICAL SERVICES Science Brief Probiotics • page 1 Systemic Proteolytic Enzymes:Systemic Proteolytic EnzymesScience Brief: Transformation Enzyme Corp. • page Improved Digestion Supplementing Science Brief:with Oral Digestive Enzymes A Review of Mechanisms of Action and Probiotics – Their Benefit the Resulting Health Benefits on Human HealthConsider the following review of clinical research and observations regarding Consider the following review of scientific literature and research regarding Consider the following review of scientific literature, research, and clinical observations regardingimproved supplementation with Transformation Professional Protocol Digest. improved digestion and immune system health with supplemental probiotics. characteristics, mechanism of action, and resulting systemic benefits of TEC’s supplemental proteases. Special recognition is given to National Enzyme Company for contributing to this paper.Transformation Enzyme Corporation (TEC) is a enzymes remain active in the GI tract. Furthermore, Transformation Enzyme Corporation (TEC) is a nutrition- organisms feed on undigested food, creating digestive Transformation Enzyme Corporation (TEC) is a nutritional Key.Characteristics.of.Supplemental.nutritional supplement company specializing in the some enzymes are absorbed into the blood stream al supplement company specializing in digestive health, discomforts such as gas and bloating. supplement company specializing in enzyme therapy since Proteasesdevelopment of quality enzyme-based products for the where they remain active and impart systemic benefit. offering quality probiotic and enzyme-based products 1991. Our goal is to educate health care professionals andhealth care professional. Through clinical and obser- to the health care professional. Through clinical and Digestive disorders affect one out of four Americans.vational research, TEC’s efforts focus on teaching the TEC’s scientific staff with decades of combined experi- observational research, TEC’s efforts focus on teach- According to the USDA Food and Nutrition Information the public on the fundamental health benefits of enzyme and There are several sources for supplemental enzymesimportance of nutrient acquisition as the foundation of ence in biochemistry, nutrition, and cellular and mo- ing the importance of optimal digestion and maintaining Center, GERD affects 60 million Americans, constipation probiotic supplementation. We believe a healthy diet and available on the market today. They are animal (pancre-wellness and healthy living. lecular biology has formulated a highly specific diges- the health of the gut as the foundation of wellness and 6.3 million, and IBS 3 million. The most recent reports lifestyle, along with optimal digestion and a strong immune atic, trypsin, chymotrypsin), plant (bromelain, papain), and tive enzyme product to facilitate digestion and support healthy living. from the World Health Organization (WHO) have ranked system, is the foundation of wellness and therefore enzyme microbial (fungal and bacterial). TEC uses microbial andA poor diet and a digestive system that fails to process the body to maintain health and wellness. This science colo-rectal cancer and stomach cancer among the top therapy is the Genesis of Good Health™. plant enzymes for their long history of safety, quality, purityfood for bioavailability and absorption will undermine brief will review the effects of supplemental digestive A poor diet and a digestive system that fails to process ten leading causes of death.the body’s coping ability and create conditions favor- enzymes on preventive health and wellness as well food for bioavailability and absorption will undermine the Enzymes Defined and efficacy.able for disease and metabolic disorders. Based on as their safety and efficacy for human consumption. body’s coping ability and can create conditions favor- We are now also seeing a greater need in our youngerthis fact, TEC strives to educate health care profes- Additionally, this science brief will highlight the “new able for disease and metabolic disorders. Based on this populations. The rate of IBD among children has doubled Enzymes are protein molecules that catalyze chemical Stabilitysionals worldwide on the benefits of a balanced diet improved” formula, Transformation Professional Proto- fact, TEC strives to educate healthcare professionals in the last 10 years. In the October 2012 issue of Pediat- reactions. In the human body, digestive enzymes catalyze Gastric stability is very important when selecting supple-and proper digestion. The primary benefits are: col (TPP™) Digest. worldwide on the benefits of a balanced diet and proper rics, researchers report as many as 49 million antibiotic or facilitate the breakdown of food molecules within the mental enzymes. As protein molecules, it is logical to think digestion. The primary benefits are: prescriptions are written for children each year. Studies gastrointestinal tract. Metabolic enzymes are those found they would be denatured in the harsh environment of the 1. maintaining a strong digestive system The Importance of Good Nutrition and, show that infants treated with antibiotics before their first in the cells and tissues that are responsible for all chemical stomach. For example, endogenous pancreatic enzymes 2. enhancing the bioavailability of nutrients to the cells More Importantly, Optimal Digestion 1. maintaining a strong digestive system birthday have a risk for developing IBD five times greater reactions in the body. Supplemental proteolytic enzymes or are secreted into the small intestines, bypassing the stom- 3. supporting a strong immune system and cellular vitality than those children who never took antibiotics. “proteases” are digestive enzymes that specifically digest ach all together. So when pancreatic enzymes are taken 4. promoting efficient and timely removal of meta- The number of reported digestive disorders is on the 2. enhancing the bioavailability of nutrients proteins into small peptides or amino acids. orally as supplements they must have an enteric coating rise. It is estimated that over 80 million Americans are to the cells The good news is, there is also a growing body of re- in order to survive the acid in the stomach. Microbial and bolic by products and environmental toxins. affected by various forms of digestive diseases. Ac- search revealing that probiotics support the healthy bal- cording to the NIH, the related health care cost is esti- 3. supporting a strong immune system and ance of native bacteria, benefiting digestion, elimination, As digestive aids, when taken with meals they facilitate plant enzymes on the other hand are not as susceptible to The only thing that any biological mated at over $107 billion. TEC believes this increase cellular vitality and immune function. system ultimately requires is can be attributed to poor diet, improper digestion, complete digestion of animal and plant proteins. When taken the acid (Mamadou 2005). an ensured way of delivering stressful lifestyles, and the prevalence of toxins in the 4. promoting efficient, timely removal of meta- The Role of Microbes in the GI Tract nutrients to the cells. environment. While genetics may play a part, scien- bolic byproducts and environmental toxins. bhbsTTeayelnenEhosaztdiCowstyletrdemhealmiestsnbee,ntedesrraaean”mndrateacudeimsfshiratcue.stlaushlIttvsr,neihmeaspyevtiralhytiiaohCmetihbetsewehpalleyosamavwerloetcythenitntol2ecisltcn.thhehleeToae,tenhnronteathezpkiisnnreyriemtosmamyirfttbsmoeeeaotorsrohubdmelfeynoayata.ekdrietkcncyiseotoeayiiyonnwnbsn™tzsnaceyohampampranbos,rrdeeosac“sditicsstreiuctyyviaenusssesrtltteioaeeeswdtmmtteoaihbcnriiyesyccyz. yme2Mm2TewTasn00Eiiutptbz00hCelyeal69seamct;;tuias2o1ZesFn0neesisde0snshtk8thtochleo;eauwernPtrr-lsovir2yMeeac0trnuehcrz1ytunney1liyrrznn;o,vydgoGamtuw1hprrr9iesHeiiofn9ksfiurig2ilnest2)sdhv.0p1oiaeg1r9utleos28rhst,c;9eatibSin;aoviclgsLenehea(asnspyBanereToolditrdrEsvoeaeaCawrncnn1itdutdit9zvshe8Kee2e5nes0ipr;dl1lHiSoean2grbt;eireiEta2lpsinht0nnyofr0gioeua3ternosk-;. tists continue to find more and more evidence that (adapted from ‘About Probiotics’ at USprobiotics.org)Historically, supplemental digestive enzymes were ob- points to the fact that the vast majority of all disease This Science Brief will review the role of microbes in Table.1 ..Transformation™.protease.enzyme.specstained from the pancreatic juice of animals, commonly can be traced back to poor diet, mal-digestion and the the human body and the most current research on The microbes present in the gastrointestinal tract havebovine and porcine. However, in the past several inability of the gut to function properly. supplemental probiotics and their impact on digestion the potential to act in a positive, negative, or neutral ENZYME SOURCE (controlled fermentation) Effective pH Rangedecades, enzymes derived from non-animal sources and human health throughout the life cycle – infancy manner. Two key roles of the beneficial bacteria are in 4.0 - 9.0have gained recognition. Plant enzymes such as bro- TEC suggests practitioners look at two variables: food through adulthood. supporting digestion and immunity, both of which have Bromelain Ananas comosus 6 3.0 - 10.5melain and papain are commonly used. More current choices and digestion. These can be addressed im- a huge impact on the health of the host. It is known that 3.25 - 7.5research suggests mycelial enzymes from Aspergil- mediately simply by paying attention to what one eats Digestive Disorders Continue to Rise microbes in the large intestine complete the digestive Papain Carica papaya (tropical plant) 2.75 - 4.7lus oryzae and niger as well as other microorganisms and by supplementing with digestive enzymes. The process on food components that were not digested in 2.75-6.25have been proven safe, effective, and in many cases benefits to overall health are extensive: The demand has never been greater for probiotic supple- the small intestine. Peptidase Aspergillus oryzae 2.75 - 7.0superior to traditional “animal” and “plant” enzymes for mentation to assist with regular bowel function, promote 2.0 - 8.0digestion. • Bioavailability of nutrients to the cell improves cel- gastrointestinal health, and support a healthy immune Bifidobacteria naturally present in the GI tracts of healthy Protease 3.0 Aspergillus niger lular vitality and function system. The beneficial bacteria normally present in the breast fed infants ferment oligosaccharides and supportContrary to the long held belief that enzymes do not - Proteins supply amino acids, the structural compo- healthy gastrointestinal (GI) tract may not be properly maturation and function of the colon. Other examples Protease 4.5 Aspergillus oryzae varsurvive the gastrointestinal environment, several nents for every cell, tissue, muscle and organ established from birth with breast feeding and/or often of digestive support are production of lactase in lactosestudies have demonstrated that some orally ingested - Carbohydrates are the body’s main energy source become imbalanced by poor diet choices, environmental intolerant people and digestion of plant fibers resistant to Protease 6.0 Aspergillus oryzae lifestyle stressors and the indiscriminant use of antibiot- the enzymes they encounter in the small intestine. The ics. Additional issues can arise when opportunistic micro- DPP-IV (Dipeptidyl Peptidase) select Asperigillus speciesDigest Science Brief Patient Comprehensive Assessment Questionnaire Name: ________________________________Date: _________ Age: ______ Sex: _______ Height: _______ Weight: _________Improved Digestion Supplementing with Oral DigestiveEnzymes PART I - Health Priorities Always□□ □ Please list your 5 major health concerns in order of importance: SometimesCarbo-G Science Brief 1. __________________________________________________ 2. __________________________________________________ NeverImproved Gluten Digestion with Innovative Enzyme Solutions 3. __________________________________________________ 4. __________________________________________________ AlwaysProbiotic Science Brief 5. __________________________________________________ SometimesProbiotics - Their Benefit on Human Health Never Eczema, psoriasis, recurrent rashesProtease Science Brief Dry or flaky skin and/or hair □□ □Systemic Proteolytic Enzymes: A Review of Mechanisms ofAction and the Resulting Health Benefits Thinning of hair on scalp, face, or genitals □□ □Gastric Stability Study Weak nails □□ □Quantitative Evidence Proving the Efficacy of Enzyme Outer third of eyebrow thins □□ □Supplementation PART II - Symptom Survey Gallbladder attacks or stones □□ □Item # 1000092 Please mark the appropriate box on all questions below Have you had your gallbladder removed? Yes NoComprehensive Symptom Questionnaires based on your health in the past year. Crave sweets during the day □□ □Understanding about your clients is the first step in getting to thefoundation of their health. Please ask our technical services team Feeling that bowels do not empty completely □□ □ Eating sweets does not relieve cravings for sugar □□ □for more information about these clinical tools. Lower abdominal pain or discomfort following meals □ □ □ Must have sweets after meals □□ □ Sense of fullness during and after meals □□ □ If meals are missed feel irritable, lightheaded or shaky □ □ □ Diarrhea, urgent, loose, watery stools □□ □ Slow starter in the morning □□ □ More than 3 bowel movements daily □□ □ Depend on coffee to keep yourself going or started □□ □ Constipation, dry, hard, infrequent stools □□ □ Poor memory, forgetful, mental sluggishness □□ □ Use of laxatives □□ □ Cannot fall asleep, insomnia □□ □ Stools are foul smelling □□ □ Cannot stay asleep □□ □ Stools are mucous-like, greasy, or poorly formed □□ □ Wake up tired even after 6 or more hours of sleep □□ □ Undigested foods found in stools □□ □ Require excessive amounts of sleep to function properly □ □ □ Pass large amount of foul-smelling gas □□ □ Crave salt □□ □ Excessive belching, burping, or bloating □□ □ Dizziness when standing up quickly □□ □ Heartburn □□ □ Headaches □□ □ Stomach pain, burning or aching 1-4 hours after eating □ □ □ Migraines □□ □ Use of antacids □□ □ Excessive perspiration or with little or no activity □□ □ Pain, tenderness, soreness on left side under rib cage □ □ □ General fatigue, tired, sluggish most of day □□ □ Greasy or high fat foods cause nausea or discomfort □ □ □ Fatigue after meals □□ □ Nausea and/or vomiting □□ □ Afternoon fatigue □□ □ Certain foods cause sinus congestion, headaches □□ □ Feel cold - hands, feel, all over □□ □ Offensive breath □□ □ Depression, lack of motivation □□ □ Bitter metallic taste in mouth, especially in the morning □ □ □ Heart palpations, increased pulse at rest □□ □ Asthma or difficulty breathing □□ □ Nervousness or anxious □□ □ Frequent colds or recurrent infections □□ □ Night sweats □□ □ Frequent urination □□ □ Difficulty gaining weight □□ □ Urinary tract infection □□ □ Difficulty losing weight □□ □ Increased thirst and appetite □□ □ Diminished sex drive □□ □ Unexplained itchy skin □□ □ Increased sex drive □□ □To learn more about our Technical Services, please visit http://support.transformationenzymecorp.com

COMPARISON CHARTSSolutions: Protease vs Rx and OTCQUICK REFERENCE GUIDE Category RX/OTC Names Purpose Active Ingredient Inactive Ingredients Side Effects TPP Protease None known Systemic Works synergistically with 355,017 HUT protease 9.6 mg Calcium citrate Enzyme endogenous protease to support 600,000 PU bromelain (0.015% DV)Supplement healthy immune function, healthy 1 capsule = 641 mg inflammation response, and healthy circulation*Systemic Enzyme Wobenzyme PS® For individuals wishing to support 1350 FIP bromelain microcrystalline cellulose, calcium None known Supplement healthy joint, immune, and 300 mg rutin phosphate, hydroxypropyl cellulose, circulatory function vegetable stearate, vegetable-based pH 4320 FIP trypsin (from animal) resistant enteric coating, silica, natural vanilla flavor and purified water Elevated pressure in the eyes (glaucoma); Fluid Steroids, Prednisone® (cortisone, To suppress inflammation and the Prednisone - 2.5mg, 5mg, lactose monohydrate, magnesium stearate, microcrystalline retention, causing swelling in lower legs; Increasedcorticosteroid, hydrocortisone ) immune system for treatment of 10mg, 20mg, 50mg cellulose, pregelatinized starch and sodium starch glycolate – blood pressure; Mood swings; Weight gain, with fatglucocorticoid in addition, the 1 mg, 2.5 mg, and 5 mg tablets also contain deposits in abdomen, face, and back of neck; longer rheumatoid arthritis, lupus, asthma, allergies, etc. stearic acid – Prednisone Oral Solution contains alcohol, term: Clouding of the lens in one or both eyes citric acid, disodium edetate, fructose, hydrochloric acid, (cataracts); High blood sugar, which can trigger or maltol, peppermint oil, polysorbate 80, propylene glycol, worsen diabetes; Increased risk of infections; Thinning saccharin sodium, sodium benzoate, vanilla flavor, and water bones (osteoporosis) and fractures; Suppressed adrenal gland hormone production; Thin skin, easy bruising, and slower wound healing Aspirin: carnauba wax, corn starch, hypromellose, powdered cellulose, triacetin; Ibuprophen: carnauba wax, colloidal Stomach problems like bleeding, ulcer and stomach Naproxen (Aleve®), Aspirin (acetylsalicylic acid silicon dioxide, croscarmellose sodium, hypromellose, upset; High blood pressure; Fluid retention (causing Celecoxib (Celebrex® Ibuprophen) Relieve pain and reduce lactose, magnesium stearate, microcrystalline cellulose, swelling, such as around the lower legs, feet, ankles \"COX-2 inhibitor\") inflammation and fever Naproxen - sodium 220 mgNSAIDS / Aspirin propylene glycol, titanium dioxide; Naproxen: FD&C Blue #2, and hands); Kidney problems; Heart problems; Black, croscarmellose sodium, macrogol, magnesium stearate, bloody, or tarry stools; Coughing up blood or vomit that polyvinyl alcohol, povidone, pregelatinized starch, talc, looks like coffee grounds; Severe nausea, vomiting, or titanium dioxide; Celebrex: croscarmellose sodium, edible stomach pain; Fever lasting longer than 3 days; inks, gelatin, lactose monohydrate, magnesium stearate, Rashes povidone, sodium lauryl sulfateAnalgesics Tylenol® Pain and fever reducer Acetaminophen Caplets: cellulose, corn starch, hypromellose, magnesium liver damage due to large doses, chronic use, or stearate, polyethylene glycol, sodium starch glycolate; concomitant use with alcohol or other drugs that also Tablets: carnauba wax, cellulose, corn starch, FD&C red no. damage the liver; chronic alcohol use may also 40, FD&C yellow no. 6, hypromellose, iron oxide black, increase the risk of stomach bleeding polyethylene glycol, polysorbate 80, povidone, sodium starch glycolate, stearic acid, sucralose, titanium dioxideBlood thinners Plavix®, Coumadin® Anticoagulant used to prevent heart Warfarin Tablets: Lactose, starch, magnesium stearate; may also Nausea, vomiting, mild stomach pain; attacks, strokes, and blood clots in contain FD&C Blue No. 1 Aluminum Lake, FD&C Blue No. 2 Bloating, gas; Altered sense of taste Aluminum Lake, FD&C Yellow No. 6 Aluminum Lake, D&C veins and arteries Red No. 6 Barium Lake, D&C Yellow No. 10 Aluminum Lake, and/or FD&C Red No. 40 Aluminum Lake; for intravenous use: Sodium phosphate, dibasic, heptahydrate; Sodium phosphate, monobasic, monohydrate; Sodium chloride; MannitolFor more details on natural options for supporting healthy circulation, pleasecontact Transformation™.* 1-800-777-1474 • TransformationEnzymes.com *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE. Solutions: TPP™ Joint Health vs Rx and OTC QUICK REFERENCE GUIDE                                                                                                                      For more details on natural options for supporting health of the joints, please contact TEC.* (800) 777-1474 • [email protected] *THESE STATEMENTS HAVE NOT BEEN EVALUATED BY THE FOOD AND DRUG ADMINISTRATION. THIS PRODUCT IS NOT INTENDED TO DIAGNOSE, TREAT, CURE, OR PREVENT ANY DISEASE.

he beginning of every67 mg †Lipase (7,518 FIP) irected by a health care ation. This proprietary blend e enzymes is formulated to ts.* times daily following each ee capsules at bedtime. a Sagrada Bark tions carefully. arrhea, loose ascara Sagrada ese conditions ult your physician re pregnant, edical condition. every meal with at least tion. This proprietary blend e enzymes is formulated to s.* capsules with every ted by a health care ery meal or snack with at titioner. This proprietary blend of highlyformulated to enhance the 55 mg † Enzyme Proprietary Blend (Phytase, Alpha-galactosidase, Amylase, Glucoamylase, Pec- Supplement Facts 90 FTU † Phytase(Protease and peptidase) (55,131 HUT + 11 SAPU) 150 mg † Tzyme™ Polysaccharolytic Blend Serving Size: 1 Capsule (47,104 HUT / 100 USP / 500 DPP-IV) 206 mg † Servings Per Container: 3122 mg † Tzyme™ Protease Blend Amount Per Serving % Daily Value 5% 1.5 IU Vitamin E (as d-alpha tocopheryl succinate) Protease Blend (endo/exo proteases) Amount Per Serving % Daily Value% Daily Value Amount Per Serving 2250 IU 45% Vitamin A (100% as beta carotene) Enzyme proprietary blend 58 mg 373 mg Tzyme™ Enzyme Blend Supplement Facts % Daily Value Amount Per Serving % Daily Value Amount Per ServingSupplement Facts Serving Size 2 Capsules Supplement Facts Supplement Facts Servings Per Container 1.5 Serving Size: 1 Capsule Serving Size: 1 Capsule Serving Size 1 Capsule Servings Per Container: 3 Servings Per Container: 3 Servings Per Container 3 DIGEST* GASTROZYME* GASTRO* RELEASEZYME* CARBO-G*PROFESSIONAL PROTOCOL™ THE GENESIS OF GOOD HEALTH™ PROFESSIONAL PROTOCOL™ THE GENESIS OF GOOD HEALTH™ PROFESSIONAL PROTOCOL™ Digest* GastroZyme* Gastro* ReleaseZyme* Carbo-G*Enzyme Supplement Enzyme Supplement with Herbs Enzyme Supplement with Herbs Enzyme Supplement with Herbs Enzyme Supplement3 CAPSULE SAMPLE PACK 3 CAPSULE SAMPLE PACK 3 CAPSULE SAMPLE PACK 3 CAPSULE SAMPLE PACK 3 CAPSULE SAMPLE PACK SAMPLESDigest ProteaseA broad range of highly active digestive Our strongest systemic proteaseenzymes to handle all food preferences.* formulation supporting healthy circulation.*Item # S40031 Item # S40081DigestZyme PureZymeGentle formulation is the perfect intro todigestive enzymes with probiotics.* A gentle protease blend for a more gradual introduction to proteolyticItem # S10051 enzymes.Carbo-G Item # S10121Helps encourage more complete digestion Protease IFCof gluten and complex carbohydrates.* Highly effective antioxidantItem # S40023 and enzyme blends supporting cardiovascular health, oxidative stress,Gastro and reduced muscle pain and fatigue after exercise.*Transformation’s Professional Protocol™enzyme and herbal support formula.* Item # S40051Item # S40041 ReleaseZymeGastroZyme Safe, effective support to help “jump start” the occasionally sluggish colon.*A gentle, well-tolerated support formulaintended for sensitive individuals.* Item # S10131Item # S10071 RepairZymeAdrenal Complex Includes phytochemicals and rebuilding nutrients from well-toleratedFor support with food cravings or irritability nutrient-dense food sources forresulting from stress.* supporting good muscular, skeletal, and tissue health.*Item # S30161 Item # S10141BalanceZymeSupports appetite control and healthycholesterol, glucose, blood sugar levels.*Item # S10021

digestzyme purezyme protease IFC balancezyme plus Zymes 4 KidzSupplement Facts Supports digestion with a gentle Supplement Facts Supports circulation, immunity, Supplement Facts Natural support for muscle Supplement Facts Supports healthy digestion Kidz Digest*Serving Size: 2 Capsules blend of enzymes and probiotics* and healthy elimination* pain and fatigue after exercise* and weight management*Servings Per Container: 60/120/180 Serving Size 2 Capsules Serving Size 1 Capsule Serving Size 1 Capsule Powder Servings Per Container 60/100 Servings Per Container 60/120 Servings Per Container 90 Improving digestion for our children!* Supplement FactsAmount Per Serving % Daily Value Amount Per Serving % Daily Value Amount Per Serving % Daily Value Breastfeeding is the best source of nutrition for a child’s Serving Size 331.9 mg (app. 1/8 tsp or 1/2 scoop) Vitamin A (100% as beta carotene) 7,900 IU 158% healthy growth and development. Kidz Digest was created Servings Per Container about 125Enzyme Proprietary Blend 372 mg † Amount Per Serving % Daily Value Vitamin C (as magnesium ascorbate) Iodine (from Bladderwrack) 22.5 mcg 15% because we understand there are circumstances that prevent Protease (370,000 HUT) 616 mg † Vitamin E (as d-alpha tocopheryl succinate) 9 mg 15% breastfeeding. Supplementing with digestive enzymesAmylase 12,200 DU † The ultimate goal of digestion is getting nutrients to the cells. Calcium Citrate 79 mg † Assuring optimal protein digestion and proper blood flow is Zinc (as zinc citrate) 2 IU 7% The normal experience of exercise can include muscle aches Chromium (from Chromium Polynicotinate) 100 mcg 286% Individuals who are interested in an effective weight supports the digestion of formula and breast milk, assisting Amount Per Serving % Daily Value Nutrients not only feed the cell, they protect it from free radical necessary for effective nutrient delivery, a healthy immune Selenium (as selenium citrate) 0.5 mg 3% and minor pains.* This supplement is a highly effective management program may need additional assistance with the body to maintain a healthy digestive system.* Once foodProtease 66,500 HUT † damage. Healthy cells lead to optimal metabolism, energy, and response, and detoxification. Protease enzymes are therefore 16 mcg 23% formulation with enzymes, vitamins, minerals, and herbs Enzyme proprietary blend 67.5 mg † fat digestion and appetite control during meals. This support is broken down into simple nutrients, the body’s cells and Polysaccharolytic Blend 130 mg † immunity. Supplementing with digestive enzymes is a vital a must. This formula is uniquely designed with protease to designed to promote overall wellness for oxidative stress and Protease 30,000 HUT † formula is uniquely designed with chromium and synergistic tissues can absorb the resources they need for energy, growth,Lipase 1000 FIP † part of this nutrient acquisition process. This unique formula promote systemic balance.* is especially beneficial for supporting muscle pain and fatigue Amylase 3,000 DU † herbal extracts and plant concentrates to assist with digestion and repair. Whether breast fed or formula fed, Kidz Digest will Amylase, glucoamylase, alpha-galactosidase, is the perfect introduction to digestive enzymes, supporting after exercise.* Lipase 1,500 FIP † and healthy weight management when combined with diet support healthy digestion and alleviate the symptoms of invertase, lactase, pectinase, diastase, phytase,Cellulase 1320 CU † immune system health by encouraging more complete • Protease Enzymes. The proteolytic activity in PureZyme TzymeTM Protease Blend 182 mg † Cellulase † and exercise.* Use this product as part of your diet to maintain occasional gas, cramping, bloating and reduce spitting up.* cellulase, hemicellulase digestion of proteins, carbohydrates, and fats for increased assists the body in maximum digestion of nutrients, • Antioxidant Support. This formula contains the 200 CU † cholesterol, glucose, and blood sugar levels already within theInvertase 200 SU † absorption and availability of nutrients.* † Daily Value not established production of energy, and aid in immune support.* (proteases, bromelain, papain) (3,108,000 FCCPU) (58,359 HUT) antioxidants Vitamin A, Vitamin C, Vitamin E, Zinc, and Garcinia Cambogia (Fruit) Extract 250 mg † normal range.* • Enzyme Blends. Three enzyme blends work together to Selenium. Also includes a comprehensive AntiOx™ blend Plantain (Leaf) 75 mg † encourage a more complete digestion: a protease blendDiastase 500 DPº † • Enzyme Blend. This gentle formula of GI stable and • Gentle Formula. PureZyme is formulated with calcium for TzymeTM AntiOx Blend 272 mg † to scavenge and correct oxidized molecules, helping Bladderwrack Algae 75 mg † • Herbs and Nutrients. Chromium and nettles help which includes DDP-IV to assist with the digestion of Peptidase Blend 119 mg † functional digestive enzymes is designed to safely and improved tolerance on an empty stomach and includes a prevent free radical damage in the body.* Nettles, Stinging (Leaf) 75 mg † maintain blood sugars already within the normal range.* proteins, a lipase blend with 3,000 FIP of activity to assistLactase 800 ALU † effectively encourage more complete digestion.* OTHER INGREDIENTS: CELLULOSE & WATER smaller but equally effective protease activity per capsule (Kelp, Irish moss, Rutin, Grape seed extract, Quercetin, Cordyceps Mushroom Extract 75 mg † with the digestion of fats, and a polysaccharolytic blend Peptidase and protease compared to Transformation’s Professional Protocol™ Alpha-lipoic acid, Citrus bioflavonoid complex, Rose • Natural Ingredients. Rutin, tumeric, quercetin, and Fenugreek (Seed) 50 mg • Digestive Support. Garcinia cambogia and plantain are to assist with the digestion of sugars and starches.* (50,000 HUT / 300 DPP-IV)Lactobacillus acidophilus (grown on milk) 20 mg † • Probiotics. The probiotics L. Acidophilus and B. Longum Protease for those who need a more gradual introduction hesperidin are key ingredients in this natural formula.* appetite suppressors.* Bladderwrack, cordyceps, and are included in this formula for enhanced tolerance and to the benefits of proteolytic enzymes.* hips (fruit), SOD, Hesperidin complex,Tumeric root, fenugreek support the pancreas, liver, and digestion.* • Powdered Product. Kidz Digest in powdered form is easy Lipase (3,000 FIP) 53 mg †Bifidobacterium longum 6 mg † digestive comfort.* L-glutathione, Asian ginseng (root), Eleuthero (root), • Enzyme Blend. The GI stable and functional, pH balanced to administer. Powder can be mixed in a small amount of • Protein Digestion. May be taken with meals for additional CoQ10, Gingko biloba leaf, Green tea extract, Catalase, proteolytic enzymes in Protease IFC have been proven • Enzyme Blend. Enzymes are included in this formula for tepid water and given just prior to feeding. Mixture can Flax Seed 30 mg † • Digestive Wellness. The smaller capsule size is well support with digesting proteins.* For those who have Flaxseed, Gingko biloba leaf extract, Lycopenes, Lutein) to improve muscle performance which may reduce the effective delivery and utilization of the herbal ingredients also be administered by mouth with a medicine syringe† Daily Value not established tolerated for children as well as adults. This product is difficulty swallowing capsules, PureZyme may be pulled amount of time involved in and enhance the overall and nutrients. For best results, take with a digestive just prior to feeding if necessary. Bifidobacterium infantis 0.16 mg † ideal for food intolerances, nutritional support during apart and mixed in a small amount of tepid water and/or results of exercise activities.* This proprietary blend enzyme formula such as LypoZyme.OTHER INGREDIENTS: CELLULOSE & WATER pregnancy and lactation, and children’s occasional with the first bite of food. † Daily Value not established includes bromelain and papain, known for their ability to † Daily Value not established • Safe and Effective. Transformation enzyme products † Daily Value not established digestive issues.* provide additional proteolytic activity.* Health Benefits: Transformation’s BalanceZyme Plus is a have been clinically used for over 20 years to safely and Health Benefits: Transformation’s PureZyme is well-tolerated, OTHER INGREDIENTS: CELLULOSE, WATER, CALCIUM CITRATE OTHER INGREDIENTS: CELLULOSE & WATER completely natural source of support for the endocrine and effectively assist with the reduction of food sensitivities THIS PRODUCT HAS NO ADDED SUGAR Health Benefits: Transformation’s DigestZyme is designed to GI and pH stable proteolytic enzymes designed for natural Health Benefits: Transformation’s Professional Protocol™ May contain fish or shellfish. Bladderwrack algae is a natural aquatic digestive systems designed to help support appetite control, that may cause occasional gas, bloating, diarrhea, OR ARTIFICIAL COLORS assist the body in maximum digestion of nutrients, production support of the cardiovascular system for supporting muscular May contain fish or shellfish. Kelp and Irish Moss are natural Protease IFC is a unique proprietary formulation of active product which may contain traces of fish and/or shellfish. weight management, and the maintenance of already normal cramping, heartburn, and constipation.* of energy, and immune system support.* health, immune system health, urinary health, and healthy aquatic products which may contain traces of fish and/or shellfish. proteolytic enzymes, vitamins, minerals, and herbs designed cholesterol, glucose, and blood sugar levels when used along Did You Know? Most commercial formulas elimination.* to support a healthy muscular system.* with a healthy diet and exercise.* Health Benefits: Transformation’s Kidz Digest is a gentle contain whey (protein) from cow’s milk, and RECOMMENDED USAGE: formula of effective, GI stable digestive enzymes designed to many use vegetable oils as their source of fats. Take one (1) capsule per meal or as promote optimal digestion of nutrients.*RECOMMENDED USAGE: Copyright 2016 Transformation TransformationEnzymes.com RECOMMENDED USAGE: Copyright 2016 Transformation TransformationEnzymes.com RECOMMENDED USAGE: Copyright 2017 Transformation TransformationEnzymes.com directed by a health care practitioner. Copyright 2018 Transformation TransformationEnzymes.com RECOMMENDED USAGE:Take two (2) capsules with every Take two (2) capsules first thing in Take one (1) capsules three times Take 1/2 hour prior to meal for added © 2017 Transformation Enzyme Corporation • TransformationEnzymes.com Mix 1/2 scoop (app. 1/8 tsp or 331.9 mg)meal or as directed by a health care *These statements have not been evaluated by the Food and Drug Administration. the morning and right before bed *These statements have not been evaluated by the Food and Drug Administration. daily on an empty stomach or as *These statements have not been evaluated by the Food and Drug Administration. appetite control.* Algae naturally *These statements have not been evaluated by the Food and Drug Administration. in a spoon of tepid water just prior topractitioner. Take with adequate This product is not intended to diagnose, treat, cure, or prevent any disease. or as directed by a health care This product is not intended to diagnose, treat, cure, or prevent any disease. directed by a health care practitioner. This product is not intended to diagnose, treat, cure, or prevent any disease. contains iodine which is a beneficial This product is not intended to diagnose, treat, cure, or prevent any disease. *These statements have not been evaluated by the Food and Drug Administration. feeding or as directed by a practitioner.liquid. Vegetable two-piece practitioner. Available in bottles of 60 and 120 nutrient, but excess amounts can This product is not intended to diagnose, treat, cure, or prevent any disease. 3+ years of age: as above or create acapsules may be pulled apart and Available in bottles of 120 and 200 capsules. cause health issues.* Take no more paste that can be put on tongue.ingredients mixed with food. capsules. NO FILLERS/NON-ALLERGENIC than 4 capsules per day. Available in bottles of 41.5g (1.46 oz)Available in bottles of 120, 240, NO FILLERS/NON-ALLERGENIC Available in bottles of 90 capsules. NON-ALLERGENIC/ABSOLUTELY NO FILLERSand 360 capsules. NO FILLERSNO FILLERS/NON-ALLERGENICINFO PAGES Adrenal Complex MasterZyme BalanceZyme Plus Mineral Complex CalmZyme Plantadophilus Carbo-G Powdered DigestZyme Digest Probiotic DigestZyme Probiotic 42.5 EFA 1200mg Protease ExcellZyme Protease 375K Gastro Protease IFC GastroZyme Protease IM H-Drain PureZyme Heavy Metal Defense ReleaseZyme Immune AV RepairZyme Intestinal Support Super CellZyme Kidz Digest Thyroid Complex K-Drain Transbiotic™ L-Drain Transcendence FemVita Liver Support Transcendence Privita Lypo Transcendence ReZEN LypoZyme Customized product info pages also available!

PRODUCTI NDigestProfessional Protocol Make the most MakMeathke mthoesmt ost Make the mostProfessioTnhaelGPernoetsoicsoOlFGOOdhealTh * wofityFhoudrigmesetaivlseO wofityhwoCfuditryihgomeudsetriaigvmlesesetaivlseA RowfityhDhououdrryiDtgoomeursretfaeimvelselutsicrleeds SDigDeisgte*stZyme™* Do The Genesis OFPGrOoOfedshsieoanlaTlhProtocol Professional Protocol hur Enzyme afte Supplement DigestPZryomteea™s*e IFC* Protease IFC* Enzyme Enzyme Supplement Enzyme Supplement 90 Capsules ESunpzypmleme eESnuntpzypmleme ent Supplementwith Vitamins enzymes enzyemnzeysmes enzayfmteresexercise?* * * *90Capsule1s20Capsules * with Vitamins 120 Capsul60esCapsules 60 Capsules *These statements have not been evaluated by the Food and Drug Administration. *These stat*eTmheesnetsshtaatveemneontsbeheanveevnaoltubaeteedn beyvatlhueatFeodobdyatnhdeDFrouogdAadnmdiDnirsutgraAtidomn.inistration. *These stat*eTmheesnetsshtaatveemneontsbeheanveevnaoltubaeteedn beyvatlhueatFeodobdyatnhdeDFrouogdAadnmdiDnirsutgraAtidomn.inistration. *These statements have not been evaluat This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctetnisdendotoindteiangdneodsteo, tdrieaagtn, ocusere, ,troerapt,recvueren,t oarnpyrdeivseenatsaen. y disease. This produTcht iiss pnrootdiunctetnisdendotoindteiangdneodsteo, tdrieaagtn, ocusere, ,troerapt,recvueren,t oarnpyrdeivseenatsaen. y disease. This product is not intended to diagno Make the most MakMeathke mthoesmt ost Make the mostProfessioTnhaelGPernoetsoicsoOlFGOOdhealTh AofllyoowuyromureablosdyDigest* DigDeisgtestZymAoe fllyoSowfuooyrotmhuuirernabgmlosrdeeyalilesf DigestPZryomteease IFCoSfooyDtohouirnyogmurreeamlilesufscles Do* ™* The Genesis OFPGrOoOfedshsieoanlaTlhProtocol Professional Protocol Professional Protocol Professional Protocol ingredients to assist the body in the prevention of free-radical ingredients to assist the body in the prevention of free-radical damage.* The highly purified enzymes in the Transformation™ damage.* The highly purified enzymes in the Transformation™ body.* All Transformation™ formulas are carefully prepared to Two (2) capsules between meals two times a day or as needed for energy and balancing.* Take Protease IFCProfessionTahlePGreonteoscisoOlF GOOd healTh twoimthadniaggeestiitvseProteaseEnzyme ProtGeaasstreoZymtweoimthwfaodinrtiahgogecdesctiaigtvseeisotnivael GastroEZxycmelelZymwfeoirthhCoucodrcuitaglosedirsotfyneivoaeelul tiure*sde ExcellZyme hCuorESunpzypmleme entTwo(2)capsuleswitheverymeal. ™* * * Supplement Enzyme Enzyme Enzyme SupplementT G TOF GG h OF G hhe enesis he OeOndesiesalThOOdbody.*All Transformation™ formulas are carefully prepared to ealTh ThEenGzeynmeesiSsuOpFpGleOmOdenhtealTh 9E0 nCzaypsmueles Supplement Supplement with Vitamin™s*Two (2) capsules with every meaTlw. o (2) capsules between meals with Vitamins two times a day or as needed for energy and balancing.* Take reenszoyumrceess withSupplement reenszoyegumnarszceteysrsmowienisthestinal egnaszatmyrfmtooeirenesetexesentriecnirasgel?y amftoe9E0nCzaypsmuelEe1sn2z0ymCaepSsupuplleemsent™* ™ ™ SupplemweinthtHerbs * * ** E1n2z0ymCae pSsupuEpl6nl0eezmsCymeaneptsSuuplpelsement E6n0zCymaepsSuuplpelsement with Herbs with Herbs with Herbs 60 Capsules *These statements have not been evaluat enzymes*These statements have not been evaluated by the Food and Drug Administration. enzydmisecsomfort discaonmdfofortcus?* an60Capsul10e0sCapsules * 60 Capsules * ** 100 Capsules60 Capsules *These stat*eTmheesnetsshtaatveemneontsbeheanveevnaoltubaeteedn beyvatlhueatFeodobdyatnhdeDFrouogdAadnmdiDnirsutgraAtidomn.inistration. *These stat*eTmheesnetsshtaatveemneontsbeheanveevnaoltubaeteedn beyvatlhueatFeodobdyatnhdeDFrouogdAadnmdiDnirsutgraAtidomn.inistration. This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctetnisdendotoindteiangdneodsteo, tdrieaagtn, ocusere, ,troerapt,recvueren,t oarnpyrdeivseenatsaen. y disease. This produTcht iiss pnrootdiunctetnisdendotoindteiangdneodsteo, tdrieaagtn, ocusere, ,troerapt,recvueren,t oarnpyrdeivseenatsaen. y disease. This product is not intended to diagno *This statement has not been evaluated by the Food and Drug Administration. *This stat*eTmhesnet hsatastenmotenbtesehnaevveanluoattbeedebnyetvhaeluFaoteodd bayndthDerFuogoAddamnidniDsrturagtiAodnm. inistration. *These state*mTheinsts thaatevme ennot hbaesenneovt ableueanteedvbaylutahteedFoboydthanedFDoorudgaAndmDirnuisgtrAadtimonin. istration. *This statement has not been evaluated This product is not intended to diagnose, treat, cure, or prevent any disease. This producTthiiss nporot dinutcetnidsendotoindtieangdneodsteo, tdrieaagtn, ocsuer,et,roeratp, rceuvreen, toarnpyredviesnetasaen.y disease. This produTchtisispnrodt uinctteinsdneodttoindteiangdneodsteo, dtrieaagtn, ocusere, ,troerapt,recvuernet, aonr yprdeisveanst ea.ny disease. This product is not intended to diagno Allow your body AlloSwooyothuirnbgordeylief Soothing reliefisaformulationofacarefullymixedselectionofmicroorgan-Could you use CoismsfriendlytothehumanGItract.*Theseorganismsenhancetheecologi-Protease tSoumppaonratgteimitsely ProtGeaasstreoZymtSeoumpfpaoonrraotgcteicmiatseiloynal GastroEZxycmelelZymfeor Aocrceaysoiounal ExcellZyme Arcalbalanceoffriendlybacteria.*AllTransformation™formulasarecarefully ingredients to assist the body in the prevention of free-radical ingredients to assist the body in the prevention of free-radical damage.* The highly purified enzymes in the Transformation™ damage.* The highly purified enzymes in the Transformation™ Professional Protocol is a formulation of a carefully mixed selection of microorgan- ProfessionTahle PGreonteoscisoOlF GOOd healTh T G TOF GG h OF G hhe enesis he OeOndesiesalThOOdbody.* All Transformation™ formulas are carefully prepared to ealTh body.* All Transformation™ formulas are carefully prepared to The Genesis OF GOOd healTh isms friendly to the human GI tract.* These organisms enhance the ecologi- cal balance of friendly bacteria.* All Transformation™ formulas are cTawreof(u2)llycapsules with every meal. Professional Protocol Probiotic reelismouinracetisowniwthith ProbiLoytpiocZymree elismogDuianrosacteytrisoowunininwtheeisethtdinal LypoZLyivmereSupporgDt aosctmyroooonuircnneetreeensentdeiendragly LiverSupport cmooEnzyme nSupplement ™* Two (2) capsules with every meaTlw. o (2) capsules between meals ™* ™ Two (2) capsules between meals ™ two times a day or as needed for energy and balancing.* Take two times a day or as needed for energy and balancing.* Take ProfessioTnhale GPernoetsoicsoOlF GOOd healTh TEhnezGymeneeSsiuspOEpFPnlerGzmyoOmefOnedestsShiuoepanpalTllehmPreontt ocol * Professional Protocol EnzymeEnzyme Supplement * Enzyme Supplement SupplemweinthtHerbs tehnezsyem“efsriendly” ethnezsydeemxi“stecfrsroaimehnfedolplryt”with edxistcraoabnmohdufeofltporotcwuurist?tho*xic abnoP60roCbaipostuilces * with Herbs * ™ with Herbs with Herbs ™ * P60roCbaipostuil1c0eE0snCzaympseules ** 10E0nCzaympseulNe-sA60ceCtyalpCsyustleeinse Supplement N-A60ceCtyalpCsyustleeinse Supplement n. SupplemeSnutpplement ** Supplemenwtith Herbs & Enzymes with Herbs & Enzymes 60 Capsules 60 Capsules se, 30 Capsules60 Capsules n. Supplement * bacteria bactheirgiha-fat foods? highen-fvaitrofonomdse?nt? envse, 30Capsules *This statement has not been evaluated by the Food and Drug Administration. *This stat*eTmhesnet hsatastenmotenbtesehnaevveanluoattbeedebnyetvhaeluFaoteodd bayndthDerFuogoAddamnidniDsrturagtiAodnm. inistration. *These state*mTheinsts thaatevme ennot hbaesenneovt ableueanteedvbaylutahteedFoboydthanedFDoorudgaAndmDirnuisgtrAadtimonin. istration. 60 Capsules *This statement has not been evaluated This product is not intended to diagnose, treat, cure, or prevent any disease. This producTthiiss nporot dinutcetnidsendotoindtieangdneodsteo, tdrieaagtn, ocsuer,et,roeratp, rceuvreen, toarnpyredviesnetasaen.y disease. This produTchtisispnrodt uinctteinsdneodttoindteiangdneodsteo, dtrieaagtn, ocusere, ,troerapt,recvuernet, aonr yprdeisveanst ea.ny disease. This product is not intended to diagno *This statement has not been evaluated by the Food and Drug Administration. *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. *This statement has not been evaluated This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This product is not intended to diagno is a formulation of a carefully mixed selection of microorgan- Support timely Support timely Are youProfessional Protocol Arisms friendly to the human GI tract.* These organisms enhance the ecologi- is a formulation of a carefully mixed selection of microorgan-cal balance of friendly bacteria.* All Transformation™ formulas are carefully isms friendly to the human GI tract.* These organisms enhance the ecologi- cal balance of friendly bacteria.* All Transformation™ formulas are carefully Probiotic eIlsimitintiamtioenfworith ProbiLoytpiocZymeeIlsimitDintoiamytiooeunfnwoeriethd LypoZLyivmereSupporDt o cDyooinducyneorenuedekdnow™ ™ * ProfessioTnhale GPernoetsoicsoOlF GOOd healTh The Genesis OFPrGoOfOedsshioeanalTlhProtocol Professional Protocol eactiDmhnobianvdoProbiotic42.5 tahemsea“xfirmieundmly” ProbiotCica4r2.b5 o-Gtahemse“eaxG“xtfrliruamiteheunendmlplFy”wreieth” CarIbntoes-tGinalSuppoe“rtxGtrlatuhabtaohetuen8ltp0Fo%wruerietothwithatleast8oz.ofwater.Contentsmayberemovedfromcapsuleand Liver Support* ”of xthicen. Professional Protocol se, N-Acetyl Cysteine Supplement bstarcetenrgiath bstarcethenirggihath-fat foods? higheimn-fvmaitruofonnoemdssey?nste?mn. * just got*easier! just got easier! *se, wInithteHsetrbins&alEnSzuympeps ort* Professional Protocol ProfessionaPlrPorfoetsosicoonlal Protocol EPrnozyfmesesionNaP-AlrcoPefrteyosltsCoioycsontaleilnePrSouptoplceomlent Probiotic ProbioticEnzyme Supplemenwtith Herbs &*Enzymes * H6e0rbCaal pSsuupplleems ent Supplement ™ with at least 8 oz. of water. Contents may be removed from capsule and SupplemeSnutpplement ™ * * ES6un0 pCzayppmsleulmeesewHn6iett0rhbCIEamaNlnpepSrzwosyuv&mupepdlelseems ent * with Enzymes n. 90 Capsule6s0 CaFoprsmuullaes 30 Capsules60 Capsulesse, * nzyme activity is measured in Food Chemicals Codex (FCC) units whenever P3r0oCbaiopstiucles New & tore tightly sealed in a cool, dry place. Keep out of reach of children. Supplement nzyme activity is measured in Food Chemicals Codex (FCC) units whenever Improved - * SPuropbpiloetmicenESt unpzypmleme enttore tightly sealed in a cool, dry place. Keep out of reach of children. se, probiotic? probiotic? is in the gut?*This statement has not been evaluated by the Food and Drug Administration.n. is i60 Capsules 30 Capsules se, - Formula 30 Casep, sules90 Capsules *This statement has not been evaluated *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This product is not intended to diagno *This statement has not been evaluated by the Food and Drug Administration. *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. *This stat*eTmhesnet hsatastenmotenbtesehnaevveanluoattbeedebnyetvhaeluFaoteodd bayndthDerFuogoAddamnidniDsrturagtiAodnm. inistration. *These statements have not been evaluat This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This producTthiiss nporot dinutcetnidsendotoindtieangdneodsteo, tdrieaagtn, ocsuer,et,roeratp, rceuvreen, toarnpyredviesnetasaen.y disease. This product is not intended to diagno Is it time for Is it time for Did you know DidProbiotic42.5 a maximum DoesPrsotbrioetCicsa4sr2.b5eov-Gear m“aGxliumteunmFreeD”oeTsossturepCspasroIbenrtoevts-tGienarl Suppo“rtGltuhtaetn80F%reeo”f tThoesuppoInrtetstinal Support thawithatleast8oz.ofwater.Contentsmayberemovedfromcapsuleand Professional Protocol with at least 8 oz. of water. Contents may be removed from capsule and ProfessionaPlrPorfoetsosicoonlal Protocol Minerals are essential for a healthy balanced diet. Transformation’s ProfessionaPlroPfreostsoioconal l ProtocolMinerals are essential for a healthy balanced diet. Transformation’s Professional Protocol ™ ™ * enzymes in the Transformation product line are concentrated from * *enzymes in the Transformation product line are concentrated from * mycological sources. All Transformation formulations are carefully mycological sources. All Transformation formulations are carefully Herbal Supplement prepared to assure maximum quality and nutritional effectiveness.* prepared to assure maximum quality and nutritional effectiveness.* with Enzymes 60 Capsules *These statements have not been evaluat Probiotic strengthCalmZyme strengthCalmMZiynmerael Complex healthy bones, immMuinenraleCosmpylesx tehmealthy bones, imSupplement n. probiotic?* keep you*awakperojbuisottgico?t*easierk!eeypoyuonue*eadwmakoere jusitsgionttehaesgieurt!?*you need more is ise, 30Capsules The Genesis OF GOOd healTh Probiotic Enzymenzyme activity is measured in Food Chemicals Codex (FCC) units whenever The Genesis OFPGrOoOfdeshsieoanlaTlhProtocol Enzyme Herbal SupplementNew & Professional Protocol *™ tore tightly sealed in a cool, dry place. Keep out of reach of children. nzyme activity is measured in Food Chemicals Codex (FCC) units whenever Supplemewnitth EnzymesImproved tore tightly sealed in a cool, dry place. Keep out of reach of children. Mineral Supplement Enzyme Supplement SupplemenStupplement with Enzymes with Herbs New & creased according to need as directed by health care practitioner. *™ creased according to need as directed by health care practitioner. n. - Improved Formula - 90 Capsule6s0 CapsulesFormula se, 30 Casep, sules90 Capsules is formulated to enhance the digestive process and impart systemic benefits.* Enzyme SupplMeminenert al Supplementis formulated to enhance the digestive process and impart systemic benefits.* se, with Herbs with Enzymes 100 Capsules at night? at ntihgahnt?just calcium* than just calcium**This statement has not been evaluated by the Food and Drug Administration. 100 Capsul3e0sCapsules 30 Capsules *This state*mThenist shtaastenmoet nbteheansenvoaltubaetedn bevyatlhueatFeodobdyatnhde DFrouogdAadnmd iDnrisutgraAtidomn.inistration. *This stat*eTmhesnet hsatastenmotenbtesehnaevveanluoattbeedebnyetvhaeluFaoteodd bayndthDerFuogoAddamnidniDsrturagtiAodnm. inistration. This product is not intended to diagnose, treat, cure, or prevent any disease. This produTcht iiss pnrootdiunctet nisdendottoindteiangdneodsteo, dtrieaagtn, ocsuer,e,troeratp,rceuvreen,toarnpyrdeviseenatsaen. y disease. This producTthiiss nporot dinutcetnidsendotoindtieangdneodsteo, tdrieaagtn, ocsuer,et,roeratp, rceuvreen, toarnpyredviesnetasaen.y disease. This product is not intended to diagno *These statements have not been evaluated by the Food and Drug Administration. *These state*mTheinsts thaatevme ennot hbaesenneovt ableueanteedvbaylutahteedFoboydthanedFDoorudgaAndmDirnuisgtrAadtimonin. istration. *This statement has not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. This produTchtisispnrodt uinctteinsdneodttoindteiangdneodsteo, dtrieaagtn, ocusere, ,troerapt,recvuernet, aonr yprdeisveanst ea.ny disease. This product is not intended to diagnose, treat, cure, or prevent any disease. Minerals are essential for a healthy balanced diet. Transformation’s Minerals are essential for a healthy balanced diet. Transformation’s To support healthy bones, enzymes in the Transformation product line are concentrated from enzymes in the Transformation product line are concentrated from you need more mycological sources. All Transformation formulations are carefully than just calcium* To supportmycological sources.All Transformation formulations are carefully prepared to assure maximum quality and nutritional effectiveness.* prepared to assure maximum quality and nutritional effectiveness.* The Genesis OFPGrOoOfdeshsieoanlaTlhProtocol The Genesis OF GOOd healTh Does stress ever CalmMZiynmerael CompDlex oehsesatlrtheyssbeovneers,creasedaccordingtoneedasdirectedbyhealthcarepractitioner. Professional Protocol CalmZyme*™ keep you awake keep you awake Mineral ComplexEnzyme SupplMeminenertal Supplementisformulatedtoenhancethedigestiveprocessandimpartsystemicbenefits.* *™ * you ne*ed morewithHerbs withEnzymes Enzyme Supplement with Herbs at night? at ntihgahnt?just calcium*100Capsul3e0sCapsules creased according to need as directed by health care practitioner. 100 Capsules is formulated to enhance the digestive process and impart systemic benefits.* Mineral Supplement with Enzymes 30 Capsules *These statements have not been evaluated by the Food and Drug Administration. *These state*mTheinsts thaatevme ennot hbaesenneovt ableueanteedvbaylutahteedFoboydthanedFDoorudgaAndmDirnuisgtrAadtimonin. istration. *This statement has not been evaluated by the Food and Drug Administration. This product is not intended to diagnose, treat, cure, or prevent any disease. This produTchtisispnrodt uinctteinsdneodttoindteiangdneodsteo, dtrieaagtn, ocusere, ,troerapt,recvuernet, aonr yprdeisveanst ea.ny disease. This product is not intended to diagnose, treat, cure, or prevent any disease.

CUSTOM MATERIALSHow much time do you spend consulting with your patients? Do you find yourself explainingthe same things over and over? Patient compliance depends upon this valuable education,and our team knows your time is limited.Let us work for you! • Multi-media options: print, electronic, video, etc. • Can be implemented throughout the office: in the waiting room, consultation room, as handouts, at the point of sale, displayed with products on shelf, on your website, with email campaigns, on social media, etc. • Popular topics include: sources of inflammation, health tips, personalized protocols, scientific articles, compliance tracker, supplement checklist, product suggestion sheet, healthy alternatives, etc.Do you offer multiple treatments?We can customize education specific to your clients’ goals! • Aesthetics • Animals • Kids • Weight loss • Athletes • Plus more!Looking for ideas?Contact us directly at 1-800-777-1474 or email [email protected] to get started!

Transformation™ EducationWEBINAR SERIESClick one of the buttons to access the webinar recording NATURAL IMMUNE JOINT HEALTH SUPPORT (password: immune) Nena Dockery, BS, MS, with Dr. DicQie Lisa Helffrich Hudson, RDN Fuller (password: joint health) READ YOUR LABEL 1 2 BODY TYPING OVERVIEW Lisa Helffrich, RDN Lisa Helffrich, RDN (password: label) 3 4 (pwd: body typing) FINDING HORMONE THE NEED HAS NEVER BALANCE BEEN GREATER Dr. DicQie Fuller (password: endochrine) Dr. DicQie Fuller (pwd: the scoop) UNDERSTANDING NIDSNEUROIMMUNE DYSFUNCTION  SYNDROMES THE MADNESS OF MOLD WHAT THEY ARE AND WHAT Dr. DicQie Fuller-Looney (pwd: NIDS) THEY HAVE IN COMMON Dawn Aubrey, CCN (password: mold) PROTEASE KEEPS YOU   COVERED (password: protease) MAKE A DIFFERENCE Lisa Helffrich, RDN & Milton Bastidas, DC IN TEEN HEALTH GMOs & CHILDREN’S DIET Lisa Helffrich, RDN (pwd: teen health) Dr. DicQie Fuller-Looney STOP HEARTBURN (password: gmos) BEFORE IT STARTS GLUTEN FREE SOLUTIONS Lisa Helffrich, RDN (password: gastro) Lisa Helffrich, RDN DIGESTIVE HEALTH (password: gluten) PROGRAM A CLINICIAN’S GUIDEThe Gentle Lisa Helffrich, RDN (password: digest) All Natural PROBIOTICS AND HEALTHY ELIMINATION TO DETOXDETOX Lisa Helffrich, RDN (pw: probiotic425) Solution Lisa Helffrich, RDN (password: detox)TransformationEnzymes.com • 1-800-777-1474 • [email protected]

Webinar Series Your purpose is not a matter of chance; it is a matter of choice.We have a responsibility to others to pass on the lessons we have learned. Click one of the buttons to access the webinar recording REVERSING THE EFFECTS OF CHRONIC STRESS AND ANXIETY Robert Greenberg, DC, with DicQie Fuller, PhD (password: stress) THE PROTEASE STUDY: ANTI-INFLAMMATORY BENEFITS OF PROTEOLYTIC ENZYMES Milton F. Bastidas, DC (password: protease) INTEGRATIVE MEDICINE APPROACH TO CARDIOVASCULAR HEALTH Wayne L. Sodano, DC, DABCI, DACBN, CFMP, BCTN (password: cardiovascular) TransformationEnzymes.com • 1-800-777-1474 • [email protected]

WEBINAR SERIESClick one of the buttons to access the webinar recordingCARDIOVASCULAR SYSTEM DIGESTIVE SYSTEMLisa Helffrich, RDN Dr. DicQie Fuller-Looney(password: cardiovascular) (password: digestive)URINARY SYSTEM ENDOCRINE SYSTEMNatalie Butler, RD, LD Dr. DicQie Fuller-Looney(password: urinary) (password: endocrine)LYMPHATIC SYSTEM MUSCULAR SYSTEMDr. DicQie Fuller-Looney Tim R. Rogers, BS, DC, CFT(password: lymphatic) (slides only available)NERVOUS SYSTEM REPRODUCTIVE SYSTEMTim R. Rogers, BS, DC, CFT Lisa Helffrich, RDN(password: nervous) (password: reproductive)RESPIRATORY SYSTEM SKELETAL SYSTEMDr. DicQie Fuller-Looney Lisa Helffrich, RDN(password: respiratory) (password: skeletal)SKIN SYSTEM PRODUCT CATALOGShelena C. Lalji, MD, FACOG ALL SYSTEMS RELY ON(password: skin) DIGESTION Lisa Helffrich, RDN (password: digestion)TransformationEnzymes.com • 1-800-777-1474 • [email protected]

THE CARDIOVASCULAR CARDIOVASCULAR HEALTH:SYSTEM THE ROLE OF NUTRIENTDicQie Fuller, PhD, DrSc, ND, CNC Milton Bastidas, DCTHE DIGESTIVE SYSTEM THE DANGERS OF DAIRYAND HEALTHY AGING Rolf Habersang, MDAmy Rawls MS, RD, LD EAT RIGHT FOR YOURTHE LEAKY GUT STUDY BODY TYPEAmy Rawls MS, RD, LD Amy Rawls MS, RD, LDTHE DIGESTIVE SYSTEM WHY THE URINARYRULES! SYSTEM IS IMPORTANTLisa Hudson, RDN Amy Rawls MS, RD, LDHORMONES AND THE LOVE YOUR LYMPHATICSENDOCRINE SYSTEM Theresa Buede, HC, LMTTamyra Comeaux, MD, NMD VACCINATIONS ANDA STRATEGIC FIVEFOLD APP- IMMUNITYROACH TO LYME DISEASE Rolf Habersang, MDMichael Turcotte, DP.S.c, NCTDP THE IMPORTANCE OFTHE POWER OF PROTEASE DIGESTION AND SLEEPMilton Bastidas, DC Paula Kruppstadt, MDGRAINFLAMMATION: MINDFULNESSLEAKY GUT / BRAIN Mira Dessy, NEPeter Osborne DC, DACBN WOMEN’S HEALTHPREPARING THE BODYFOR PREGNANCY Dr. Polly Heil-MealeyKatelyn Richter, MS STRESS & MEN’S HEALTHTHE DIGESTIVE SYSTEM Joseph Feste, MD, FACOG, AACS, AACGAND MEN’S HEALTH THE POWER OF PROTEASEAmy Rawls MS, RD, LD Milton Bastidas, DCRHEUMATOID ARTHRITIS HOLISTIC SKIN THERAPYMilton Bastidas, DC Emily Fritchey, “The Skin Whisperer”

Video LibraryImportance of Enzyme Nutrition with Lisa Medora Hudson, RDN http://youtu.be/D7ZeAUTj4A0Why Digestive Enzymes? with Lisa Helffrich, RDN http://vimeo.com/72982910Getting Started with Enzymes with Lisa Helffrich, RDN http://vimeo.com/20226325Digestive Formulas with Lisa Helffrich, RDN http://youtu.be/jcJjuQ1vwh4How Proteases Support Detoxification with Lisa Helffrich, RDN http://vimeo.com/84810145How Proteases Support Immune Health with Lisa Helffrich, RDN http://youtu.be/uSTFDpL6T1EProbiotics and Digestive Wellness with Lisa Helffrich, RDN http://vimeo.com/38124246Clinical Based Solutions with Lisa Helffrich, RDN and Dr. DicQie Fuller-Looney http://vimeo.com/58659327Enzymes for Childrens Health with Dr. DicQie Fuller-Looney http://youtu.be/UdiGo8LX0TQCedar Fever & Other Winter Allergy Woes with Dawn Aubrey, CCN http://vimeo.com/80109147The Importance of Enzyme Nutrition with Lisa Helffrich, RDN http://vimeo.com/16703379The Ripple Effect of Toxicity: Interview with Lisa Helffrich, RDN http://vimeo.com/34105281Supporting Urinary Health with Lisa Medora Hudson, RDN http://youtu.be/m_rpYSTF070Understanding Liver Function with Lisa Helffrich, RDN http://vimeo.com/40683315Product Overview: Liver Support with Lisa Helffrich, RDN http://youtu.be/jDRxFNaDkN4Product Overview: Intestinal Support with Lisa Helffrich, RDN http://youtu.be/cQ8fKc6vqjAProduct Overview: Probiotic 42.5 with Dr. DicQie Fuller-Looney http://vimeo.com/23617691Product Overview: Carbo-G with Dr. DicQie Fuller-Looney http://vimeo.com/20212689Product Testimonial: Protease IFC with Tim Brown http://vimeo.com/80946794Intro to The Healing Power of Enzymes with Dr. DicQie Fuller http://youtu.be/UPn_kdWZB5kCellular Nutrition, part 1 with Richard Couey, Ph.D. http://vimeo.com/17530181Cellular Nutrition, part 2 with Richard Couey, Ph.D. http://vimeo.com/17548440Cellular Nutrition, part 3 with Richard Couey, Ph.D. http://vimeo.com/17548489Body Types with Dr. DicQie Fuller-Looney http://youtu.be/7kLjRWMPgD8Body Type Measuring with Dr. DicQie Fuller-Looney http://vimeo.com/110961451TransformationEnzymes.com • 800-777-1474 • [email protected]



TransformationEnzymes.com 1-800-777-1474