DL-2021-12

["?? ?????? ??????? ?????? ? ?????????? ???? ??????????? ?????????? ??????? ????? ?????? ???-???????-???????, ??????????? ????? ?? ????? ??????????? ???- ????? ?????????? ?? ???? ??????. ???? ????? ? ????? ???????? ????, ????????? ? ??????, ? ??????? ???????? ????? - ???????????? ?? ?????, ? ????????? ???- ??? ? ?????? ?????????????? ???????? ? ???????? ?????????? ????????? ??????- ???? ???????????? ????????? ???? ? ??????? ???????. ??????? ???? ??????? ??- ??????? ??????? ? ???????????? ????????? ????????, ???????????? ?????? ????- ????? . ??????? ???-???????-??????? (???????). ??????? - ??? ????????? ????? ??? ???????? ?????, ??????? ???????, ????? ?? ????????? ???????, ?????? ??????? ?????????? ????. ?????, ??????? ???????? ??????????? ? ????. ?? ??? ???????? ????? ???????? ?? ????????? ? ???????, ??????? ??????? ???-?? ? ?????, ?? ??????? ????? ?????. ? ????? ???? ?? ????????????... ? ?????? ???????? ?????????? ??????? ?????????????, ?????????? ?? ???????? ??????? ?????????? ????? ?????, ? ?? ??? ??????? ??????, ???? ??? ?????? ?? ????????. ?????? ? ???????????? ?????????????? ????? ? ???? ? ???????, ?? ??- ?? ???????? ????? - ?? ??????????? ?????? - ??????? ???????? ? ?????? ? ????- ???????, ??? ? ?????????????? ?????? ???????? ?? ???????. ??? ?????? ??????? ??????? ????? ??? ????????? ??? ????? ???? ?? ?????? ??????????, ?? ?? ????. ???? ??? ?? ??????? ??????????, ??? ?????? ? ????? ?? ??????","- ??????! - ?????? ? ???????? ??? ?????? ??????, ? ??? ?????????? ?? ?????? ?????. - ? ??? ???? ???????. ??????? ???????? ? ???, ????, ?????? ????????? ???????????, ?????? ???????- ??? ??????? ???? ?? ??????. ???? ?? ???-?? ? ??????? ????? ?????????? ? ???- ?????????? ????????? ?? ????? ???????? ??????? ??????? ??????, ?????, ???? ??????? ??? ???????? ?????, ?????????? ????????????? ???? ????????????? ????- ???? ? ????????. ?? ??????? ??????? ?????????, ??????? ???????. ?????? ??????? ????????????? ?????? ????????, ?????? ????? ???? ??????? ???????, ?? ? ?? ????, ? ??????- ???, ??????????? ?????????? ??????????? ???????. ?????? ?????? ?? ??? ?????????? ????? ? ?????? ???? ?????????? ? ???? ????. ?????????? ?????? ?????, ?? ???????? ?????? \u00ab???????\u00bb - ????????? ????? ?? ??????????????? ?? ?????? ???????????????? ???????? ??????. ???? ????? ???- ??????? ???????? ???????????? ???? ????? ?????????, ??? ????????????? ??????? ? ????????? ??????? - ?? ??????? ??????? ????? ??? ????????? ????? ????? ???- ??????? ????? ???? ?? ???????? ??????. ????????? ???????? ?? ???????? ???????? ??????? ? ??????? ?? ??????, ?????? ?? ?????. ?? ??? ?????? ????? ?? ??????????, ??? ?? ???????, ?? ??? ?? ????- ??? - ?????????? ??????????? ????????????. ?? ?? - ???????? ???????, - ???????????? ??????, ??????? ???? ? ?????????? ???????????? ??????. - Prosecco15? Limoncello16? - No, grazie, - ???????? ?????? ? ?? ?????? ??????????? ?????? ??? ????? ??????? ????????? ?? ?? ??????? ??????? ?????. - Ma certo17! - ????? ????????? ????????. - ??? ????? ????? ??????? ? ????- ???... ???? ??????? ?? ?????????? ??????????? ? ???????? ??????? ?? ?????, ?????- ????????? ??? ????? ?????? ? ?????? ????? ????? ???????? ?? ?????? ?????, ??- ??? ???? ???????? ??????? ?????? ? ????? ???????? ????. ????? ??????? ????? ???????? ??????. ??????? ??????? ?? ????????? ?? ???????? ???????????, ??????, ? ????? ??? ????????? ?????? ????????? ? ????????? ???????? ??????? ?? ???- ???? ??????????? ????????. - ??????? - Scusate18! ? ????? ???????? ???????????? ?????. - ???-???????! ????? ????????? ?????? ?? ??????? ????? ?? ????? ????? ??????? ?????-????? ? ???????? ?? ???????? ?????? ?? ??????. ????? ??? ?????????? ??? ??????? ??- ??? ????? ???????, ??????? ?????? ???????? ?????? ???????? ?????????? seppie al ???? - ????????? ? ??????????? ????, - ??????? ??????? ?? ?????????? ??? ????????, ??????????????? ????? ??????. ?? ????????? ?????????? ???????????? ???????? ?????? ??????? ???????, ?????????? ???????. - ?????? ?????, - ????????? ???????, ???????? ??? ?????? ?? ????? ??????. - ????? ????????. - ??? ?? ???????? - ???????? ??????, ???????, ??? ??? ??????? ????????? ???-?? ??? ?? ??????????? ?????????????. - ?? ???, ??????, - ??????? ???????. - ?????? ??????????? ?????. ?????? ???????? - ?? ??????? ?? ???????. - ??? ?????????? ?????? ?????. ? ?????? ??- ??? ?????? ?? ???????????????? ?????????, ??????? ????????? ???????????? ???- ???, ? ????? ????????, ??? ?????? ????? ???????? ???????????????? ??????. - Si, santa Lucia! - ???????? ????????, ????? ????????? ????????. - ?????- ?????????? ??????! ?????? ?? ???????? ???? - ?????? ??????? ??????, ???????? ??????????? ??? ?????????. - ????? ???? ????? ????????, ??? ?? ?????? ??? ???????? - ??????????? ????? ???????? ????. 16 - ?????????? ??????????? ???????? ?????. (????.) ?????????? (????.) 17 ???????! ?? 18 ????????!","???????. ? ???, ????? ????????? ??? ??????? ??????? ? ??????????, ??????? ??- ?? ?????. ?????? ???? ???????????. - ?????? ???? ???????????! - ? ? ??????? ?? ?? ??????, - ??????? ????????, - ??????? ??? ????? ????? ??? ??????????. ?????? ?????????? ?? ????????. - ?? ?? ????????, ??? ? ???? ??? ???????? ??????, ?????? - ???? ???????? ????????????, - ??????? ???????, ?????????? ??????? ?????? ????????, ?? ??????? ?????? ????? ???? ?????????? ? ????????, ?? ??????? ??- ???? ?? ?????. ????? ?????? ?? ???? ?? ?????? ???? ????????. ???? ?????? ??????? ? ?????? ????? ???? ?????????, ?? ?? ???? ??? ???????? ???? ?????, ??????? ???????? ? ???????? ??????????, ????? ?? ?? ?????? ? ???- ???????? ???????? ???????? ?????????????? ?? ???????: \u00ab??? ??, ???? ?? ?????- ??? ??? ??????... ? ??????, ????, ?????? ???? ? ?????!\u00bb ???????? ?????? ??, ??? ?? ????? ?????? ????? ???????? ??????????? ??????, ? ??????? ????????? ? ???- ?????? ???????: \u00ab? ???? ???? ???? ?????????? ????, ????? ??? ? ????? ?? ??- ??\u00bb. ??????? ????? ???????? ? ?????????????. ????? ???? ???? ??????????? ????- ???, ???... ????? ??????? ????????. ?????????? ??????????, ??????? ?????????, ?? ????? ?? ?????? ????? ???? ??? ????? ????????, ? ??????? ?????????? ? ?????????????. - ????????, - ??????? ??????? ? ??????? ?? ??????? ??????? ???????. - ? ??? ???? ???? ?????? ?????? - ?????-?? ????, - ?????????? ???, ????? ???????? ??????? ????? ????? ? ?? ??????? ???????? ?? ????????? ?????. - ?? ???????. ?????? ????? ??? ????????, ??? ?? ???? ????????? ?? ??????? ????? ????. ?? ?????? ????? ?? ?????, ?????- ??, ? ???????, ??????? ?? ?????????... - ????????! - ????? ??????? ???????. - ?????? ????? ???? ??????, ?? ??-?? ???! ?????? ??????! ?????? ?????????? ???????????? ? ? ????????? ?????? ????? ??????? ????? ? ??????? ? ???????? ???????????? ?? ????????? ??????. ?????? ??????????? ???????? ?? ????????. - ?? ? ??? ????????? ? ?????????? ????, ??? ???????? ????? ????????? ??????? ????????? ??????? ????. - ? ?? ??????. ?? ?????? ????????? ?????? ? ??????? ??????? ???????? ?????? ????? - ?? ??- ???, - ??????? ???? ????? ?? ????? ???????????? ? ????????????? ??????. ?? ???????, ????? ?????????? ????? ???????? ?????????? ???????????? ???????, ??? ??????? ?? ????????????? ? ??????? ????????? ? ???????? ?? ??????, ?????? ?? ???? ????????? ???????????? ????. ????? ????? ???? ????? ???????, ??? ?? ???? ???????? ??????????????? ?????, ? ?? ?????????? ???????? ???????? ?????? ?????. - ??????????????? ????? - ???????????? ??????. - ??, ? ??? ??????, ? ??????? ?? ???? ????????? ?? ????? ????. ?? ???????- ??? ???? ??????????? ?????????????? ????????? ???????? ?????????? ???? ?????? ?????, ????? ????????? ???? ???????? ? ??????. ?? ?????? ???????????? ??????- ??, ???????? ? ?????? ????? ? ????????? ?? ????? ??????? ????, ??? ?????? ??????? ???????. ?? ?????? ??????? ?????? ??????? ????? ?????????????? ?????- ????? ? ??????? ????????????. - ??????? ??????????? ????? - ????????? ??????. ????? ???? ???? ??????????? ???????, ??? ??????? ??????? ??? ?????... ?? ???- ?? ??????? ????????. - ????????, - ?????????? ???????, ?????????, ??? ? \u00ab???\u00bb ????? ?????? ?????","????????? ?????? ????. ??? ???????? ????? ?? ???? ?????????????? ?????? - ????????- \u00abtre donne benedette\u00bb, - ??????? ???????? ???????? ??????? ????? ?? ????????, ???. ????????? ????? ??????? ???? ?????????? ? ???????????? ????? ?? ???? ???????? ????? ? ????? ???????? ????????. - ???? ?? ????? ?????? ?????, - ?????? ?? ????? ?????? ????????, - ?? ????- ??????? ??? ?????... ?????? ???, ??????? ??????? ????? ???????. ?????? ???????? ?? ??? - ...????? ? ???? ?????, - ?????? ???????. - ??? ??????????? ???????? ??? ??????. - ??? ???????? ?????? ?? ???????. - ?? ???????, ??? ??????? ?? ????????? ?? ????? ?? ?????????? ? ?????????... ??? - ?????????? ?????????, - ??????? ??????. - ? ?????? ??? ????????. ????. - ?? ??? ????? ????? ?? ?????, - ?????? ???????. - ??????, ??? ? ?????? ??????? ????? ?????-?? ?????? ?? ??????. ????? ??????? ?????, ??? ???-?????, ??? ???????????? ??????, ? ???????????? ???????? ? ??????????? ??????? ?? ??????????. ??????? ? ????????? ????? ???- ????? ??????. ????????? ???????????, ??? ???????? ??????? ?????????? ??? ??- ????????? ????... ? ???, ???? ???????, ? ?????, ????????? ????????? ??? ??????- ????????? ????. ??? ? ??????? ??????????? ?????? ?????. ??????? ?????? ???????? ????????? ?? ?????? ????? ? ????. ?? ????? ??????? ??????????? ????, ??? ???????? ???? ????? ?? ??????? ????????... ????? ??????? ???????? ?????? ??????????? ???? ??????????? ????????... ??? ?? ????, ??? ??, ??????????? ?????, ???????? ??????? ?????, ? ????? ????????. ? ???? ?? ???? ??????, ?????????? ??????? ????? ??????? ????????, ? ?? ??????? - ?????????? ? ?????????. ?? ?????? ??????, ?????? ???? ??????????? ? ????????? ????????? ??????? ? ? ????? ? ?????? ???????? ????? ???????? ?? ?????? - ???? ??? ????? ??????? ????? ??- ????????? ?????, ???. ?? ?? ????, ??? ?????????? ????????????? ???- ?????? ?? ?????? ? ?????? ????? ??????? ???????? ?? ?????? - ???????? ? ???- ????, ??????? ? ???????? ??? ???????. ??????? ????? ???????? ????? ? ??????? ?? ????? ???????? ????. ??-?? ??- ?????? ??? ?????????? ????? ???????? ??????? ???? ?????, ????????? ???? ???- ???? ? ???????, ? ????????? ?????? ???????? ? ????? ??????? ?????, ??? ?? ??????????? ???????????? ???????, ?????? ??????, ? ?????????? ? ????. ????- ???? , ??????? ??????? ?? ????? ???????????? ????. ?????? ??????? ?????? ????- ??, ??? ??????????? ?????? ???? ?????, ?? ??? ?? ? ??????? ??????? ?????, ?? ???????? ?????? ????????? ????? ?????? ???? ????????? ?? ????? ????? ?????, ?????? ??? ??? ???????? ????????????. ? ?? ??? ???? ????? \u00ab?????\u00bb - quaranta - ?????? ??????? ???????????? ? ????????????? ????? \u00ab????????\u00bb. ????? ????? ??????? ? ????????, ? ????????? ????? ?? ??????? ??????????? ??????? ???????????, ???? ????????????? ?? ?????, ?????? ???????? ?? ??????- ??? ?????? ? ???????? ??????? ?????? ?? ??????? ???????????? ?????? ????? ?? ?????. ???????: ?????? ?????? ??? ?????? ??????? ??????? ?????? ?? ???????, ??? ?????? ????? ??????? ??????? ?? ???- ??????????? ????? ???, ?? ???? ?????? ???? ???????? ???????? ????????? ?????- ????. ? ???? ??????, ?????????? ???????????? ???????? ? ????????????? ????????? ???, ??? ??????? ? 1883 ????? ???????? ?????? ??????????? ????????? ??????, ???? ? ??? ????????? ?? ?????????? ???????? ?????????? ?????? ?????? ?????? ????? ?????????? ??? ?????-???????? \u00ab?????????\u00bb. ?????? ?? ?????? ?? ??????????? ?????? ?????? ? ????? ??????? ????? ??? ???? ???????????, ???? ???????, ??? ??????, ?????? ??? ?????-?????? ?????, ?? ??????? ???? ???????? ?? ???????????:","CA' PESARO: GALLERIA INTERNAZIONALE D'ARTE MODERNA19. ????????? ??? ????? ??????? ??????? ?? ? ?????? ??? ??????????? ?? ???? ??? ????????? ?????????? ?????? ??????? ?????? \u00ab???????\u00bb. ??????????? ????1 ? ???- ?? ??????????, ?? ???? ???????????? ??????? ????????? ?????? ? ??????? ????, ??? ???? ?? ??????????? ????????? ???????? ????????? ??????, ???????? ??????? ??? ??????????? ?????????? ????? ?????????. ??????? ??????????? ??????, ??? ????? ???????????? ????????? ? ???????????? ????????? ?? ?????? ????????????? ??-??????. ????? ???? ????, ? ???????? ???????? ????????. ??????? ????????? ?????????? ???? ???????, ???????????? ???????? ?? ???????? ???? ? ??????? ??????? ?????. ????? ??? ???????????? ? ???? ????? ????????, ??????? ?????? ?????? ? ?????? ?? ??? ?????????? ???????? ???????? ??????, ?????? ????????? ????. ???? ???????? ????????... ? ????????. ??????? ???????? ????????. ? ?????? ??- ???????? ???? ???? ??????? ????? ? ??????? ???? ?????? ????. ????? ??? ????? ??? ????, ????? ??????? ?????????, ??? ??? ?????? ?????? ???????? ????? ???????: ?? ????????????? ????? ????? ??????? ????? ?????- ???????? ?????? ???? ???????? ????? ????????. ?? ?????? ????? ???????????? ????? ?????????? ???????? ?????? ?? ??????. ????? 69 ??????? ??????? ????? ????? ?? ????? ??????????? ???????? ?????? ???????, ???, ??? ?????????? ?????? ??????? ??????? ? ???????? ????. ???? ??????? ???- ???? ???????? ??????? ??????????? ???????? ??????-??-??? - ??????? ???????. ????? ?????-?? ??????????? ???????? ????? ??? ?????? ?? ????????? ?????????. ?????? ??????? ??????-??-??? ??????? ????????? ??????? ?????? ???, ?? ??????? ??????????? ?????? ????? ??????? ? ???????? ? ???? ???????????? ????. ?? ?? ?????? ?????????? ??????????? ?????, ?? ? ?????? ???????????? ??????? ? ????- ?????????? ??????. ??????? ??????? ?????. ???? ? ????. (???????). ????????????? (????.). 19 ??????? ???????????? ????????? ??-??????:","???????? ???????? ?? ?????????? ????? ? ????? ??????, ? ????? ?????? ?????- ????. ????? ????????? ???????? ???????? ???????????? ?????? ??????? ???????- ????? ??????? ??? ???? ???? ?? ???? ????? ???, ?? ?????? ?? ?????????, ??? ??? ??- ??????? ???????????? \u00ab???????\u00bb, ?? ??????? ??? ????? ??????. ? ?????? ????- ?? ??????? ???? ?? ???????? ?????? ????????????. ??????? ????? ??????? ? ???????? ??????? ?????, ?? ?????? ?????????? ???? ???????? ?????? ? ??????? ?????, ??????? ?? ????????? ??? ? ?????????? ? ?????????? ????????? ? ???????? ????????? ?????????. ????????, ??? ??? ????- ???? ? ??????????? ?????? ?? ?????????????? ?????????? ??????????. ?????? ???? ???? ???? ?? ?? ???? ??? ???? ????????????? ?????? ????????? ???????, ????????????? ?????? ????? ? ???????? ????? ????? ? ??? ?? ?????. ?? ??????? ???????, ???????????? ?????? ????, ????????? ?????????, ???????? ????? ??????? ??????? ????? ? ????, ? ?? ??? ??????????? ??? ??? ?????? ? ???????? ????? ??????? ???????? ???? ????? ?????????? ????????????????????? ???????. ??????? ??????, ??? ? ????????? ???? ?????????? ????? ??????? ??- ???????, ??? ?? ???????? ?? ???????? ???? ?????. ???? ? ????????, ???????? ?????? ???????? ????????????? ? ????? ???????, ? ????? ??????? ??? ?? ?????? ??? ???????, ??????????????? ?????????? ? ????? ???????. - ??????, ???? ? ??????? ? ???? \u00ab?????\u00bb? - ?? ??????? ?? ????????, ???????- ???????? ?? ??????? ??????? ??? ???????????? \u00ab???????\u00bb. - ?????? ????? ????? ??????. ????????? ????? - ???, ??????? ??? ????? ?? ?????, - ???????????? ??????, ????????? ?? ???- ???? ?? ?????? ??????? ??????. ???????? ?????????? ????? ???????. - ??? ???????. ?????????! ????????? ????????, ????? ???????? ????????? ?????? ? ?????? ??????? ?? ??- ?? ?? ?????, ??????????? ?????. ? ?????????? ??????? ????????, ??????? ?? ???????? ???????????? ????, ????? ??????? ????? ??????? ?????? ?? ???????. ???????? ???????, ??? ??????? ?????? ?????????? ?????? ??? ?? ?????. ?? ??- ??? ??????? - ??? ????? ????? ? ????? ????? ? ???? ? ??????? ????? ?????? - ?????????? ???????????? ????????????? ?? ??????. ?????? ???????? ????????? ? ???????????? ???????? ? ?????? ? ????? ?????????? ???????. ?? ???????? ????? ?? ?????????? ? ????? ????? ????? ? ???? ????? ??????, ???????????? ? ??????- ?? ?? ?????? ?????. ???? ??? ??????? ???????? ???? ?????, ??? ?????? ??????? ???????????? ??????? ???????? ?? ????? ????. ? ???? ????? ??????? ?????????? ????????????? ???????? ? ?????, ??? ??? ??????????? ??????? ? ????????????? ????????? ???????. ?? ?????? ??????? ?? ?????? ?????? ?????? - ?? ???? ? ???- ???????????? ?? ?????????? ???????, - ????? ?? ????????? ?? ???????? ????? ??-?? ?????????????? ??????. ???????? ? ????????? ??????? ?? ???? ?? ??????, ???? ??????? ??? ????????- ??. - ?????? ??????? ????????????? ???????? - ??????? ??, ??????????? ? ??????- ??? ?? ??????? ????????? ?? ???? ?????. - ??? ???????????? ????????????? ??- ???? ?? ???????. ??? ?????????? ferro di prua - ?????? ?? ????. ??? - ?????- ???????? ???????! ???????? ????????, ??? ????????? ?? ???? ?????? ???????????? ??????? ????? ????????????? ?????. ????????? ????? ?????? ????????????? ??????? ?????, ????? ?????? ??????? - ??? ????? sestieri, ??? ???????, ???????, ? ????????- ????? \u00ab??????\u00bb - ????????????? ??????????? ????????? ????? ????????????? ??- ??. ????? ???, ??????? ???????, ???????? ?????????? ? ???? ?? ???????. ????? ???????, ????- ???? ???? ??????????? ??? ??????? ??????? ??? ?????... ?? ????? ??? ????????.","??????? ??????? ?????? ?? ?????, ??? ? ???? ????????? ????????? ????. ??? ?????????, ??? ????? ???? ?????? ????? ?? ???? ???????????? ????, ??????????? ? ??????? ????????? ?????????? ?????? ??????? ?????, ??????? ?????? ????? ???????? ? ???? ???????? ????????? ????????, ?????????? ?? ????? ? ?????????- ????????? ?????? ? ?????? ?????. ??????? ? ????? ??????? ?????. ?????????? - ??????. (???????). ? ??????, ??? ??-?? ??????? ?????? ???????? ?????? ?? ?????????, ??? ????- ??? ?????????? ??????? ?????????? ??????? ????, ??? ??????? ?????????? ? ??- ?????? ???????????? ??????? ? ??????. ????????????? ? ?????? ??????? ???? ?????????? ?????? ??????? ?????? ? ????, ????? ???????, ? ????? ??????? ????- ????? ??????? ??????? ?????. ????? ?? ??? ????????? ?????, ???????? ? ?????? ? ?????? ????????, ??? ? 1902 ???? ??? ???????, ??????? ??? ??????? ????????. ??? ?? ???????????, ?? ???????????? ??????? ???? ????????? ????? ?????? ???? ?????. ????? ??????? ????? ????????? ? ????????????? ????????? ?????? ? ????? ?? ???????, ??????????? ?? - ??????? ?? ??????? ?????? ???????? ?????? ???????? ????- ?????-???????? ???????? ?????? ??????????, ??????? ???? ???????? ? ??????? ???? ?? ???????? ?? ??? ??????? ?????????? ? ???????? ?? ??????? ??- ??????? ?????? ? ??????? ?????. ??????????, ??????????? ??????? ????, ??????????? ??????? ? ???????? ????- ??, ????? ??????? ???? ???? ??????? ??????? ??????? ????????, ?????????? ?? ???????? - ????????? ???????????? ??????????? ?????, ??? ??????? ?????? ??? ???????? ???????? ??????? ????????? ?????, ??????? ???????? ?????????? ???? ? ???????? ?????. ?????????, ??? ????????? ???? ????? ?????????? ????? ???????? ???????? ???? ? ??????? ?????? ? ????? ?????, ????????? ????????? ? ???. ????????? ???????? ?? ????-?????-???????? ??????, ??????? ????????? ??? ???, ??? ?????????? ????????? ? ????? ?????? ????. ?????, ?? ????? ????????- ??? ??????? ??????? ?????, ??????? ?????????? ????????? ? ????. ?? ??????? ???????? ??????? ??? ????? ????? ????????? \u00ab??????? ???????????\u00bb. ???????, ??? ? ? ?????? ???, ?? ???? ??????? ??????? ? ?????? ????? ???? ????????????? ?? ?????? ??? ?????? ??????. ?? ????????????? ?????? ????? ??- ?????????? ?? ???? ???????? ?? ?????? ??????? ?? ????? ????????? ???????. ???????? ? ?????? ???????? ????????????, ??? ???? ????????? ?????, ?? ???- ???? ????? ? ??? ???? ?????? ???????????? ????? ???-?????, ???? ??????? ??","???? ? ???????????? ? ?????????? ? ?????????? ??????? ??????. ???????? ?????? ????? ????? ? ??????, ? ?????? ????? ?????, ??? ?? ??????? ??????? ?? ????????????? ?? ?????. ???????? ???-?? ?????? ??????? ??????? ????? ????? ???????? ???????? ??????, ??, ???? ?? ?????, ???????????? ?????- ???? ?????????? ??????, ??? ????????? ?? ???????. ????????, ??? ??????? ???- ??? ?????????? ?? ???, ?? ???????? ??????? ??????????? ?? ??? ???????????. - ???? ??????????! - ?????????? ??????, ?????????? ???????????????. ??????? ?? ?????, ???????? ?? ??? ??? ?? ??????, ??? ??????? ?????? ??? ??- ???, ????? ????????? ???? ?? ????... ??? ??????, ??? ???, ????????, ? ???-?? ??? ????, ???????????? ?? ????????? ?????????????. ??????? ???????? ????????? ??????????? ?????????? ???????? - ????? ????? ???????? ?? ????? ????????? ???????, ??? ? 2000 ???? ????????? ??????? ???- ????? ????????? ???????. ????????? ? ??? ??? ????????? ????? ??????????? ?? ???????? ???????, ?????????? ???????? ??????? ??? ?? ??? ???????? ? ???. ??- ????? ????? ???????, ??????? ??????? ?? ??? ??????, ? ???????? ??????, ????? ??? ??? ?? ?????? ??????? ???? ????????, ????????? ??, ?????? ??? ?????? ? ???????????? ???? ??????. ?????? ????? ?????, ?? ??????? ?? ?? ?????, ? ? ???? ? ??????????? ??? ???- ??????????? ????. - ? ???? ??? ? ???????? - ???????? ?????? ?????????. ??? ????? ?????????. - ??... ?????? ?????????. - ?? ??????? ?????? ?? ????????. - ???????????? ??? ????? ????? ? ??????. - ??? ???????! - ?????? ????? ??????. - ???? ?????! ????? ?????????? ? ??????? ??????? ?????, ? ?????? ?? ???? ????????? ????- ?????????? ?????? ?????. ??????? ???????????? ???????? ????????????? ??????????? ?????, ?????? ???- ??? ???????? ?????????? ????????????. ? ??? ??? ??????? ??????? ? ??????, ??????????? ??? ??????????? ??? ??????- ???? ???????, ? ?? ??? ??????? ??? ???????????? ????????????? ?????????? ? ???????????? ???????? ???????? ??? ?????????? ??????????????? ?????????????- ???? ? ???????????????? ????????? ????. ????? ? ???? ????????? ?????? ?? ?????? ?????????? ?? ????????? ?????????- ???, ??? ???? ??????? ???????? ???????? ???????? ????????, ??????? ???????? ? ? ??????????? ? ????? ???????????????. ?????????????? ???? ?? ???????? ??????- ???? ?? ????? ?????????? ???????? ??????? ? ???????? ?????????? ?? ???????? ????????????-????????? ???????? ????????? ? ????????? ???????. ????? ????? ???????? ? ???????, ???????, ????????, ??????????? ????????? ????? ? ????? ?? ??????. ?? ????? ????????? ??????? ?????, ? ??? ???????? ???? ???????, ????????? ???? ????? ?? ???-?? ? ????? ??????, ??????????? ???- ??? ????? ?? ??? ?????. - ?? ??? ??? ???????? - ??????????????? ??, ?? ??????? ???????. - ??????. ?? II Ponte dei Sospiri, - ???????? - ?????????? ???????????? ????. ??????? ??????? ?????? ?? ?????, ? ??? ????? ???????? ??????????? ???? ?? ???????????? ??????????, ?????????? ????????????? ???????????? ? ??????? ???????, ??????? ???????? ??? ??????. ???? ???????, ??????? ??, ???????? \u00ab??- ??????? ?????\u00bb, ???? ?? ????? ????? ??????? ? ?????????? ???????. ? ??? ????- ???????? ???????, ??? ???? ???? ?????????? ?????????? ?? ????? ??? ???? ????- ????? ?????? ??????? ?????, ?? ?? ??????? ??????? ?? ???????. ??? ?????????- ???? ?????????? ??????? ???????? ?? ??? ?????, ???? ?????? ????????????? ??? ????, ??? ? ?????? ???????????? ?????????????????? ????? ????, ? ??????? ?? ??-???????? ????? ???????? ??? ??????... ? ? ?????? ??? ???????, ?????, ? ???- ????????, ?? ?? ??????.","???? ???????. ? ?????? ????? ??? ??????? ??? ?????????, ?????, ??? ????? ????????? ???? ??????? ??? ?????? ?????????? ?? ?????, ? ??????. ??? ??????????, ???????? ? ???????, ?????? ???????? ?????? ????? ? ??????? ???????? ? ??????? ?????- ??????, ? ?? ????????? ????? ????? ???????????? ???? ??????????? ?? ????? ??- ???? ??????. ??????? ??????? ??????? ??? ?????? ? ? ?????????? ?????, ??? ?????? ?????- ???? ???????? ? ??? ???? ?? ??, ??? ?????????? ?? ?????? ?????, ??????? ????? ???????????? ????????????, ? ??, ??? ????????????? ???????? ??????? ?????? ??????. ?? ???????? piombi, ?? ???? \u00ab????????? ???????\u00bb, ??-?? ???????? ????- ?????? ?????????? ?????, ??? ???????? ????? ??? ???? ?????????? ?????, ? ??- ??? ????? ???????. ??????? ???????? ???????? ?????? ? ????????? ?????? ?????- ????? ???????, ???? ??? ????????? ?????????? ?? ????????? ? ?????????? ? ????????. ??????, ??? ??????? ??????, ??????? ?????????. attento!20 - ??????? ???????? - Sta' ???????????? ??????????, ????????? ??- ??? ?? ?????? ??? ????????????? ??? ?????. ?????? ????????? ????? ????? \u00ab??- ?????\u00bb, ????? ? ????? ????? ?? ??????? ??????? ????? ? ?????? ?????. ???????? ???????? ???????????? ????? ?? ????? ?? ????? ? ???????? ?? ?????? ??? ????, ????? ?????????? ?? ???? ? ?????? ???????. ???????? ?????, ?? ???- ????? ???? ? ????? ?????????? ?????. - ???????, - ???????????? ???????, ????? ??????????? ????????? ????????? ??????? ??? ? ?????. ?? ??? ?????????? ??????, ??????? ???????? ?????????? ? ?? ? ???? ?????????? ?? ????. ????????? ?? ????? ????? ??????. ????????? ?? ?? ?????, ??????????? ?????- ??? ????????? ???????? ?? ?? ????? ? ???????? ? ?????, ????? ????????? ????- ???? ????? ????????? ? ????????? ?? ????, ??? ??? ????? ???????? ????? ?????- ?? ??????????. ?????? ??????? ???, ??? ?????? ?? ????????. - Grazie, ????????, - ???????? ??????? ??? ? ???????? ?????? ?? ?????? ??- ???. ????? ????, ?? ????? ???????, ?????? ???????? ? ??????? ?????? ?????. ???????? ! (????.)","????? 70 ?????? ????????? ? ????? ?????? ??????????? ???????????????, ????????????? ???????? ????? ????? ???? ?????????? ? ??????? ????? ?? ??????? ??????? ???- ??. ????????? ????????????? ???????? ????? ???????? ??????, ?????????????? ???- ???????? ?? ?????? ????? ?????, ??? ??????? ?? ?????? ?? ???????? ???? \u00ab????? ??52 ????????\u00bb, ?????????? ????????? ?? ???????????. ????????. ????? ???????????? ??? ???????? ??? ?? ?????? ??????? ??????? ?????? ???- ???? ???? ???????? ?? ??? ???????? ???????? ????????. ??? ?????????? ??? ???? ? ?????????? ??????????? ??????, ??????? ??? ?? ????????? ??????? ?????. ??- ??? ?????????? ????? ?????? ??? ??? ????, ? ???????? ?????? ??????? ???????- ??????, ??? ??????? ? ???????? ?????? ????? ??????? ???? ?????. ????? ?????? ? ??? ???? ????? ?????? ?????. ???? ?? ? ??????? ????? ?????- ?????? ??????? ???????, ?? ???? ??????????? ??? ???????????? ??????? ??? ??- ?? . ??????? ??????????? ?? ???. ???? ??????? ??????, ? ?????? ?????? ????????? ??????? ??????, ??? ????? ??? ???????? ?????????? ???????? ? ???????? ???????. ??????, ?????? ???????? ??????, ?????????? ????? ????????????? ??????????????? ??????. ???? ?? ???????, ??? ? ????? ?????, ? ??????? ???????? ???, ????????, ??? ?? ?????? ????? ??????. ???? ?????????. ????? ??? ?????, ??? ??????????, ??? ???????? ? ??????? ?? ????? ???????, ? ??? ?????? ?????????? ????? ??????. ?????? ??? ???????? ??????? ?? ?????? ??????, ????? ??????????? ???????, ??? ????? ?? ???????? ????? ?? ??????? ?? ???????? ???????. ?? ????? ?????????? ??????, ??? ??? ??? ????? ???????? ???? ?????????, ? ???????? ?????????? ? ????? ????? ? ???????, ? ??????????? ???- ?????????????? ??????? ? ??????? ???????? ???????, ????????? ?? ??????????. ???????? ??? ? ?? ??????, ??? ??????? ???????? ?? ??????? - ?? ???? ??? ??? ???? ?? ?????????, - ?? ?? ??????? ??? ??????? ??? ???????????? ??????. ???????????? ??????? ? ??? ????????? ?? ?????? ??????? ??? ?????? ?? ????- ????. ????? ?? ? ??????? ?? ????? ???????? - ?????? ??????????, ?, ???? ??- ??????? ????????? ???????, ?????? ? ??? ??? ??? ?????? ?????????. ??? ???????? ???. ??????????? ??????, ?????????? ??????? ????????, ??????? ????? ????? ?? ???? ?????. ??????? ??????? ?????? ??????? ??? ?? ???????? ? ??? ??????? ????????????? ????? ?? ? ??????, ? ????????????? ???? ?? ??????? ?????????? ?????, ?? ??- ????????? ??????????, ??????? ????? ??????? ???????? ? ??????? ?????????? \u00ab?????? ??????\u00bb. ????? ????????? ???? ??????? ???-??????, ???????? ????- ????? ???????????? ??????, ??? ?? ????? ???????? ???????? ????? ???? - ???? ?? ?????, ??? ?????? ????????? ?? ????? ? ???????? ?????, ?? ????????. ???????? ?? ????????-????? ?????? ??????? ?????????? ? ???????? ??????????- ????????? \u00ab?????\u00bb. ?? ????? ?? ?????-????????? ?????????? ?????? ???????? ?? ????? ?? ? ??? ?? ????????. \u00ab????????\u00bb ? ?? ???? ??????????? ?????? ???? ??????????? ??? ??????, ? ?????? ?? ?????? ?????? ?????? ?????????? ???????? ?????? - ?? ??? ??????? ? ??????? ????????? ????????? ???????. ????? ????? ??????? ? ??????? ?????????? ????????? ?? ???- ?? , ??????? ?????????, ????? ?? ?????????. - ?????? ??????, ????? ?????????? ?? ????. - ?????? ?? ?????? ??????? ???- ???? ????? ?? ????. ??? ?????? ???? ??????? ? ????????, ?? ??? ? ???????. - ? ?????????? ??? ?? ??????. ??????????, ???????? ?? ????. ?????????? ?? ?????????? ???????, ?????? ???????? ????????, ??? ? ???????-","??? ????????, ??????? ?? ??????? ?????????, ????? ????????? ????. ?? ????? ????? ??? ???? ?????? ?????. ????????? ????? ?????, ? ??? ????? ?????? ???? ??? ???????????, ?????? ????????, ??? ?????????? ?????????, ? ???? ????? ???????? ???. ???? ?? ????????????? - ? ???????? ???????? ???. - ? ????? ?? ?????????? ? ???????? ?????? ??? ??????????, - ?????? ??????? ????? ? ?????? ? ????????? ?? ??????. - ?? ?? ??????????? ???????? ???????? ???????. - ???, - ???????? ??????, ? ? ??? ?????? ??????? ?????????????. - ? ?? ??- ?????????? ???????????? ??????? ?????? ?????????? ???????? ?????. ??... - ?? ???? ??? ? ???????, - ????????? ??. - ??????. ?? ??????? ?? ??????. ?????? ????? ??????? ?? ???????, ? ????? ??????? ?? ????, ??????? ????????? ?? ??????. - ???????????? ?????????. ??? ??? ?? ????????. ????? ????? ?? ????? ?????- ?????? ?? ?????. ?? ?????, ?????? ?????????? ?????, ????????? ?? ?????? ?????? ? ??????? ? ?????? ?????? ?, ????????? ?? ????? ?????? ? ?????????? ??? ???????, ?????? ?????. - ?????? ???-?????? ??????? - ????????? ??, ????????? ?? ???. ??? ???????? ???????, ??-???????? ??????? ? ????????, ??? ??? ?? ?????. ??? ??? ??????????? ???? ???????? ??? ?? ?????? ????? ??????????? ??????? ?? ???, ?????? ?????? ??? ???????????. ??????????\u00bb? - ?? ??????, ??? ??????? ??????? ??????? ??? \u00ab?????????? - ? ???? ???? ????-?????? ???????? ? ??? ????. ??????? ????? ?? ???????????? ?, ??????? ? ?????, ??????? ?? ??????? ?????. - ?????????, ??????????. ?????? ??????? ? ?????????? ?? ?????. \u00ab??\u00bb ?????? ??? ????????? ?????? ???- ????????? ?? ?? ??????? ???? ??????, ??????? ??????? ? ?????? ?? ??????????- ??? ??????????. - ??????? ??? ??? ??? ????? ??? ?????? ?????. ??? ???? ???????. ????? ????- ????????? ?? ????????? ???????. ?????? ?????????? ????? ?? ???? ????????. ?? ??????? ??? ??????? ????, ???????, ??? ??????? ??? ????? ???????? ????. ??? ???? ?????????? ???. ? ?????? ??????? ????????? ?? ????. - ? ????? ???? ?? ??????? ??? ?????? - ? ??????? ?? ????. ? ??????, ?? ???? ??? ????????? ????? ?????. - ? ??????? - ? ?????? ? ??????? ???? ??????????? ????????... ? ???????? ? ????. ??????? ?????? ??????? ????? ????? ? ?????? ? ???? ?? ? ?????????? ???????- ?????? ????????????. ?? ????, ??? ?? ????? ? ?????? ????? ??????? ?? ???? ??- ??????????. ???????? - ???, ? ??????? ???????, ?????? ?? ????????, ???????? ?????, ?? ? ?????? ???????? ??????????? ????????? ??????????? ???????????????? ???????? ?? ?????????? ??? ??????, ??????? ????????? ????????? ?????????- ????? ? ??????? ????? ???? ? ????????: - ? ???????, ??? ?????? ???? ???? ???? ???????????? ????????????????, ?? ? ???????. ???????? ????? ?? ?????????? ???????? ??????? ? ???????, ??? ???? ??????? ??????? ????????????? ?? ???????. ? ????? ??????? ??????? ?????? ????????? ??????, ??????? ?? ? ???- ?????? ? ?????? ????????? ?????? ?????.","- ??? ????? ?????????? ??????? ???????. ?? ???????????, ??? ? ??? ?????? ?????????? ?????????????? ??????. ?????? ??? ?????? ?????? ?????????????, ????? ???????? ????????, ? ?????- ????????? ????? ?????? ????? ????. ??????? ?????? ????????????, ? ?? ?????? ??????... ? ?????-?? ????????? ??????. ???? ? ??? ???????? ?????????? ??????? ????????. ??? ?????????????? ????? ?????? ?????? ?????????? ? ??????????? ? ????, ??- ??? ???? ??????? ? ????????? ???? ??? ? ????????? ?????????, ?? ??????? ???? ???????, ???? ? ???. ??????? ? ???? ????? ??? ????????? ???????? ???? ???? ??????????. ??? - ??????? ???????. ???????? ????????????. - ??? ??? ??????! - ???????? ???. - ??? ????! ??????? ??????? ???????? ??????????????, ? ?? ?????? ????????, ?? ??????? ????????????? ? ???????. - ?????? ??????, - ??????? ??, - ? ???????? ???????? ????? ?? ???? ?????? ?? ???. ??????? ??????, ???? ???????? ? ?????????? ????-?????-????????, ????? ????- ?????. ?? ??????? ??-?? ??????? ???? ????????? ?????? ???????? ????? ????, ??????? ???????? ???????????? ? ??????? ??????? ??????? ?????. \u00ab????????\u00bb. ?? ?????? ? ??-2080 ?????????? ????. ????? ?????? ???? ?????????? ?? ? ??? ??????????. ?????? ??? ?????? ?????... ? ????? ?? ??????. (??????????? ???????)","?????? ????????????? ?????? ??????? ?. ?????? ?????? ????? ????????? ???, ??? ???? ???-?? ?????? ? ??- ?????????? ????????? ? ?????????, ? ????? ???????????? ????????- ???? ???????????? ??????. ??? ??? ????? ????????????: ??????? ??????????? ????????? ???? ???????? ? ???????? \u2014 ??????? ????? ?????. ? ???? ??? ????????, ????????? ???????? ????, ??????, ????- ?? ???? ?? ? ?????? ??????? ??????? ?????-?? ??? ???? ????????? ??????? ?????, ??????? ???????? ????? ?? ????????? ??????: \\\"????? ???? ?????? ????????????? ???????? ???, ???????????? ???????? ????- ???? ???????? ?????????? ????? ??????? ? ?????????? ?? ??????? ????????, ???- ??? ? ???????????? ????? ?????? ??????? ???????????? ? ?????, ??? ???????? ? ?????????? ?????\\\". ? ???? ??????????? ??????????? ????????? ?????????? ????\\\", ? ?????? ???????- ????? ?????????? ?????????? ??? ????????? \\\"?????\\\". ?????, ???????? ??? ????- ??????? \u2014 ??? ?????????????????? ???????????? ????????, ????????? ?? ?????- ???????????, ??????????? ? ??????? ????????? ??????. ????? \u2014 ??? ??????? ??- ????????, ??????? ????? ????????? ?????? ????????, ??????? ???????????? ???, ??? ???? ???????? ???????? ????? ?????? ????? ????????????? ? ??? ?????? ??? ????????????? ???????? ??????????? ??????? ?????????? ???????????? ??????? ?????? ?????????????. ? ???????????? ?????????? ?????? ???????? ???????, ??- ???? ??????????? ??? ?????? ?????????, ? ??????? ????????????? ??????????, ??- ??????, ???????????, ???????????-??????????? ?????, ? ????? ???????, ??? ?????? ?????????, ?????????, ????????? ? ???????????? ?????????.","????????? ????????? ????????? ????????? ????????? ????????? ??????????? ????????? (????? (??????? ???????????) (?- ???????) ??????) ? \\\\ ? ? ^ -? X ? ? ?? ? ? ?????? ?????? ????? ??????????????? ????????????? ?????? ?????????????? ??? ??? ??????- ??????, ??? ??? ???????????? ??????? ???????? ????????????? \u2014 ??? ????. ????, ??? ?? ????? ??? ????, ????? ??????? ??????????? ? ????? ??????\\\" ??- ???? ???, ???????? ????????? ??? ? ???? ?????? ? ??????? ????????????? ????? ?? ???????????? ? ????????? ????? ? ???????? ????????, ??? ??? ?????? ??? ????? ?????????????? ?????????, ? ?????? ???- ? ??? ????? ??? ??????? ????????????, ????? ?? ????? ?? ????? ?????????????. ?????- ?????? ?????? ??? ????? ??? ?? ?????? ?????????? ????? \u2014 ???????????? ?????- ??? ??????? ??????? ??????? (TNFR, ????). ??? ?? ????? ??????? ??????? ?? (???) , ??? ?? ??? ?????? ?? ??? ????????, ???????? ???????????? ??????, ?????????? ??????????????????? ????????????????? ?????????, ??????????????? ? ???????? ?????????? ? ???????????. ? ?????? ????? ??????? ??????? ???????.","?? ?????? ?? ???????? ??????????, ??????????, ???????????? ? ????????, ???????????????? ?????????, ??????????? ????????? ??-1, ??-6, ??-8, ???????- ????-?????, ?????????? ????????? ? ???????? ????? ?? ?????? ???????? ?????? ?? ??????????????? ????????? ? ???????. ??? ????????? TNF, ??????? ????????- ?????????? ???????? ??? ? ????????? ??????? ????? ?????? ? ?????? ?????????, ????????? (TNF-R1 ? TNF-R2), ???????? ????????????? ??????????? ???????? ???- ????? TNF. ?????????, ??? ???????? ???????? ??????????, ????? ?????? TNF ???- ???????? ? ????????????? ???????? ???? ??? ???? ?????? ??????????? ???????, ??? ?????? ????????? ????????? ? ????????? ?????????????????? ???????. ??? ?? ??????????? ?????????, ??? ????? ? ?????? ????? ??????? ???? ??????- ???? ?????????????, ???? ?????????? ???????? ??????. ??? ?? ?????, ???????? ?????????????? ????? ???????? ? ???????????? ??????????????????? ???????????, ? ???????? ??? ???????, ???????? ??????????. ??????, ????? ?? ????????????? \u00ab?????? ??????????\u00bb ????? ?????????? ?????????? ? ????. ????, ??? ????, ????? ?????? ?????????????, ?????????? ??????? ????? ?????- ??? ?????-??????? ? ???????? ???? ?????? (Protein Data Bank), ?? ????????? ???????? ?? ????? ??????? ???????????? ??? ?????. ? ?????? ?????? ??????- ???????? ????? ????????? ????????? ? ??????????? TNFR ????????. ??? ????? ??- RSCB Protein ??????? ????? ?? ???? Data Bank1 ? ? ????????? ?????? ??????: ? ???????? TNF receptor \u2014 ?? ?????? ???? ????????? ?????? ??????? ?????? ??- ???? ?????. RCSB PDB Deposit ^ Search *? Visualize ^ Analyze \u00bb Do- ? --1? I855.il Biological Structures Macromolecular D? ?? !__, -^ Enabling Breakthroughs in ) P R () T !: I N Research and Education -, | Brewse -nnotations ?AN ? |pdb l^^^-r-irTr.BB- CM, 'flf\/ftn ffS^ YEARS 0F \u00a3: r5^ IBProtein DI ata Bank _. A Structural View of Biology December Molecule of the Month This resource is powered by the Protein Data Bank archive-information about of proteins that helps the 3D shapes nucleic acids and complex assemblies and researchers students and understand all aspects of biomedicme - Deposit agriculture from protein synthesis to health and disease Q, Search Li Visualize As a member of the wwPDB the RCSB PDB curates and annotates PDB data ::: Analyze ? Download The RCSB PDB builds upon the data by creating tools and resources for ? Learn in molecular research and education biology structural biology computational Latest Entries biology and beyond COVID-19 ir CORONAVIRUS Resources CetehtutfUw. PROTEIN ????DATA BANK ik- SARS-CoV-2 Spike Variants ?????*???282021 I Features & Highlights Publications- ????? ???? ??? ????? ????????, ????? ????????? ?????? ????? ?????? ???????, ??????????? ?? ????????? ???????. ??? ?????? ?????????? ????? ????? ???????? ???????? ?? ???????? ?????? ??? ?????? \u2014 ????? ????????? ?????? (??????????? ??????????? ??? ??????????????????? ??????) ? ?? ?????????? (?????????? ????- ????) . ??? ???????? ?????? ????????? ??????????????? ????????? ????? ???????? ???????? ?????? ?? ??, ??????? ???????? ??????? ???????????????????? ???????, 1 https:\/\/www.rcsb.org\/","??? ??? ?????? ?? ????????? ??????? ?????? ???????? ????? ??????, ? ?? ?????? ?? ??????? ????????. ?????? ????? ?????????? ???????? ??????, ?????? ????????????? ?????????? ????? ?? ?????? ??? ????????? ??????, ? ?? ?????? ????????? ?????????????? ??????????????????? ???? ? ???, ??? ??????? ????? ?????????? ??????????????? ????????? ???????- ?? ?????, ????????? ?????? ?? ?????????? ????????. ????? ???????, ????????? ???????? ????????????? ?????????? ?????????????? ? ???????? ???????? ? ????- ?????? ??????????? ???????, ???????? ????? ????????? ??????????? ??????? ???- ??. ? ?????????????? ??????? ???????? ???????????? ????????? ????? ???????? ??? ?????? ?????? ??????????? ???????? ??????? ??????????? ??????? ???????????. ???? ??? ???? ?????? ?? ?????? ????????: ???????? ? ???? ????????????????? ?????????? ??????? ??????? ? ???????? ????? ????, ??? ????????? ?? ????????- ??? ???? ????????? ??????????? ????????? ?????????? ? ????????? ?????????. ???????????? ????????? ??????? ???????????? ??????, ?????????????? ??????- ???????? ????????? ??????? ????????? ?????, ????? ?????? ???????????????????, ?????????? ???????? ??? ?????????. ??????, ??????? ?????????? ? ???? ???? ??????, ????????????, ?? ????, ???????? ?? ?????. ????????? ?????????, ??- ????????? ?? ?????????? ??????? ?????? ?????????? ?? ????? ????????????? ???- ??? . ??? ????????? ????? ???????? ????????????? ????????? ????? ?? ????????? ??????????, ??????????? ?? ???? ?????? ????????? ????????. ???? ????????? ??- ???? ???????????? ????????? ????????????? ?????: ????????????? ????????????? (??? ?? ? ???? ? ????????), ????????????? ???????, ???????????? ????????? ?????????, ???????????? ab initio2 ? ??. ???? ?????????????????? ????? ??????????? ????????? ????????? ? ????? ??? ??????????? ???????????????????? ?????? ? ????????? ?????????? (??? ????? ???????, ????????, ? ????????? MEGA X) ? ? ???????????? 80 ??? ????? ???????? ?????????? ? ?????? ?????? 25% ???????, ?? ???????? ?????????????? ?????????- ??? ????????? ??????????? ?????????, ??????????? ??????? ???????????????????, ?? ????????? ????????? ? ????????? (?????????) ??????????. ????? ????? ????- ???? ????????????? ?????????????? ??? ?????????????? ?????????. ?? ???? ???- ???????? ????????? ?????? ?????? ???????????? ?????? ????????? ?????????. ???? ?????????? ????????? ????????? ??? ?????? ??????? ?????????????????? ?? ??????????, ?? ???????? ?????????? ? ??????????????? ??????? \u2014 ?????????- ??? ????????? ?????????. ???? ???? ????? ? ???????????? ????????????? ??????? ??????? ????????? ????????? ?????????: ???????????, ???????????, ???????????? ??? ????????????????. ????? ???????????? ?????? ???????? ?????????????? ???? ?????????. ?????? ????????????? ??????? (?????-??????????) ????????? ?????????? ????- ?????? ????????? ? ???????? ?? ?? ????????? ??????? ???????????????????, ?? ????????? ? ????? ????????. ????????????? ?? ?? ?????? ????????? ???????????? ????? ? ?????????? ????????? ???????? ????? ? ??????? ?????????, ???????? ?????????? ??? ????????????? ??????????????????, ????????? ??????? ? ?????? ???? ???????????. ????? ?????????? ???????????? ????? ??????????????????? ??- ????? ? ????????? ?????????? ???????????????????? ?? ???? ?????? ????? ???? ???????? ?????? ??????? ??????? ?????????? ????????? ?????. ?????? ab initio ???????????? ???????????? ????????? ?????? ?? ?????? ????- ????? ? ????????? ?? ????????? ?????? ?????????? ????, ???????? ??????????- ???? ????????????? ? ????????? ????????. ? ?? ???? ???? ??????? ????? ?????? ? ???????????? ???????? ????????????? ?????????????. ???????????, ? ?????? ?? ??? ???? ?????????? \u2014 ?????????: 2 ?????? (???.) ? ??????","Q Homo sapiens (55057) Q Mus musculus (7779} 1TNR Download File View File r~j Escherichia coli (6464! f~J synthetic construct (5413) CRYSTAL STRUCTURE OF THE SOLUBLE HUMAN 55 KD TNF RECEPTOR- Q Escherichia coli K-12 (3876) HUMAN TNF-BETA COMPLEX: IMPLICATIONS FOR TNF RECEPTOR ACTIVATION (\\\"J Rattus norvegicus (3434) Q Bos taurus (3306) (1993) Cell 73 431-445 Q Saccharomyces cerevisiae (2913) S288C Q Callus gallus (2141} Released 1994-07-31 Method X-RAY DIFFRACTION r~) Saccharomyces cerevisiae Homo sapiens 2 85 A Organisms TUMOR NECROSIS TUMOR NECROSIS FACTOR ???? (protein) Macromolecule FACTOR RECEPTOR P55 (protein) TAXONOMY QEukarvota (100574) 1EXT Download File View File Q Bacteria I63673) Q Riboviria (10274) EXTRACELLULAR DOMAIN OF THE 55KDA TUMOR NECROSIS FACTOR AT PH3.7 IN P21 21 21. r~j Archaea(5523'i RECEPTOR. CRYSTALLIZED r~j other sequences (5473) fiai smith J H sprang SR Q Duplodnavina (2665) r~\\\\ Vandnavina (608) (1996) Structure 4 1251-1262 r~~j Monodnavina (506) Released 1997-01-11 Method (~J unclassified sequences (359) X-RAY DIFFRACTION 1 85 A Organisms r~j Naldavincetes (48) Homo sapiens Macromolecule tumor necrosis More factor receptor Unique Ligands (protein) EXPERIMENTAL METHOD MO S04 Q X-RAY DIFFRACTION (1595531 1D4V Download File View File Q SOLUTION NMR (11769) (J ELECTRON MICROSCOPY (9363) Crystal structure of trail-DR5 complex Q NEUTRON DIFFRACTION (185) J Crimes J U Stuart D I Jot . MongkcHsapava 4&? Q ELECTRON CRYSTALLOGRAPHY (164) ^w-% (1999) Nat Struct Biol 6 1048-1053 Q SOLID-STATE NMR (1 36) Q SOLUTION SCATTERING (65) Released 1999-11-01 Method Q FIBER DIFFRACTION (30) X-RAY DIFFRACTION 22A Drnaniemc ???? ???.1\u00bb=.?? ???????? ?? ?????? ?????, ? ??????? ???????? ??????? ?????????? \u2014 ????? ??? ? ????????? ??- ?????? ??? ????????? 1???. ???????? ?? ???????? ?????? ?? ?? ?????? ????????. RCSB PDB Deposit - Search - Visualize - Analyze )ocumentation - Careers E'peoment 1? ? Display Files ~ ??? Biological Assembly 1EXT FASTA Sequence EXTRACELLULAR DOMAIN OF THE 55KDA TUMOR NEC CRYSTALLIZED AT PH3.7 IN P 21 21 21. PDB Format DOI: tO pdrCE:CCpc!t> PDB Format (gz) Classification: SIGNALLING PROTEIN PDBx\/mmCIF Format col PDBx\/mmCIF Format Organism(s): Homo sapiens (gz) Expression Escherichia Mutation(s): System: No ? PDBMUXML Format (gz) Deposited: 1996-07-03 Released: 1997-01-11 Sf Biological Assembly 1 Deposition Naismith JH sprang Author(s): Experimental Data Snapshot wwPDB Validation ? Structure Factors (GIF) Structure Factors (GIF - gz) Method: X-RAY DIFFRACTION Metric Resolution: R-Value 1 85 A Rfree ^? R-Value ?? Hi 3D View R-Value Free: 0 243 Clashscore ?? Validation Full PDF H Validation XML Work: 0 203 Ramachandran outers ?? Observed: 0 203 Sidecham outliers Global Symmetry Cyclic ?- C2 <. i RSRZ outhers Global Stoichiometry Homo 2-mer AC ? fo-fc Map(DSN6) 2??-?? Map(DSN6) D.v,\u00ab Map Coefficients (MTZ format) 1 assigned by autho-s and This is version 1 2 of the entry See complete histo isofUvarei Biological assembly qenerated by PISA I Download Primary Citation I\u00bb\u2022 Macromolecule Content","????? ?????????? ??????? ???? FASTA Sequence ? ???????? ??? ?????? ? . txt ??? ?????????? ?????? ? ?????-??????. ? ??????????? ????????? ????? ? ?????????????? ??????????????????? ??????- ???? ????????? ????? ????? ?????? ?????? ?????? ?? ????????, ??????? ???????- ?? ? ?????? ?????? ????? ?????? \\\">\\\". ??????? ??????? ?????? ????? ?????? ??? ?????????? ?????? ? ??????? ?????????? ??? ?????? ??????, ???????????? ?????- ?????????????? ??? ?????????????. ? rcsb_pdb_lEXT.txt - Notepad [six \\\"? File Edit Format View Help ' >1EXT_1|Chains ?, ?|TUMOR NECROSIS FACTOR RECEPTOR|Homo sapiens (9606) IMdsvcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhclscskcrkemgqveissctvdrdtvcgcrknqyrhywsenlfqc ??????, ????? ????, ??? ?? ???????????? ? ???????? ??????, ?? ?????? ????- ???? ????? ? ??? ??????? ?????? ?????? ????? ????????, ?? ???? ?? ???? NCBI3 ????????? ?? ???????? ????????? BLAST. National Center for Biotechnology Information Log in BLAST Help Home Recent Results Saved Strategies Basic Local Alignment Search Tool A new feature was added to the NCBI IgBLAST BLAST finds regions of similarity between biological webpage sequences. The program compares nucleotide or g IgBLAST is now able to determine Ig protein sequences to sequence databases and W isotypes Learn calculates the statistical significance. more 9 Mon, 01 Nov 2021 12:00:00 EST ? More BLAST news. Web BLAST ?? ?????? ???????? ????? ??????? ??????, ??? ???????? ??????? ???????? \\\"Protein BLAST\\\" ??? ????, ????? ????? ???????????? ?????????????????? ??? ??- ???? ?????????? ?????. ?? ???? ???????????? ?????????????????? ??????????? ?? ? ????? ??????? ??? ?????. ??? ????? ?????? BLAST? Basic Local Alignment Search Tool \u2014 ???????? (???????????) ????????, ??? ????????? ?????????? ?????? ????????? ????????????. ????????????? ? ??????? ????? ????, ????? ????? ???????, ??? ?? ???????? NCBI BLAST ? ?? ? BLAST ??- ?????? ????????? ?? ?????. ???????, ??? ????? ???? ???-?????????. ??????, ??- 3 https:\/\/www.ncbi.nlm.nih.gov\/protein","??????? NCBI BLAST ???? \u00ab????? ????????\u00bb, ?? ??????? ?? ???? ?, ????????? ??? \u00ab???? ????????\u00bb ? ????? ?????, ?? ????????????? ????????? ? ?????????? BLAST. ??????? ????? ?? ????? ???????? ????? ?? NCBI \u2014 ??????? ??????? ??????? ????- ????? ?????. ????, ??????????? ???????? Basic Local Alignment Search Tool ???? ???????? ????????? ? ???????????? ? 1990 ????. ????????? ????? ????????????? ? ?????- ???? ??????????????? ????????, ??? ???????? ???? ??????? ????????????. ? ??- ??? BLAST ?????? ????????? ??? ?????????? ?????????? ???????????? ? ??????? ????? ??? ????? ?????? ??????????????????? ? ???????????????????? ?? ???? ??????, ??? ???, ??? ? ??? ???????? ???????????????????. ????, ??????? ? ?????? ????????? BLAST, ??????? ? ???, ??? ?????????? ??- ??????? ?????? ?????????? ????????? ????? ????????? ? ???? ???????? ?????? ?????????? ????????, ??? ??????? ? ????? ??????? ?????. ?????????????, ?????- ?? ?? ????? ?????? ? ???? ?????? ?????? ???????? ??????????, ? ????? ??????- ?????? ?? ??? \\\"????????\\\", ?? ??????? ????? ?????????? ????????? ?????????? ???????? ????? ??????? ??????? ????????????. ??????? ???????? ???????? ???? ??????????? ??????? ?????????? ?????? ??????????????????, ????? ??????? ???- ???? ???? ????????? ???????? ? ?? ???????????? ? ????? ??????????????????. BLAST ??????? ?????? ???? \\\"???????\\\" ???? ????????????? ????? (?? ????????? 3 ??? ???????? ???????????????????, 11 \u2014 ??? ????????????), ??????? ?? ??- ?????? ????????????? ? ????? ??????????????????? ? ?????, ???? ?????? ??????- ???? ????????, ?????? ????? 2 ??? ?? ???????. ????? ???????? ????????? ???? ??????, ? ?????? ??? ??? ?????????? ????? ?? ?????? ???????? ??????? ??? \\\"?????????? ??????????\\\", ????? ????????? ????????? ??????? ???????????? ?? ?????????? ???- ???????? ??? ??? ?????????? \\\"?????\\\", ? ????? ????????????, ?????????? ????. ???????? ?????? ???????????? ?????? ???????????? ????????????, ??? ??? ??? ????? ??????????? ???????? ?????? ?????? ????? ????? ???????????? ?????????- ??? ??- ???, ?????? ??? ????????? ????????? ????????????? ??????????????????? ???? ??????, ? ?? ????? ??? ???? ???????????? ???????????? ?????????? ?????- ?????? ??????????????????? ??? ??? ????? ???? ?????????????. ? ????????? ?????? BLAST ??????? ????????? ???????: BLASTP (?????????? ???- ??????????? ?????????????????? ??????? ? ??????????? ???????????????????? ?????? ?????), BLASTN (?????????? ????????????? ???????????? ?????????????- ????? ? ???????????????????? ?? ??) , BLASTX (?????????? ?????????? ???????? ????????? ?????????? ? ?????? ??????? (????? ?????) ?????????????????? ?????- ?? ??????????? ? ?? ??????), TBLASTN (?????????? ???????? ?????????????????? ??????? ? ???????????????????? ?? ???? ?????? ???????????? ???????????????- ????, ??????????? ????????????? ? ?????? ??????? ?????????? (??? ????) ? PSI- BLAST (?????????? ?? ?????????????????? ??????? ? ??????????? ?????????????- ?????? ??????? ?? ???? ?????). ? ????? ?????? ?? ????? ???????????? ??????? BLASTP, ??? ?????? ?????????- ??? ??????????????????? ? ????????? ?????. ?? ???????? BLASTa ????????? ? ??????? ?????? ??????? ?????? ????? ? FASTA ??????? ?? ???? ?????????? ?????, ??????? ?? ?????????. ?????? ???????? ?? ??- ?????????, ??????? ??? ?????? ?????????? ??? ?????? ???????????? ?????????- ?????????? ? ??. ? ????? DataBase ????? ??????? ???? ?? ???????????? ??? ??????? ???????? ??????, ? ??????? ????? ?????????????? ?????: ? ??????????????? (???-redundant) ???????? ?????????????????? (?? ??? ?????? ??????- GenBank, PDB, Swiss Prot ? ??. \u2014 ?? ?????????; ?????????? ????? ???) . ? ?????? ?????????????????? ??????, ?????????????? ? NCBI (Refseq_protein). ? Model Organisms (???????? 27 ???????, ????????????? ????????? ??????? \u2014","????? ?????? ??????????? ??????; ???????????? ?????? ? ??????? SmartBLAST.) ? UniProtKB\/Swiss-Prot (???????? ?????????? ? ???????? ???????????????????). ? Patented protein sequences (?????? ??????????????? ???????????? ?????????- ????????? ??????). ? Protein Data Bank proteins (?????, ?????????????? ? ???? ?????? PDB, ??? ??????? ???????????????? ??????????? ????????? ? ?????????? ?????????). ? Metagenomic proteins (?????????????????? ???????? ???????? ???????????? \u2014 ?????????? ?????????????? ??????? ????????????? ?????? ??????????, ??????- ??? ? ??? ??? ???? ????????). ? Transcriptome Shotgun Assembly proteins (?????????? ? ?????? ???????? ?? ?????? ??????????????, ????????????? ????????????). ??? ?????? ????????? ???? ????? ???????????? ?????? ???????. ?????? ? ????? \\\"????????\\\" ?? ?????? ?????? ????????? ???????? ???? ?????????, ? ??????? ???- ?????? ??????????? ????? ??? ?????? ???????????? ?????. ????? ???????? ??. ??? ??, ????, ?????- ? ????? ???????????? ?????? \u2014 ?????????, ????????????? ? ????????, ??????. ? ??- ??? , ????????? ?? ???????????? ??? ??? ???? ???, ??? ????? ??????????? ??????? ???? Molossus molossus. ????? ?????? ??????? ?? ??- ???????? ????????? ??????????????????? ? ???????????????? ???? ? ???????? ?? ???????? ???????? ??BLAST\\\" . BLAST\u00ae\u00bb blastp suite Home Recent Results Saved Strategies Help blastn ???? Standard Protein BLAST blastx tblastn tblastx BLASTP programs search protein databases using a protein query, more... [ Reset page ] ( Bookmark ) Enter Query Sequence Enter accession number(s), gi(s), or FASTA sequence(s) ? clear Query subrange Q From I MI^VCPjQGkYIHPCWNSiq^^ New columns added to the qcr^sjxjJgt^ ~\\\" ~~~\\\" ? ~~\\\" ~ Description Table ^? Columns' lclpqienT \/y\/. To Click Select or 'Manage Columns'. Or, upload file Browse... No file selected Job Title Enter a descriptive title for your BLAST search Q I Align two or more sequences \u00a9 Choose Search Set Database Non-redundant protein sequences (nr) ]\u00a9 Organism Molossus molossus exclude ( Add organism ' OpHon.il Enter organise common name binomial or tax id Only 20 top taxa wil be shown \u00a9 sample sequences Exclude Optional ? Models (XM\/XP) l_l Non-redundant RefSeq proteins Q(WP) Uncultured\/environmental Program Selection Algorithm Quick BLASTP (Accelerated protein-protein BLAST) \u00ae blastp (protein-protein BLAST) 1 PSI-BLAST (Position-Specific Iterated BLAST) (Pattern Hit Initiated BLAST) \\\" PHI-BLAST 1 DELTA-BLAST (Domain Enhanced Lookup Time Accelerated BLAST) Choose a BLAST algorithm ? Search database nr nsinn Blasto (Drotein-orotein BLASTl ???????? ????????? ??? ?????????, ???? ???????? ????? ?????????? ???????? ?????????? ??????????????????. ????? ??? ????????????? ?? ????????, ??? ??? ???????????? ????????? ?????? ???????? ?? ??? ???????????????????, ??????? ????? ????? ? ???? ?????, ????- ??? ?? ??????? ?????????. ????? ??? ?????????? ?? ??????????????????, ???????","? ????? ???????? ?????????? ???????????? ????????? ????? ? ???????? ???????- ??? ???????? ????????? ?? ????????? ? ??????? ??????????. ??? ???????, ????? ?????????????????? ????????? ? ?????? ??????, ? ? ?????? ?????? ?????? ?? ?????? ?????. | ? Your search is limited to records that include Molossus molossus ; and exclude models (XM\/XP), uncultured\/environmental sample sequences Filter Results Job Title Protein Sequence RID WXW6C96WQ16 Searcn expires onOl-Oi 1901 pm Program Organism only top 20 wm appear I | exclude Database Downioad_A.lj v BLASTP ? Citation v- Type common name binomial taxid or group name \u20224- Add organism nr See_detailsv Query ID lcl|Query_91919 Percent Identity E value Query Coverage Description None to to to amino acid Molecule type Reset Query Length 162 Other reports Dis^i^Jrjee^results rvljj?|pje^a11gnm?11 MSA_vjewer \u00a9 Descriptions Graphic Summary Alignments Taxonomy Sequences producing significant alignments Download ? Select columns v Show 100 v Q U select al 3 sequences selected GenPept Graphics Distance tree of results Multiple alignment ?MSA Viewer Description Max Total Query E Per Ace value Ident Len Accession Scientific Name Score Score Cover Q TNF receptor superfamily member 1A [Molossus molossus] Molossus moiossus 252 252 99% 5e-83 74 53% 449 KAF6454106 1 ? TM F_r\u00a3c e ptcj_s ? pejtarnj1 y_ membe r. 25. [ ?? =i ui_mol ]? s s us ^loJip_ss_u s. m_o ioji sus 62 0 62 0 81% 2e-11 30 71% 379 KAF 644 5440 1 Q TNF receptor superfamily member 25 [Molo-.sus molossus] Molossus moiossus 62 0 62 0 81% 2e-11 30 71% 416 KAF6445437 1 U hypothetical protein HJG59 010448 [Molossus molossus] Molossus moiossus 60 1 60 1 68% 7e-11 36 61% 253 KAF6396472 1 LI hypothetical protein HJG59_010449 [Molossus molossus] Molossus molossus 57 8 57 8 69% 6e-10 35 09% 323 KAF6396473 1 TNF receptor superfamily rrember 1? [Molossus molossus] Molossus molossus P43 5 43 5 56% 2e-05 34 41% 155 Feedbacl ????? ?? ?? ??????? \\\"Multiple alignments\\\", ??? ????????????, ?? ????? ??- ???????? ???????????? ????????? ?????????????????? ? ???????. ?? ??????????? ?????? ?????, ??? ???????????? ??????????????????? ?????????? 75%, ? ?????? ?? ????? ????? ??????????????? \\\"?????????????? ??????????????\\\" ????????. ??? ???? ????? ?????????? ? ?????????? ?????????, ??? ?????????? ???????? ?? ID ????? ?????????????????? ? ??????? ?? ????????, ??????? ??? ???????? ?????????? ?? ?????????????? ?????????????????? ????? ???? ????????????? ??- ??????? ??????? ??????? ???????. GenPept w TNF receptor superfamily member 1A [Molossus molossus] GenBank KAF6454106 1 Identical Proteins FAS ?? Graphics Go to |v| KAF6454106 449 aa linear MAM 07-AUG-2020 LOCUS TNF receptor superfamily member 1A [Molossus molossus]. DEFINITION ACCESSION KAF6454106 PRJNA62 8 57 4 VERSION 5AMN147 3 4 44 8 DELINK KAF6454106.1 JACASFU10 000010.1 DBSOURCE BioProject: KEYWORDS BioSample: SOURCE accession ORGANISM Molossus molossus (Pallas's mastiff bat) Mo1?s s u ? mo1? ? ? u ? Chordata; Craniata; Vertebrata; Euteleostomi; Eukaryota; Metazoa; Laurasiatheria; Mammalia; Eutheria; Chiroptera; Microchiroptera; Molossidae; Molossus.","????? ????? ?? ???? ???????? ?????? ?? ?????? \\\"?????????\\\", ??????? ?????? ????? \\\"FAS??\\\". ????? ?? ??? ?????????? ??????? ???? ???? ? ???????? ?????? ? .txt , ????? ?????????? ??????. ??? ????? ?? ???? ???????? ?????? ?? FASTA ? ??????? ?? ???????? ? ???????- ???????????? ? FASTA ???????, ????? ?????? ??????????? ?????????????????? ?? ???????? ? ????????? ? txt ????. ????? ????, ??? ??????? ?????? ? ?????? ???????, ??? ?????????? ?????????? ??? ?????????????????? ? ???? ???????. ?????? ?????? ???? ?????????????????? ????????????? ??? ?????, ? ?????? \u2014 ?????-??????. ??? ????, ????? ? ?????????? ???? ????????? ???????, ????? ???- ???? ???, ????? ??? ?????? ?????????????????? ??????????? ????????? ??????. sequence.fasta.txt - Notepad - ?X File Edit Format View Help T] >KAF6454106.1 MGLPTVPGLLLPLVLLALLVERYPSGFARLVPRCRDWEKRDSQCPQGKYTHPQNDSICCTKCHKGTYLYK DCPAPGLDTDCRECESGTYTECENYLRQCLSCSKCRTEMNQVEISSCRVDQNTVCGCRKNQYQKYLSDTV FQCQNCSTCLNGTVQIACSDKQNTVCTCHAGFFLKNNECKPCVNCEKDSECTKLCLPTTETVKGAQDPGT TVLLPLVIFFGLCLLSLVSMGLICHFQRWKPKLQSIFCRKSTPVKERVSEHLAPGFSPTTGFSPIPNCIP SPTFTPSDWSHHRDASAAQMASSHQGAGLLLNAAPASTPIPTILPKWEGSTYTQQQQQQQQQQQRPDADP ATLYAWDGVPPSRWKELVRRLGLSEHEIELLELQNGRCLREAHYSMLAAWRQRTPRREATLELLGQVLR DMELHGCLEDIEATLCGPASLSPLTHLPR >1EXT_1 MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISS ?????? ????????? ???? ? ???? ?? ????4 ??? ???????????? ?? ?????? ClustalW. ? ????? ????? ??????? ??? ???? ?????????? ???????????... ???????? ClustalW ???????? ???????????? ?????????? ?????????????? ???????- ??????? ???????????? ? ??????????? ????????? ???????: 1. ??????? ?????????????? ??????? ?????????? ????? ???????????????????? ???? ??????? ???????, ????????? ?????????? ??? ?? ???????? ??? ???????? ??????- ?????? ?????????? (2-4 ?????????), ???? ???????????? ?????????? ?????????- ?? ???????????? ??????????????????? ? ????????? ???????? ?? ????????; 2. ????? ???????? ???????????? ?????? guide tree ??????? ????????????? ????- ??? (neighbor joining) , ???????? ??? ??????? ????????? ?????\\\" \u2014 ?????? ??- ?????, ? ??????? ??????? ????? ?????? ?? ??? ??????? ?? ????????? ???? ?????; 3. ? ????? ?????????? ?????????????? ???????????? ?????????? ????? ????? ???- ??? ???????????? ???? ??????????????????-??????????????????, ?????????- ?????????-??????? ? ???????-??????? ? ???????????? ? ???????????? ???????. ???????????? ???- ? ???????? ???????? ??????? ????????? ??? ????????????, ???????? ???????- ????, ??????????? ??????? ???????? ????????? ????????? ?????? ???????. ?????? ?? ????? Multiple Sequence Alignment by CLUSTALW ???????? ???? ? ? ???????? ????????? ? ????? ?????????? ??????? ???????????? SLOW\/ACCURATE ???????? \\\"???????????\\\". 4 https:\/\/www.genome.jp\/tools-bin\/clustalw","Multiple Sequence Alignment by CLUSTALW ETE3 MAFFT CLUSTALW PRRN Help General Setting Parameters: Output Format: CLUSTAL v Pairwise Alignment: FAST\/APPROXIMATE \u00ae SLOW\/ACCURATE Enter your sequences (with labels) below (copy & paste): \u00ae PROTEIN DNA Support Formats: FASTA (Pearson), NBRF\/PIR, EMBL\/Swiss Prot, GDE, CLUSTAL, and GCG\/MSF A Or give the file name containing your query Browse... sequence.fasta.txt Execute Multiple Alignment Reset ????? ???????????? ????? ???? ?????????? ???????? ? ????? ?????????????, ??- ??? ???????? ??? ????? ???????? ???????????? ??? ???????????? ? ????? ? ???, ???????? ?? ?????? ??? ?? ???????? ???????? ?? ????. ??? ????? \\\"????\\\", ??\u2014\\\". ???????? clustalw.aln CLUSTAL 2.1 multiple sequence alignment KAF6454106.1 MGLPTVPGLLLPLVLLALLVERYPSGFARLVPRCRDWEKRDSQCPQGKYTHPQNDSICCT MDSVCPQGKYIHPQNNSICCT 1EXT 1 KAF6454106.1 KCHKGTYLYKDCPAPGLDTDCRECESGTYTECENYLRQCLSCSKCRTEMNQVEISSCRVD 1EXT 1 KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD *********.*** ** *?*?********..* **-?*-*-?*?*****-*-?*- ** ******* ** KAF6454106.1 QNTVCGCRKNQYQKYLSDTVFQCQNCSTCLNGTVQIACSDKQNTVCTCHAGFFLKNNECK 1EXT 1 RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV ..**-*-****-*- + *\u2022* *- .*** *** **?****...* ?\u2022 *********?*****..*** KAF6454106.1 PCVNCEKDSECTKLCLPTTETVKGAQDPGTTVLLPLVIFFGLCLLSLVSMGLICHFQRWK 1EXT 1 SCSNCKKSLECTKLCLPQIEN * *+.* ******** * KAF6454106.1 PKLQSIFCRKSTPVKERVSEHLAPGFSPTTGFSPIPNCIPSPTFTPSDWSHHRDASAAQM 1EXT 1 KAF64 5 4106.1 ASSHQGAGLLLNAAPASTPIPTILPKWEGSTYTQQQQQQQQQQQRPDADPATLYAVVDGV 1EXT 1 KAF6454106.1 PPSRWKELVRRLGLSEHEIELLELQNGRCLREAHYSMLAAWRQRTPRREATLELLGQVLR 1EXT 1 KAF6454106.1 DMELHGCLEDIEATLCGPASLSPLTHLPR 1EXT 1","? ?????? ?????????? ? ????? ???? ???????? ??????????? ?????? ?? ????? ????- ???????? ??? ??????????????????, ??? ??? ???????\\\", ??? ???????? ? ????????? ?????. ??? ?? ???????? ?????????????????? ? ???????? ??????????? ?????? ???- ??????, ??????? ??????? ??? ? ??????????? ?????? ?????. ????? ?????????? ???- ??????? ??????: ?????? ?? \\\"????????\\\" ????? ??????? ????? ?????, ???? ??? ??- ??? ?????? ????? ?????????, ? ? ????? ????? ????? ?? ????? ?? ???, ??? ?? ??- ???????? ? ???????? ??????? ???? ??? ? ???, ??? ? ????????? ? ???????? ???- ????? ????? ? ??? ?????????? ????????? ??????? ????????? ????????? (???????- ??? ??? ?????????? ?????????????????? ???????????), ???????, ? ??? ????? ??- ?????? ?????? ????? ????? ?????? ????? ??? ????, ????? ? ????? ?? ?????? ???? ????????????? ????? ? ??????? ????????? (???????????? ?????????). sequence.fasta.txt - Notepad _JSJ_x| File Edit Format View Help \\\"? >KAF6454106.1 A RDSQCPQGKYTHPQNDSICCTKCHKGTYLYKDCPAPGLDTDCRECESGTYTECENYLRQCLSCSKCRTEMNQVEISS >1EXT_1 MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISS \u00b11 J ? ????? ????? ?????? ????? ?????????? ??? ?????????????????? ? ??? ?? ??- ????? : ?????? ?? ?????????????????? ??? ????????????, ? ?????? \u2014 ?????????. ???? ???? ????? ???????? ? ??????? .txt, ? ????? ??? ?????????? ????????? ? ?????? .fasta. ??? ?? ??? ??? ?????????, ??? ??? ????? ?? ????? ??? ?? ?????- ?? ????????? ??? ??????. ??? ????????????? ????? ????? ????? ??????? ?? ????5 ???????????? ????????????? ??? ????? ??????? ??????????????? ????????????? \u2014 SWISS-MODEL. SWISS-MODEL Re ? SWISS-MODEL Repository is a fuly automated protein structure Every week we model al the sequences for accessible homologYHfnodel ing server, or from thirteen core species based on the latest Pdb- via the Expasy web server, the UniProtKB proteome. Is your protein already program DeepView (Swiss modelled and up to date in SWISS-MODEL Viewer). Repository? The purpose of this server is to make protein modelling accessible to al life science researchers Worldwide. Start Modelling 5 https:\/\/swissmodel.expasy.org\/","????? ?? ???????? \\\"?????? ?????????????\\\" ? ??? ????????????? ?? ????????, ??? ?????????? ??????? ????????? ????????? ????, ????? ?? ??????? ?? ????? ???????????? ???? ?????. PV BIOZENTRUM SWISS-MODEL , ,,, :,o,u,\u201een-a:,on C^e* L\/lJU-lt Modelling ^epoi'-c .:, \u201e Start a New Modelling Project ? l Target Supported Inputs \u00a9 Sequence(s) C'ustal Please fil out this field. or a valid Target-Template Alignment ?\u00bb plain sinng OniFroiXB ACi User Template A DeepView Project \u00bb + Upload Target Sequence File... 1 &\\\"labcia-x Project Title Email Search For Templates H Build Model ????? ????? ??????? ?????? ???????? Target-Template Alignment, ??????? ??- ??????, ??? ???????????? ??????? ? ?????? ???????? ?????????????. ? ? ??????? ???? ?? ?????? ???? ??????????? ??? ???? ?????????????????? ?? ????????, ???? ???????? ?????-????. ????? ???? ??? ???? ????? ????????, ??? ?????? ???? ??? ????????? ????????? ?????????? ????????????? ????? ? ???? ??- ??????????????????, ??????? ????????? ???????? ? ???? ?????? ?? ???? ??????, ?? ??? ????? ??????????? ????????????? ????? ??? ?? ??????? ??? ????????? ??- ??? , ??????? ?? ??????? ???????. BIOZENTRUM SWISS-MODEL Modelling Repository Tools Documentation Log in Create Ac ?? Start a New Modelling Project ? For the uploaded target-template alignment 6 biounits and or chains were found to match your template Supported Inputs ? alignment, Please select which biounit you wish to use as the template Sequence(s) You can avoid this step by using the SMTL ID as the template name in your input (SMTL ID is <PDB ID>.<biological assembly>.<Chain ID>) Target-Template Alignment User Template DeepView Project lykdcpapgldtdcrecesgtytecenylrqclscskcrte1-in0vei ~ lyndcp:-pg;dtdcrecesg t en lr clscskcr em qvei y^ Target SSCRVDQNrVCGCRKNQYQKYLSDrVFQCUNCSrCLNGrVQIACSDKQNTVCTCHAGFFLKNNECKPCVNCEKDS -? cf.l.ASSC V2 TVCGCRKNQY YS FQC NCS CLNGTV C_ KQNTVCTCHAGFFLr TNEC'5C5NCFJCSL : =? ! = ?? Sequence Identity 74 07 Build Model \u00a35 Reset LYimCPAPGLDTDCRECESGTYTECENYLRQCLSCSKCRTEMNQVEI \\\" LYNDCPC-PG.DTDCRECESG T EN LR CLSCSKCR EM QVEI ^ Target SSCRVDQNT CGCRKNQYQKYLSD7VF0CQNCSrCLNGTVQIACSDKQNTVCTCHAGFFIJraNECKPCVIICEKDe \\\" Ift-s.l.ASSC VD T CGCRKNQY YS FQC NCS CLNGTV ? KQN7VC7CHAGPFL-- INEC 5CSNCKKSI 15 '--=? Build Model Sequence Identity: 74 07","? ???????? ??? ?????? ??????????? ??? ??????? ????????????? ????????? ????- ????????? ? ?????????, ??? ??? ? ????????????? ????????? ??????? ??????? ???- ???? ??? ???? ? ?\u2014 ?, ??????? ???????? ???????????, ?? ??? ??????? ???? \\\"?\\\" ????????? ????????? ? ???????????????? ? ???? ???\\\". rYLYKDCPAPGLDTDCRECESGTYTECEN \/\\\\ *\u2022 -^. rYLYNDCPGPGQDTDCRECESG T EN Targe- YLRQCLSCSKCRTEMNQVEISSCRVDQNTVCGCRPCNQYQKYLSDTVFQCQNCSTC lext.l.B. LR CLSCSKCR EM QVEISSC VD TVCGCRKNQY YS FQC NCS ? Target LNGTVQIACSDKQNTVCTCHAGFFLKNNECKPCVNCEKDSECTKL^^Bl Build Model ? Reset Sequence Identity: 74.07 ?HKGTYLYKDCPAPGLDTDCR \/\\\\ SCBKGTYLYNDCPGPGQDTDCR Target YLRQCLSCSKCRTEMNQVEISSCRVDQNTVCGCRKNQYQKYLS lext.l.A LR CLSCSKCR EM QVEISSC VD TVCGCRKNQY YS Target LNGT VQ I AC S DKQNT VC T ? HAG FFLKNNE CKPCVNCEKDSECT: \\\\\/ Build Model Sequence Identity: 74.07 Project Template Alignment: 1ext.1.A| Title: Email: [email protected] ? ?????? ?????? ?? ????? ????????, ????? ?? ???? ????????? ?????????? ????? 1???.1 ?? ????????. ????? ?????????? ??????? ???????? ??????? ? ??? ???????? ??????? ???? ?????, ????? ?? ????????? ????????????? ??? ?????? ??? ????????? ??? ?? ?????, ??? ??? ?????? ??? ??????? ????????????? ??????? ??????? ????- ????????? ????? ?????? ????????? ?????. ????? ??? ?????? ???????, ????? ??- ???? ?? ?????? ??????????? ??????\\\" ? ????????? ????????? ?????. Template Alignment: 1ext.1.A Created: today at 14:47 Summary Templates Q ^^^^^^^^H Project Data ? Model Results ? order?? gmqe Oligo-State Ligands GMQE QMEANDisCo Global Monomer None 0.84 dE) \u00b10.07 (requested by user) QMEANDisCo Local QMEAN Z-Scores Model 01 Template Seq Identity Coverage Description TUMOR Assessment 1ext.1 A 74.07% FACTOR NECROSIS v RECEPTOR D Cartoon . ?^ Model-Template Alignment","????? ?? ????? ?????? ????? ???? ???????? ??? ????? ???????, ??????? ?? ??- ???? ??????? ? ?????????, ??????????? ? ????? ??????\\\". ? ???? ?????? ?????? ???????? ??? ??? ????? ?????????, ?????????? ?? ???? ? ?????? ??????, ? ????? ???????? ??????: ?????????? ? ???????????, ??? ?????? ?? ????? ???????, ?????- ??????? ?????- ??????????? ???????, ?????-??????? ? ????-?????, ??????????? ???????- ??? ???????, ? ?????? ??????. ????? ????? ????????? ??????, ?????? ????? ??????: ? GMQE (Global Model Quality Estimation) \u2014 ????????? ???????? ??????, ?????- ?????? ???????????? ?????? ? ??????? ? ???????? ?????? ???????. ????????? ?? 0 ?? 1. ? QMEAN \u2014 ?????????? ?????? ?????????? ??????, ?????????? ?? ????????????? ?????????????? ???????????????: ????????? ?? ? ???????? ? ??????????????- ??? ?????????? ???????. ?????? ????????? ????????, ??????? 0? \u2014 ???????? ?????? ????????????? ???????? ??? ??????? ????????????????? ?????????. ???????? ?????? -4.0 ????????, ??? ???????? ?????? ??????. ? ???? 4 ?????????: QMEAN ???????? ? Cbeta - ?????? ??????????? ?????????????? ????? ?-???? ???????, ? All atom - ?????? ??????????? ?????????????? ????? ????? ???????, ? Solvation - ?????? ??????????? ???????????, ? Torsion - ?????? ??????????? ?????????? ?????. ?????????? ?? ??? ??? ?? ??? ??????, ??????? ??????? ??????????: ? Local quality estimate - ????????? ?????? ???????? ?????? ?? ?????? ? ????????? ?????????????? ???????? (<0.6 - ?????? ????????). ? Comparison - ????????? ? ?????????????? ?????????? QMEAN ??? ?????? ? ? ???????????????? ????????? ??????????. ?????? ?????? ? Z-value - ? ???????? ??????????? ?????????? ?? ???????? ??? ?????? ????????????? ? ???????. ? Seq Identity \u2014 ??????? ???????????? ?????? ? ???????. ? Coverage - ??????? ???????? ???????? ???????. ? ????? ???? ????????? ???????????? ?????-?????? ? ?????-???????, ????????- ??? ????????????? ? ???????????? ??????????. ??????? ??????? ???????????? ????????????? ???????????? ???????? QMEAN (????????? ???????? \u2014 ????? ????, ????????? \u2014 ???????). ????? ??? ??????? ??????? ??????? ? ?????? ??????? ???- ?????? ????????? (??????? \u2014 ??? ????-?????, ?????????????? \u2014 ?????-???????).",""]