MIddlesex West Chamber of Commerce Directory 2017-2019

™ Local Business Guide Sponsored by the Middlesex West Chamber of Commerce Julie L’Heureux, Sunlight Photography Middlesex West businesses tell their stories Stories begin on page 15 Directory on page 40 CMB VIRTUAL SERVICES

Read about us on page 36 Your Partner for Growth NBTC.com | 414 Massachusetts Ave | Acton, MA 01720 | 978.263.9501 PREMIUM MASSACHUSETTS & AMERICAN WINES Handcra ed in Westford www.AaronapCellars.com auto choose ICNE - a full service home independent insurance agency business benefits where you will receive great rates and trusted advice. 303 Littleton Rd., Unit 2 www(8.i0c0)n24e3-8.c1o3m4 Westford, MA 01886 2 www.mwcoc.com

Providing thoughtful service and careful attention for Read about us on page 35 all your home, auto, and business insurance needs. 978.369.5656 1150 Main St. Concord www.northbridgeins.com open everyday 3 5:30 am - 11:00 pm 55 Great Road Acton, MA 01720 978.264.2062 The Acton McDonalds is independently owned and operated by a local family. Middlesex West Chamber of Commerce ~ 978-263-0010

Read about us on page 33 CMB VIRTUAL SERVICES 4 www.mwcoc.com

978-692-6012 5 Cornerstone Square, Suite 202 Westford, MA 01886 SmileWestford.com We are located in the beautiful Cornerstone Plaza. Read about us on page 26 There is ample parking in the rear of the medical building, at the main entrance. Call today to schedule an appointment! Dr. Nicholas Papapetros , DMD, FAGD Dr. Leo Kharin, DMD 3D Imaging · Modern Technology · Professional Cleanings · Dental Implants Crowns · Veneers · Root Canals · Invisalign Middlesex West Chamber of Commerce ~ 978-263-0010 5

TABLE OF CONTENTS Profiled businesses and display advertisers in bold 110 Grill 9 Burtons Grill & Bar 21 1 on 1 Self Indulgence Spa & Sanctuary 11, 15 Cambridge Focus 41 24 Hours Care 15 Cambridge Savings Bank 21 A Spa For You 46 Caprara Law, PC 40 A.C. & M. Fire Equipment Co. 44 Capstone Practice Systems, Inc. 41 AAA Northeast 40 CareOne at Concord 43 Aaronap Cellars 5 Carl Belack Consulting 41 Acton Ace Hardware 46 Catherine Meeks Fine Art & Design 40 Acton Critter Sitters 45 Catherine Pfau Photography 40 Acton Ford, Inc. 40 Chelmsford Storage Solutions 46 Acton Funeral Home 14 ChiroPro Performance Center 43 Acton Handyman, LLC 16, 24 Clarity Advantage Corp. 41 Acton Lions Club 44 Clock Tower Law LLC 40 Acton Medical Associates, PC 43 CMB Virtual Services 44 Acton Monument Co., Inc. 43 Coatings2Go, LLC 44 Acton Nursing Service 16, 48 Coldwell Residential Brokerage 45 Acton Pharmacy, Inc. 43 Colonial Chevrolet of Acton 22 Acton Real Estate Company 17 Colonial Figure Skating Club 42 Acton Recreation Dept 14 Colonial Spirits 22 Acton Toyota of Littleton 40 ComForCare Home Care 43 Acton-Boxborough Regional Schools 42 Concord Flower Shop 43 Acton-Boxborough United Way 44 Concord Teacakes 23 ActonTV 17 Concord’s Colonial Inn 25 Allegro Software Development 46 Cookie Lady Treats 41 Alpha Business Group 41 Cornerstone Dental Group 5, 23 Alphen & Santos 40 Coughlin, Sheff & Associates, P.C. 25 American Cancer Society 45 Courtyard by Marriott Boston-Littleton 44 ARC Remodelling, LLC 41 Cracom Engineering Technologies, Inc. 42 Artisan Realty Group 45 Create! Sewing Studio 44 Atlantic Sea Grill & Fish Market 5 Creation Station 42 Avery and Associates 45 CruiseOne 46 Axe Brothers Tree Service 46 Cynosure 44 Barron Chiropractic & Wellness Center 41 Dana Snyder-Grant, LICSW 42 Bay State Elder Law, P.C. 9, 18 Dental POSSE, LLC 42 Benchmark Senior Living at Robbins Brook 18 Diane Jaques Insurance Agent 44 Betsy Purcell with Keller Williams Digital Federal Credit Union 41 Realty – Boston Northwest 19 Dunkin’ Donuts 41 Boch Honda West 41 EAV Inc. 40 Boston Bijoux Inc. 46 Eckel, Morgan & O’Connor 40 Boston Harbor Wealth Advisors 19 Ekaru, LLC 41 Boxboro Regency Hotel & Conference Center 7 Elizabeth West 44 Boxborough Insurance Agency 44 Elza B. Design, Inc 40 Brad M. Capland, CPA 40 Emerge Coaching for Success 41 Brandmarketing & Design 44 Emerson Dental, PC 42 Bridges by EPOCH 43 Emerson Hospital 26, 47 Bueno Y Sano 45 Enterprise Bank 26 Bullock’s Nursing Service 20, 24 Especially For Pets 45 Bullwinkel & Brooks, LLC 20 Evviva Cucina 46 EWhitney Events LLC 46 6 www.mwcoc.com

Centrally located off Route 495, minutes Weddings from the Mass Pike and Route 2, the Bar / Bat Mitzvahs Boxboro Regency is easily accessible to Corporate Meetings Boston, Worcester, Hartford, and Providence. Featuring an indoor pool, Trade Shows full-service Minuteman Grille restaurant, and over 30,000 sq. ft. of meeting and banquet space, the Boxboro Regency has everything you need. 242 Adams Place, Boxboro, MA 01719 | boxbororegency.com | 978-263-8701 Middlesex West Chamber of Commerce ~ 978-263-0010 7

TABLE OF CONTENTS Profiled businesses and display advertisers in bold EXIT Realty Partners – The Roser Realty Group 45 Lombardo Loam and Gravel Co., Inc. 44 Facilitations, Ltd. 45 Ludwig Agency 31 Ferns Country Store 43 M. Moreau & Sons Trucking,Inc. 46 Fish Nook Pet Center 45 MarcelineParent WELLBEING 32 Fitting Fitness In 42 Margo’s Hair Design & Margo’s Too 46 Footcare Focus 43 Mark Roth Electrical Services 42 FS Engineers, Inc. 42 Market Dynamics 44 Gallant Insurance Agency, Inc. 44 Mary Kay Cosmetics 46 GateHouse Media New England WICKED LOCAL 45 MassDevelopment 45 Gateway Vision PC 43 Maynard Education Foundation 42 Get in Shape for Women, Acton 14, 27 Maynard Storage Solutions 46 Gilbert E. Carley, D.M.D. 42 McDonald’s of Acton 3 Goddard School 41 Michael’s Shoe 41 Golden Girl Products, LLC 41 Middlesex Savings Bank 32 Gould Law Offices 40 Middlesex West Chamber of Commerce 33 Gould’s Distinctive Clothing 27 Midge Belcourt, CPA 40 Great Spaces, Inc. 28 Minute Man Arc 33 Haartz Corporation 44 Mortgage Network, Inc. 41 Habitat for Humanity North Central Mr. Trashman 34 Massachusetts 28 My Hometown Map 44 Harsip & Stuart, P.C. 11 Nashoba Valley Auto School LLC 42 Healthcare Insights 43 Nashoba Valley Ski Area 7 Home Is Best Home Healthcare LLC 43 National Aviation Academy 42 Household Goods, Inc. 45 Netscout Systems, Inc. 46 Huntington Learning Center 42 New England Center for Mental Health 43 Ideal Group Incorporated 41 New England Forever Aloe 43 Ideal Weight Loss of Central MA - Littleton 29 New Habitat Partners LLC 45 Idylwilde Farm, Inc. 43 North Acton Dental 42 Indian Hill Music 44 NorthBridge Insurance Agency, Inc. 3, 34 InMotion Cycling Studio, LLC 42 Northeast Association of Realtors 45 Insurance Center of New England, Inc. 2 Northeast Numismatics 11, 35 ISS, Inc. 29 Northern Bank 2, 35 Joseph G. Perry Plumbing & Heating 42 Not Your Average Joe’s 46 Joyce Contract Interiors, Inc. 40 Not Your Problem, Inc. 41 Juice Plus+ 43 Omni Properties, LLC 45 KAC’s Accounting Services 40 Open Door Education 42 Karen Guerin - Coldwell Banker Open Door Theater 44 Residential Brokerage 13, 30 Orangetheory Fitness Westford 42 Kimball Farm 43 P-S Berube Construction Design-Build 48 Kristin M. Cressman, CPA, MST 40 Palia Corporation dba IM Wireless (Verizon Wireless) 46 Law Office of Kathleen P. Ryder and Associates, P.C. 40 Passion Print & Design Services 45 Law Offices of Susan D. Stamps 30 Patricia Sutherland Connolly with Keller Williams Levine-Piro Law, PC 40 Realty – Boston Northwest 25, 36 Levitt Law Group 2 Patrick A. Gallagher, Contractor 42 Life Care Center of Acton 9 Payright Payroll Services, Inc. 45 Life Care Center of Nashoba Valley 43 Perennial Advisors Group 44 Littleton Liquors, LLC 31 Periwinkle Art and Glassworks 13, 36 Locke’s Pest Control 45 Pete’s Plumbing & Heating, Inc. 42 8 www.mwcoc.com

HOST YOUR NEXT EVENT AT 110 GRILL! WE OFFER BEAUTIFUL PRIVATE DINING ROOMS WITH SEATING FOR UP TO 50 GUESTS, CUSTOMIZABLE MENU OPTIONS AND ATTENTIVE SERVICE. Seasonal Menu, Monthly Specials, Private Dining Room, Patio Modern American Cuisine in a Trendy Casual Atmosphere WWW.110GRILL.COM LOCATIONS IN THE MIDDLESEX WEST AREA: CHELMSFORD: 978.256.2777 | BERLIN: 978.562.4610 **ADDITIONAL LOCATIONS IN MA & NH Philip and Cathleen Summers, Esquires Read about us on page 18 Clients can expect guidance in Elder Law, Estate Planning, Asset Protection, Probate, and Medicaid Planning - providing seniors and their families with peace of mind. www.BayStateElderLaw.com TWO CONVENIENT LOCATIONS: SUDBURY & ACTON 978-263-0006 111 Boston Post Road, Suite 101 179 Great Road, Suite 109 Sudbury, MA 01776 Acton, MA 01720 Middlesex West Chamber of Commerce ~ 978-263-0010 9

TABLE OF CONTENTS Profiled businesses and display advertisers in bold Ptfitstyle Ideal Weight Loss 43 INDEX TO DISPLAY ADVERTISERS Quick Lane, Tire and Auto Center 41 1 on 1 Self Indulgence Spa & Fitness 11 Rafanelli & Kittredge, PC 40 110 Grill 9 Rapscallion Table & Tap 46 Aaronap Cellars 5 Residence Inn by Marriott Concord - Boston 44 Acton Funeral Home 14 Resident Artist Studio 40 Acton Handyman Remodeling 24 RH Products Inc. 44 Acton Nursing Service 48 Richard Mandel, Esquire 40 Acton Recreation Dept 14 Roche Bros. Supermarket 43 Atlantic Sea Grill & Fish Market 5 Roudenbush Community Center 42 Bay State Elder Law 9 Scheier, Katin & Epstein, P.C. 40 Boxboro Regency Hotel & Conference Center 7 Sechrest & Bloom, LLC 40 Bullock’s Nursing Service 24 Servpro of Marlboro/Concord 42 Concord’s Colonial Inn 25 Simon Acupuncture and Nutrition 43 Cornerstone Dental Group 5 Spound Development Associates, LP 45 Coughlin, Sheff & Associates, P.C. 25 Sprint Nexgen Wireless LLC 46 Emerson Hospital 47 Star Custom Framers 11, 37 Get in Shape for Women, Acton 14 Stow Family Chiropractic 41 Harsip & Stuart, P.C. 11 Strawberry Hill Co. 44 Insurance Center of New England Inc. 2 Sunlight Photography 40 Karen Guerin ~ Coldwell Banker Residential Brokerage 13 TD Bank 37 Patricia Sutherland Connolly with Keller The Atrium at Drum Hill 38 Williams Realty – Boston Northwest 25 The Curry House 38 Levitt Law Group 2 The Discovery Museums 44 Life Care Center of Acton 9 The Homesteader 45 McDonald’s of Acton 3 The Parents Estate Planning Law Firm, P.C. 40 Nashoba Valley Ski Area 7 The Red Apple 45 NorthBridge Insurance Agency, Inc. 3 The Thoreau Club 42 Northeast Numismatics 11 The Three Trolls, Inc. 46 Northern Bank & Trust 2 The UPS Store #0286 46 P-S Berube Construction Design-Build 48 The Virginia Thurston Healing Garden Periwinkle Art and Glassworks 13 Cancer Support Center 43 Star Custom Framers 11 Theatre III 44 Workers Credit Union 24 Title Boxing Club Littleton 39 Tranquility Yoga 46 True West Brewery 46 Vacation with the Magic, LLC 46 Village European 41 Vinmark Group Inc. 41 Visiting Angels - Home Care Services 39 WatchRx 46 Wedgewood Pines Country Club 42 WestFit 42 Westford Community Access Television, Inc. 45 Westford Regency Health Club 42 Westford Regency Inn and Conference Center 44 Westford Xfinity Store - Comcast 46 Winning Content Strategy 44 Workers Credit Union 24 10 www.mwcoc.com

Read about us on page 15 We Buy Coins! Read about us on page 35 100 Main Street, Suite 330 Concord, MA 01742 Hours by appointment 800.449.2646 www.northeastcoin.com DIVORCE | MEDIATION | ARBITRATION | TRUSTS & ESTATES Barry S. Harsip, Esq. Sarah E. Stuart, Esq. Victoria C. Rothbaum, Esq. Annasophia M. Salvia, Esq. 289 Great Road, Suite 101, Acton, MA | 978-264-0250 | www.harsip-stuart.com Active Members of Your Community for Over 30 Years wweeffrraammeeaannddpprreesseerrvveemmeemmoorrieiess!!!! Read about us on page 37 VFVrFairesaitenstSndSdelyelleyElecExtcpixtopieonerntortDofDfFerFesairsgmaingmneeeserssr•s~•M~MMaMtairstirrso&ror&sPrsPoriornfinftAstAlsl•lSl•HSiHzaieznaesnds•d-•Sc-rScparpefatecfeitcaediladisolitsonstnsPinPirneTremeTmexitxsiietlseiesless•s••Q•OQuObuicbjiekcjeckTtcuTtBurBnorno-xae-xraesors•ou•FunFindnidneTeATimArimtret•e• BBrirningsgi1sna1ina7tthtGtihsiisrsiefsaafaadtadcaRcantdwntdi.wodSiwSotwSnAownAVww.VgsE,.tgsEMua$tuar$2Aacr20aucr•0usroSatsofotatnfofomnfowtmonfteSrnfaeaerhanameodnymdpeypp•erpus•ir9nu.src9cg.r7ochc7Co8mha8mtas-res.-4/eo4R6ofo6f1$u-1$4t-24e02011o511o7r55/rm52moorere. . 117 GreatfiRnde. Scutoswto, MmAp•iScttouwreSfhroapmpiinngg C&trg./aRlloeurtye 117/2 fine custom picture framing & gallery Middlesex West Chamber of Commerce ~ 978-263-0010 11

CATEGORY INDEX OF PROFILED BUSINESSES & DISPLAY ADVERTISERS Accounting / CPAs Health, Medical & Wellness Coughlin, Sheff & Associates, P.C. 25 Emerson Hospital 26, 47 Art / Framing / Photography Ideal Weight Loss of Central MA - Littleton 29 Periwinkle Art and Glassworks 13, 36 MarcelineParent WELLBEING 32 Star Custom Framers 11, 37 Hotel & Conference Center Attorneys / Legal Services Boxboro Regency Hotel & Conference Center 7 Bay State Elder Law 9, 18 Concord’s Colonial Inn 25 Bullwinkel & Brooks, LLC 20 Insurance / Financial Advisors Harsip & Stuart, P.C. 11 Boston Harbor Wealth Advisors 19 Law Offices of Susan D. Stamps 30 Insurance Center of New England Inc. 2 Levitt Law Group 2 Ludwig Agency 31 Automotive NorthBridge Insurance Agency, Inc. 3, 34 Colonial Chevrolet of Acton 22 Kitchen & Bath Design, Cabinets Bakery Great Spaces, Inc. 28 Concord Teacakes 23 Non-Profits Banks / Mortgages ActonTV 17 Cambridge Savings Bank 21 Habitat for Humanity North Central Massachusetts 28 Enterprise Bank 26 Middlesex West Chamber of Commerce 33 Middlesex Savings Bank 32 Minute Man Arc 33 Northern Bank 2, 35 Printing / Promotional Items TD Bank 37 ISS, Inc. 29 Workers Credit Union 24 Real Estate & Development Clothing and Shoe Stores Acton Real Estate Company 17 Gould’s Distinctive Clothing 27 Betsy Purcell with Keller Williams Realty – Coin Dealer Boston Northwest 19 Northeast Numismatics 11, 35 Karen Guerin - Coldwell Banker Contractors / Plumbing / Electric Residential Brokerage 13, 30 Acton Handyman Remodeling 16, 24 Patricia Sutherland Connolly with Keller P-S Berube Construction Design-Build 48 Williams Realty – Boston Northwest 25, 36 Dental Restaurants / Catering /Events Cornerstone Dental Group 5, 23 110 Grill 9 Fitness / Sports / Recreation Atlantic Sea Grill & Fish Market 5 Acton Recreation Dept 14 Burtons Grill & Bar 21 Get in Shape for Women, Acton 14, 27 McDonald’s of Acton 3 Nashoba Valley Ski Area 7 The Curry House 38 Title Boxing Club Littleton 39 Salon & Spas / Hair, Nails, Skin Funeral Services 1 on 1 Self Indulgence Spa & Fitness 11, 15 Acton Funeral Home 14 Waste Management Health & Elder Care Mr. Trashman 34 24 Hours Care 15 Wine & Spirits Acton Nursing Service 16, 48 Aaronap Cellars 5 Benchmark Senior Living at Robbins Brook 18 Colonial Spirits 22 Bullock’s Nursing Service 20, 24 Littleton Liquors, LLC 31 Life Care Center of Acton 9 The Atrium at Drum Hill 38 Visiting Angels - Home Care Services 39 12 www.mwcoc.com

626 Main Street GUIDING YOU HOME Read about us on page 22 Bolton, MA 01740 TEL: 774.364.0952 www.karenguerinrealtor.com FAX: 978.779.5154 [email protected] real. local. art. Periwinkle Art & Glassworks Read about us on page 36 586 Massachusetts Avenue West Acton Village, MA 01720 508.341.4740 www.perwinkleglassworks.com [email protected] Stained and Fused Glass Art • Shop & Gallery Custom Work • Classes & Workshops Kid’s Birthday Parties • Girl’s Nights Out HELPING YOU MAKE CHOICES. CONCENTRATING PROVIDING YOU WITH RESULTS. IN FAMILY LAW COLLABORATIVE PRACTICE MEDIATION I LITIGATION 4 Meeting House Road, Suite 3 Chelmsford, MA 01824 Tel: 978-458-5550 I Fax: 978-256-7600 WWW.LEVITTLAWGROUP.COM The 2017-2019 Middlesex West Chamber of Commerce Directory was published as a service to the Middlesex West Chamber by Chamber Profiles (a division of Indie Owned, LLC), a print and online, profile-based publication. This Directory was mailed, free of charge, to every home in Acton, Boxboro, Concord, Carlisle, Littleton, Maynard, Stow, and Westford in March 2017. It can also be found at MWCOC.com. All content submitted for publication is deemed advertising. Indie Owned, LLC is not responsible for errors in advertising beyond the original cost of participation. Indie Owned reserves the right to edit and/or reject any print or online content. Indie Owned, LLC is not responsible for the validity of claims or content made by advertisers. All rights reserved. Reproduction of material appearing in any Indie Owned or Chamber Profiles publication is prohibited without the written permission of the publishers. Indie Owned, LLC d/b/a Chamber Profiles [email protected] 258 Harvard StreeTt h#3e3A3cBtroonokMlinceD, MonAa0ld24s4is6independeCnhtalymberProfiles.com 617.264.0594 owned and operated by a local famCiolyp.yright ©2017 by Indie Owned, LLC Middlesex West Chamber of Commerce ~ 978-263-0010 13

Read about us on page 27 Our unique combination is scientifically proven to work. Weight Training Cardio Nutrition Accountability Theresa Watts, Acton Client After Before Age 52, R.N. 133 Great Road Acton, MA 01720 Lost 75 lbs. and 24.4% body fat 978-929-9449 14 www.mwcoc.com

1 on 1 Self Indulgence Spa See our ad on page 11 457 Great Road Acton, MA 01720 978-266-1800 [email protected] www.1on1si.com HOURS OF OPERATION: We are open Tuesday through Saturday. Sunday and Monday - Closed (Appointments available Sunday and Monday for groups, parties, and multiple treatments with advance booking.) Award-winning, beautiful Day Spa and Sanctuary European Soft Dry Float. A must-try for relaxation! that has been showcased on Chronicle celebrates Explore our Sanctuary for yoga and wellness classes, over 12 years of passion for skin care, relaxation, and both group and private are available. therapeutic wellness... all offered under one roof! Have a special occasion or just want to relax with Owners Cindy McCullough and D. Schweppe first friends? Then let us help you plan your event with a opened 1 on 1 Self Indulgence Spa in October 2004. personalized Spa Party, with something for everyone! They are proud to welcome you to their beautiful Gift cards are available. new spa in a renovated 1774 house, where they 1 on 1 Self Indulgence Spa ~ “Once you find us... combine together charm, modern technology, you’ll never want to leave!” and pure indulgence to create a soothing and rejuvenating environment for a truly memorable 10% OFF (1) Spa Service and relaxing spa experience. Our world-class spa offers a menu of indulgent and Excludes Packages & Gift Cards therapeutic treatments. Enjoy a wide variety of services Cannot be used with specials. Limit (1) pp. including facials, bodywork, body wraps, nails, waxing, hydro therapy soak, and of course our soothing Expires:07/2018 Present Code:MWCoCG17 first 24 Hours Care 73 Lexington Steet, Suite #LL5 Newton, MA 02466 617-792-0500 617-244-4676 [email protected] www.24hourscare.com 24 Hours Care is dedicated to providing • Opportunity to interview and interact with your professional care and comfort to people who need HHA or RN before allowing them into your home it the most. Our mission is to provide medical and non-medical care with compassion to people with • Background (CORI) and driving record checks for special needs and seniors who need assistance. all HHAs and RNs 24 Hours Care Advantage . . . • Licensed and Insured • Locally owned and operated • Medical and non-medical assistance Contact us today if you or a family member is in • Great flexibility - a couple hours per week for need of a caregiver. chores and check-ins to 24-hour-a-day care • Highly experienced and trained Home Health “When there was an emergency, Collins put Aides and Registered Nurses everything in his life on hold to help us… There • Special care for patients suffering from chronic really was not a second, a minute, a day, a week, diseases or a month when Collins and his staff did not put our family first.” Middlesex West Chamber of Commerce ~ 978-263-0010 15

See our ad on page 24 Acton Handyman, LLC 7 Post Office Square Box 2812 Acton, MA 01720 978-844-6359 [email protected] www.actonhandyman.com HOURS OF OPERATION: Mon - Fri 8:00 am - 7:00 pm Sat 9:00 am - 5:00 pm Sun 1:00 pm - 5:00 pm Additional hours by appointment. The Acton Handyman is owned by Kevin and sincere, competent, and reliable. Once clients know Patty Connolly. Kevin is a highly skilled carpenter, and trust Kevin through handyman projects, many contractor, builder, and tinkerer. He started in the invite him back to remodel kitchens and bathrooms building business in the 1980s. Kevin became a or to complete the renovation they have been “hometown handyman” serving neighborhoods postponing. in Westchester County in 2000 when the property Kevin’s goals are to establish solid relationships investment management company that Patty with his clients and to deliver quality workmanship worked for moved their family to New York. In 2012, within the expected timeframe and at a reasonable the Connolly family came back to Massachusetts, price. The Acton Handyman guarantees complete and to Patty’s childhood hometown of Acton to satisfaction. provide hospice care for Kevin’s mother and to be nearby Patty’s parents. Find out what The Acton Handyman can do The statistic we are most proud of is that over for you by calling (978) 844-6359 for a free in- the past 30 years, two-thirds of Kevin’s clients are home consultation, and by visiting us at www. repeat customers. Kevin earns that loyalty by being actonhandyman.com and on Facebook. Acton Nursing Service 30 Sudbury Road 2 North Acton, MA 01720 978-929-6650 www.actonnursingservices.com HOURS OF OPERATION: Mon - Fri 8:00 am - 5:00 pm Sat, Sun Closed See our ad on page 48 An On-call Nurse is available for referrals and current patients after hours and on weekends and holidays. The Acton Nursing Service (ANS), founded in 1923, Medicaid Certified Home Care Agency. Skilled is dedicated to fostering individual and community services are covered by insurance such as Medicare, health in the Town of Acton and surrounding areas. Medicaid, and most major insurance carriers. Acton ANS provides certified home care to residents of Nursing Services is proud to be the recipient of Acton and the neighboring towns of Boxborough, the HomeCare Elite Award for six out of the last Carlisle, Concord, Littleton, and Stow. ANS provides ten years! Winners are ranked by an analysis of personal, consistent home care services under the publicly available performance measures in quality direction of a physician. ANS provides coordination outcomes, best practice, patient experience, and of home care for patients. ANS assures services quality improvement and consistency. ANS also are delivered by highly qualified Nurses, Physical, provides Public Health Services for the Town Occupational, and Speech Therapists, Medical Social of Acton. Health Promotion Services for Acton Services, and Certified Home Health Aides who are Residents include Blood Pressure, Podiatry and current in their practice, community-oriented, and Seasonal Flu Clinics, Immunizations, Wellness Visits, proactive. Acton Nursing Services is a Medicare/ and Health Discussions. 16 www.mwcoc.com

Acton Real Estate Company 525 Massachusetts Avenue Acton, MA 01720 978-263-1166 www.acton-realestate.com HOURS OF OPERATION: Mon - Fri 9:00 am - 5:00 pm Sat 9:00 am - 4:00 pm Sun 10:00 am - 1:00 pm Acton Real Estate Company is a locally The company is a longtime member owned and managed, full-service real of the Boston area Realty Guild and estate firm. Our agents are experienced affiliated with the Leading Real Estate with unmatched knowledge of the Companies of the World®, connecting communities they serve, making them our buyers and sellers with opportunities among the top producers in the area. throughout the region, across the They are supported by a professional staff country, and around the globe. of marketing and sales professionals, along with the latest technology. ActonTV 16A Craig Road Acton, MA 01720 978-263-6033 www.actontv.org HOURS OF OPERATION: Mon, Tue, Thur 9:00 am - 9:00 pm Wed, Fri 9:00 am - 5:00 pm Sat 9:00 am - 2:00 pm Sun Closed ActonTV is your local access TV Studio and social media. We offer free tours of our and Media Center. Our Mission is to create studio and encourage everyone to come and community through media by providing check out one of Acton’s hidden gems! For the technology, facilities, and expertise to more information about ActonTV, please visit encourage free speech and inspire creative our website at www.actontv.org, where you expression. We are a non-profit 501(c)(3) can learn more about what we do, watch our membership organization that provides programs On Demand, or sign up for one of you with the video and audio equipment as our media classes. Become a member today well as education to help you produce your and take advantage of all that ActonTV has own videos and distribute them through our to offer! You do not need to be a resident of cable channels and online via our website Acton to join in on the fun. Middlesex West Chamber of Commerce ~ 978-263-0010 17

Bay State Elder Law, P.C. Two convenient locations in Acton and Sudbury 978-263-0006 www.baystateelderlaw.com HOURS OF OPERATION: Mon - Fri By Appointment Sat, Sun Closed See our ad on page 9 Bay State Elder Law is a widely recognized leader Bay State Elder Law. in Medicaid, estate planning, asset preservation, Learn more at www.BayStateElderLaw.com or probate, and all other issues pertaining to elder call us at 978-263-0006. law. Founded by a Nurse Attorney, Bay State Elder Law has over 20 years experience and has been the Acton Office trusted source for expert legal advice that families 179 Great Road, Suite 109 need to maintain their financial security and protect Acton, MA 01720 their wealth for future generations. Tel. 978-263-0006 Whether you have just placed a loved one in a nursing home and don’t know where to turn, or you Sudbury Office want to plan ahead for your own future security, you 111 Boston Post Road, Suite 101 need a trusted expert. Start the conversation today Sudbury, MA 01776 and learn about your options from the attorneys at Tel. 978-579-3030 Benchmark Senior Living at Robbins Brook 10 Devon Drive Acton, MA 01720 978-264-4666 www.benchmarkatrobbinsbrook.com What Makes Us Unique? * Dedicated associates working with the same resident, ensuring familiarity * Programs to help our residents live well: mind, body, and soul * Award-winning dining * Award-winning Arthritis Exercise Program * Trips, entertainment, and the opportunity to stay active and involved * Proud to be a Benchmark Senior Living community named a Top 100 Place to Work by The Boston Globe year after year We creatively improve the experience of the aging by offering a lifestyle option that fits you and your loved one’s needs. 18 www.mwcoc.com

Betsy Purcell with Keller Williams Realty – Boston Northwest 200 Baker Avenue, Suite 205 Concord, MA 01742 978-758-7414 [email protected] www.betsypurcell.com Buying or selling a home is more than just a friendly approach, strong work ethic, and desire for transaction—it’s a life-changing experience. Betsy a positive outcome, buyers and sellers can trust that understands this. With 11 years of experience they’re being represented by the best. working with buyers and sellers in Acton and the Betsy has been a resident of Acton since 1997, surrounding towns, Betsy provides exceptional where she’s raised her family and continues to personalized service. Taking great pride in the participate community activities as an active relationships forged over these years, she works member of the Rotary Club of Acton-Boxborough, relentlessly on the client’s behalf to help them the League of Women Voters, and as a Corporator achieve their real estate goals. Board member for Emerson Hospital. Today’s buyers and sellers need a trusted Contact Betsy Purcell: [email protected], resource who can guide them through the complex 978-758-7414 world of real estate. By providing extensive knowledge and commitment along with her energy, Keller Williams Realty Boston NW, 200 Baker Ave., Suite 205,Concord, MA 01742 Boston Harbor Wealth Advisors 289 Great Road, Suite #304 Acton, MA 01720 978-767-8667 [email protected] www.bostonharborwealth.com Your financial goals, aspirations, and investment SERVICES needs are just that—yours. And your financial plan • Retirement Planning should reflect that. So rather than ask you to settle • Estate & Charitable Planning for an off-the-shelf investment program, our team • Investment Management is here to provide you with personalized financial • Cash Management & Borrowing planning based on your goals, your timeframe, and • Risk Management your particular tolerance for risk. Backed by the resources of Raymond James, PLANNING FOR LIFE one of the leading independent financial services • Transition to Retirement companies in the United States, our advisors can • Death of a Loved One provide you with just the right combination of • Divorce financial services, support, and guidance that makes • Career Change the most sense for you. And should something • Selling a Business change, we’ll also be there to help keep you on track • Investing in Education in the pursuit of your personal financial goals. Middlesex West Chamber of Commerce ~ 978-263-0010 19

See our ad on page 24 Bullock’s Nursing Service 747 Main Street, Suite 316 Concord, MA 01742 978-369-0463 [email protected] bullocksnursingservice.com HOURS OF OPERATION: Open 24 x 7 Bullock’s Nursing Service has been offering light housekeeping, companionship, personal home healthcare to the local community since care, and medical services. All clients receive 1978. We are family-owned and managed as a free initial assessment by a RN. Our RNs are well as RN-owned and managed. We have available 24 x 7 to handle any medical issue or companions, CNAs, LPNs, and RNs on staff to other concerns. Our number one priority is the handle both personal care and skilled nursing satisfaction of our clients and their families. services. We offer flexible scheduling starting We have many excellent references available from four hours per day up to 24 x 7 care. upon request. We offer transportation, meal preparation, Bullwinkel & Brooks, LLC 2 Lan Drive, Suite 120 Westford, MA 01886 978-320-3400 [email protected] www.bullwinkelbrooks.com HOURS OF OPERATION: Mon - Fri 9:00 am - 5:00 pm Sat, Sun Closed Bullwinkel & Brooks, LLC focuses needs. Our support staff includes its practice in the areas of family former court employees and certified law, estate planning, probate Paralegals, all of whom add valuable administration, real estate law, knowledge and experience to our business law, elder law, and team. We assist you through every litigation. With over 50 years of step of the process and work with you combined experience, the attorneys at to achieve an efficient and just result. Bullwinkel & Brooks, LLC are experts who work hard to meet your legal 20 www.mwcoc.com

Burtons Grill & Bar One Cornerstone Square Westford, MA 01886 978-692-1220 www.burtonsgrill.com HOURS OF OPERATION: Mon - Thur 11:30 am - 10:00 pm Fri, Sat 11:30 am - 11:00 pm Sun 11:30 am - 9:00 pm Since opening our doors in 2005, Burtons Burtons Grill & Bar offers a vast selection Grill & Bar has had a simple goal in a complex of menu offerings which appeal to any and and highly competitive business: “delight every type of diner including Paleo, Gluten every guest”. Consistency, integrity, and Free, Vegetarian and our ever-changing, passion guide us. Whether it’s the traditional innovative Whim menu. The Whim is our way fare that our patrons love, or our chef-driven, to demonstrate our exceptional cocktails and innovative local preparations, we promise to culinary trends of the season brought to your keep guests coming back for more. table by way of locally sourced ingredients. With our legendary from-scratch kitchen Burtons Grill & Bar of Westford features and bar, we are able to customize our menu an intimate, semi-private dining area idea for offerings to meet specific dietary requests to any occasion, whether it’s a birthday party, fit your lifestyle. business function, or other special event. Cambridge Savings Bank 202 Sudbury Road Concord, MA 01742 617-441-7115 www.cambridgesavings.com HOURS OF OPERATION: Mon - Wed 9:00 am - 4:00 pm Thur 9:00 am - 6:00 pm Fri 9:00 am - 5:00 pm Sat 9:00 am - 1:00 pm Sun Closed Cambridge Savings Bank is a full- full line of individual and business service financial institution with banking services and has branches approximately $3.4 billion in assets located in Cambridge, Arlington, that is committed to improving the Bedford, Belmont, Burlington, quality of life in the communities it Concord, Lexington, Newton, and serves. One of the oldest and largest Watertown. For more information community banks in Massachusetts, about Cambridge Savings Bank, Cambridge Savings Bank offers a please visit cambridgesavings.com. Middlesex West Chamber of Commerce ~ 978-263-0010 21

Karen Guerin – Coldwell Banker Residential Brokerage 626 Main Street Bolton, MA 01740 978-779-2247 FAX:978.779.5154 [email protected] www.karenguerinrealtor.com See our ad on page 13 Bringing extensive knowledge and purchasing another, but likes working with the experience in the Real Estate market, Karen first-time buyers as well! While the process offers her clients an outstanding level of service. can be stressful, Karen focuses on making Honesty, integrity, and patience are the most the transition as smooth and stress-free as regarded characteristics that have helped Karen possible by getting to know her clients and build a business of repeat clients and referrals. meeting their needs. With a background in Property Management, When Karen is not selling Real Estate, Karen brings connections not commonly found she enjoys spending time with her husband, in real estate sales, working with only the best Michael, and daughter, Michelle. She also home inspectors, project managers, and lenders enjoys gardening, yoga, socializing, and in the business. She has been working in Real Fundraising with the Women’s Business Estate since 1993 and has been a Licensed Networking group in Harvard, MA. Salesperson since 1999. Contact Karen at 774-364-0952 and she can She specializes in helping people making help you with your next move! a local move, selling their current home and Colonial Chevrolet of Acton 171 Great Road Acton, MA 01720 978-263-1000 www.buycolonialchevrolet.com HOURS OF OPERATION: Fri 8:00 am - 7:00 pm Sat 9:00 am - 5:00 pm Sun 12:00 pm - 4:00 pm Mon - Thur 8:00 am - 8:00 pm Best Price, Service, Selection and Best Reputation! “Yes, you can have it all!” At Colonial! At Colonial Chevrolet, we go the extra mile to ensure that you never drive home unhappy. Whether you’re visiting us for a new vehicle, maintenance on your existing vehicle, or for repairs at our body shop, Colonial Chevy’s team makes you our number one priority. Choose from hundreds of new Chevrolet cars and trucks and a range of pre- owned vehicles. 22 www.mwcoc.com

Colonial Spirits 87 Great Road Acton, MA 01720 978-263-7775 www.ColonialSpirits.com HOURS OF OPERATION: Mon - Sat 9:00 am - 10:00 pm Sun 10:00 am - 6:00 pm Colonial Spirits of Acton has been a locally Our main goal at Colonial Spirits is to make our owned and operated business for over 50 years. customers happy with the service we provide and Throughout that time the store has continually the selection we carry. We want each and every grown and expanded to meet the needs of a customer to leave not only pleased with their changing community. Colonial Spirits moved into purchase but relieved that there is still a store out the old movie theater at 87 Great Road in Acton, there that genuinely cares about and appreciates MA on March 31, 2003. The store now showcases the people who frequent the business. Colonial the largest selection of beer, wine, and liquor in Spirits can help you plan an event, find the perfect the area. Inside you will find over 16,000 bottles of wine for your dinner, or special order anything we wine, an extensive collection of beers and ales from don’t already carry. Please visit Colonial Spirits in over 40 countries, and all the ingredients of your Acton to find the best deals around and much more. favorite drinks and cocktails. Concord Teacakes 59 Commonwealth Avenue Concord, MA 01742 978-369-7644 [email protected] www.concordteacakes.com HOURS OF OPERATION: Mon - Fri 6:00 am - 5:00 pm Sat 7:00 am - 5:00 pm Sun 8:00 am - 1:00 pm Concord Teacakes is located in the charming cookies for all occasions. Our cakes are made village of West Concord, easy to reach by public with the freshest ingredients and individually transit or by car. Stop in to our café for a coffee, designed for each customer. Our cake decorators tea, or latte and join us for a quick breakfast of are true artists, combining delicious flavors with homemade muffins, croissants, and breakfast beautiful color and outstanding design. sandwiches. Our delicious sandwiches, salads, We can give your wedding, shower, bar/ and entrees are customer favorites for lunch bat mitzvah or any other event a sweet and and dinner and, of course, our desserts are memorable highlight. irresistible! We also offer a full catering menu. If you are looking for something out of the Concord Teacakes specializes in making ordinary for both visual “wow” and fantastic delectable, show-stopping cakes, cupcakes, and taste, you’ll find it at Concord Teacakes. Middlesex West Chamber of Commerce ~ 978-263-0010 23

Read about us on page 16 KKeevviinn F F.. C Coonnnnoollllyy Read about us on page 20 HHoommee I m Impprroovveemmeennt t C Coonnttrraaccttoorr Kevin F. ConnollyHHLILCiIcCi c e M e nFMHnAsrAsaeT o eRdT v Rmdh e e &h e g & e g .a \"e I . #n I H #n BA1 s A1sou7eu7(c3rn(ac39re0t9ee0udt87od8y7ot33i-8nf8nDu) ) o l H H 8 \"&8 a4 L a4 Wni4n4so-td-d 6 rt6yory3y3m m R-55Fea9ar9menneo L dHLeLLolCmiCneg SSaHattikosiwksemwfefyvwyHevwiiin winL [email protected]@a. e a acpM cacnlccrtlciAsottoietoeoe v onn Rdnnnenth e mth hs&hsga a a e f .an fI non n o#nnddrtd1srd y yCu 7yo myom3mrovmve0aneaead8antrnrnHr3n . a. 3c .a3c.ccco5vo5oteo mo m y m y maree Baaerrassutiful & Worry-Free Home From \"Honey-Do\" List to Remodeling The A(c9t7o8n) H 8a4n4-d6y3m5a9n LLC4BFH.u6rla2olo5v”mcexk’1 s a.\"N8 7H u B5r”ose-innFagoeuuSrytecir-ofvDluiocroel - \"&C o L nWicsootrd rtDoriyr e R-cFteorrmyeSAeaod t dHiesolfmiyniegng clieKHnoetmsvHe Lf i IIoCimnc e rpM n r F Asooe v .Rvde e me C&gre . I on #n 3t1s n Cu753ro ne 0 nyd8toer3aalcltroysr OurKCeavreinPr oFv.i d Ceos YnonuowliltyhHome L Iimcepnrsoevde m &e Innts [email protected]. c.Aco(oc9mtm7o8n) H 8a4n4-d6y3m5 The PeaHceICo MfAMT Rhienge.d # A1Y7oc3u0t8oD3ne s Heravne dyman [email protected] acclctitoeonnnthhsa a fnondrdy yommvaeanrn For over 30 years, Bullock’s Nursing Service has been providing (978) 844-6359ccreloitmeirneptmsanweiniottnhfsachcoiipmlitfpioearss.tshWioenehaootfemf,epSer,rfoahlefoextssiipkbssiiloteeafn,lya,vafnlifinuonnurrdsrg@iasnib ng lacgehlcccoaiamtrreeeoenpa&nnlatdnhss at fhonat rd yomvTeaorlne a 3r.ncc5aaolbl o u ymustaeotua9r sr7ers8vic-e3s,6an9d-h0ow4w6e3can help, adreeminendtiviai,dAualzlihzeeidmteor’ms aenedt yPoaurrkisnpseowcnif’siwcdnisweeeads.sea..SWcpethcoeitahnliezrhinitga’sijnnusdt yman.com for three hours a day or around the clock, we’re here for you. 747 Main St., Suite 316 • Concord, MA 01742 • bullocksnursingservice.com Fully bonded and insured. Licensed by the state of Massachusetts. I’M ON THE FAST TRACK And I bank at the speed of life. BUSINESS ACCELERATOR • Small Business loans under $75,000 PROGRAM • Fast approval within 48 hours • Apply now by calling 978-353-7178 workerscu.com 800.221.4020 24 www.mwcoc.com

Proud Member Historic Hotels of America Coughlin, Sheff & Associates, P.C. Certified Public Accountants • Individual & Business Tax Services • Tax Planning & Preparation • Estate and Trust Tax Preparation • Financial and Accounting Services • IRS Representation 978-263-3777 125 Nagog Park, Acton, MA 01720 www.csa-pc.com REALTOR® Read about us on page 30 978-844-6397 [email protected] www.SutherlandRealtyGroup.com 200 Baker Avenue | Suite 205 Concord | MA | 01742 Middlesex West Chamber of Commerce ~ 978-263-0010 25

Cornerstone Dental Group 5 Cornerstone Square, Suite 202 Westford, MA 01886 978-692-6012 SmileWestford.com HOURS OF OPERATION: Mon - Thur 8:00 am - 5:00 pm Fri - Sun Closed See our ad on page 5 Cornerstone Dental Group is a leading dental care each and every individual, and are happy to answer any practice in Westford, Massachusetts. At Cornerstone questions that you may have. Dental Group, we are committed to helping you achieve With comfort and convenience as the hallmarks the dental health you deserve, and a smile you’re of Cornerstone Dental Group’s office operations, all proud of. Through our state-of-the-art technology and information regarding hours, location, appointment experienced staff, we provide you with exceptional care scheduling, insurance acceptance, and billing is offered that helps you achieve outstanding oral health. on our website at www.SmileWestford.com. You can Our dental services include preventive checkups also contact us at (978) 692-6012. and cleanings, root canals, extractions, fillings, Our office is located in the beautiful Cornerstone crowns, implant restorations, teeth whitening, dental Plaza in Westford, MA. There is ample parking in the implants, dentures, TMJ treatment, cosmetic dentistry, rear of the medical building at the main entrance. Call and Invisalign aligners. Whether you’re an adult, today to schedule an appointment! adolescent, or child, we provide care that is tailored to Emerson Hospital Route 110, 133 Littleton Road Westford, MA 01886 978-589-6999 www.emersonhospital.org See our ad on page 47 The Emerson Hospital Health Center in Medical services in Westford are Westford brings a wide range of top-quality complemented by the Polo Emergency health services to the community. When you Department, the Clough Birthing Center, or your family need a convenient place for a the Mass General Cancer Center at Emerson primary care physician, pediatrician, specialist, Hospital-Bethke, the Clough Surgical Center, or exceptional diagnostic care and the most and the Yeatts Radiology Center—all based advanced imaging equipment, look no further. at Emerson Hospital in Concord. With more than 30 physicians in 15 different For more information on services in practices, Emerson gives you all the services Westford, Concord, Groton, or Sudbury, please you need to keep your whole family healthy visit emersonhospital.org. and well. Emerson Hospital, Concord: 978-369-1400 26 www.mwcoc.com

Enterprise Bank 237 Littleton Road 340 Great Road Westford, MA Acton, MA 01720 978-656-5557 978-656-5707 www.EnterpriseBanking.com DRIVE-UP HOURS: LOBBY HOURS Mon-Wed 8:00 am - 4:00 pm Mon-Wed 9:00 am - 4:00 pm Thurs 8:00 am - 6:00 pm Thurs 9:00 am - 6:00 pm Fri 8:00 am - 5:00 pm Fri 9:00 am -5:00 pm Sat 8:30am - 12:30 pm Sat 8:30 am - 12:30 pm Enterprise Bank was founded through the our customers we have a profound impact on the entrepreneurial vision of George L. Duncan in 1989. quality of life and the economic well-being of the We are headquartered in Lowell, Massachusetts, with communities in our area. At Enterprise Bank, building branch locations throughout the Merrimack Valley lasting and positive relationships with our customers and North Central regions of Massachusetts, and is much more important than conducting transactions. Southern New Hampshire. Our service is consistently measured by the success For over 25 years, Enterprise Bank has been of the individuals, businesses, and communities we supporting the financial needs of businesses, enthusiastically serve. Member FDIC. professionals, individuals, and communities. Our Call or visit us today: exceptional team of bankers offers a unique blend Carla Stover, Branch Relationship Manager of personal service, professional expertise, and a full Acton | 340 Great Road | 978-656-5707 suite of solutions to meet the unique business and Wendy Baker, Branch Relationship Manager personal needs of our customers. Westford | 237 Littleton Road | 978-656-5557 As a leading independent, community-focused bank, we recognize that by working together with Get in Shape for Women, Acton See our ad on page 14 133 Great Road Acton, MA 01720 978-929-9449 www.getinshapeforwomen.com HOURS OF OPERATION: Mon, Tue, Thur 5:30 am - 8:30 pm Wed 6:00 am - 8:30 pm Fri 6:00 am - 8:00 pm Sat 6:00 am - 12:00 pm Sun Closed I was a client of Get in Shape for Women in Acton consultations and measurements. Our trainers are all before purchasing the studio in 2013. It was the first certified personal trainers and work with each client program that combined my need to both lose weight in a small-group setting (up to four women at time) and exercise. Since becoming the owner (and even to motivate and make sure that you are working out when I was a client), I have seen countless women safely and effectively. In 2013, we were recognized as experience the transformation that Get in Shape for the #1 Get in Shape for Women studio nationwide. Women brings. I encourage anyone to stop by and experience There are four main components to our how we help women achieve their goals every day! program—nutrition, accountability, strength training, We have an incredible community of supportive and and cardio—that work together for total body inspiring women whose goals range from losing transformation. We work with each client individually weight, to gaining strength, to finding more energy. on their nutrition or weight loss goals with regular Middlesex West Chamber of Commerce ~ 978-263-0010 27

Gould’s Distinctive Clothing 260 Great Road Acton, MA 01720 978-263-0374 www.gouldsclothing.com HOURS OF OPERATION: Mon, Fri 9:30 am - 6:00 pm Tue - Thur 9:30 am - 7:00 pm Sat 9:30 am - 5:30 pm Sun 12:00 pm - 5:00 pm Gould’s Distinctive Clothing is a family owned operated by George’s sons Marvin, Lester, and specialty clothing store featuring high-quality, Spencer. George, 98, still comes to work nearly brand-name men’s and women’s merchandise every morning, but definitely not on horseback. and committed to a level of customer service that Gould’s offers a full-service tailor shop with a department stores or larger chain stores are unable full-time master tailor and seamstress. We offer to deliver. tailoring service on outside work as well as free The Gould’s stores began with a small outlet tailoring for anything purchased here. Gould’s does store in Clinton, Mass. in 1934 by brothers David free gift wrapping all year, and we offer tuxedo and George Gould. They would sometimes come sales and rentals. Gould’s has an experienced and to work on horseback! Currently, we are located professional sales staff who make shopping here a on Rte. 2A in Acton, Mass., in a big and beautiful pleasurable and productive experience. Shop local 10,000-square-foot store. Gould’s is owned and and see how rewarding and convenient it can be. Great Spaces, Inc. 25B Stow Road Boxborough, MA 01719 978-760-0729 [email protected] www.greatspacesinc.com HOURS OF OPERATION: Mon - Fri 9:00 am - 5:00 pm Sat, Sun Closed Evening hours by appointment. Great Spaces, Inc. is a design, sales, and remodel to recommending and coordinating sub-contractors, we are consulting company specializing in kitchens, baths, there from the initial drawings to the final walk-through. mudrooms, and closets. Let us show you how our custom Home Potential Design Service: Selling your level of service, design skill, and quality products are the home? Let us show buyers your home’s full potential keys to turn your space into a Great Space! without you having to renovate. We provide a storyboard Design: Our unique combination of form and function of design possibilities, with 3-D color images of updated provide you with a well-designed and expertly executed layouts and style alternatives, custom tailored to the space. We work with spaces big and small, modern or specific space, including coordinating product samples, traditional, incorporating inspired functionality. to help buyers see your house as their new home. Quality Products: We offer cabinetry, floor and wall tile, counter tops, plumbing and hardware, and can Owner/Designer Dawn Willis, AKBD, is a well-respected work within any budget or project schedule. designer and project manager with over 20 years Project Management: From providing a scope of work experience in the building and construction industry. 28 www.mwcoc.com

Habitat for Humanity North Central Massachusetts 138 Great Road, 2nd Floor Acton, MA 01720 978-348-2749 [email protected] ncmhabitat.org HOURS OF OPERATION: Mon - Fri 9:00 am - 5:00 pm Sat, Sun Closed Construction Volunteer hours are 8:30 am - 4:00 pm Wednesday through Saturday. Our ReStore is open 10:00 am - 5:00 pm Wednesday through Saturday. Habitat for Humanity North Central Ashburnham, Ashby, Ayer, Berlin, Bolton, Massachusetts is an independent, Boxborough, Clinton, Fitchburg, Gardner, local affiliate of Habitat for Humanity Groton, Harvard, Hudson, Lancaster, International. We are a non-profit housing Littleton, Lunenburg, Leominster, Maynard, ministry that seeks to eliminate poverty Pepperell, Princeton, Shirley, Sterling, housing and homelessness right here in Stow, Townsend, and Westminster. Massachusetts through both new home- Habitat NCM also operates the building and critical home repair. Leominster ReStore, which raises funds We serve 25 towns and cities in north through the sale of discounted or recycled central Massachusetts, including Acton, materials and furniture. Ideal Weight Loss of Central MA - Littleton 671 Great Road, Unit 4 Littleton, MA 01460 978-486-1012 [email protected] www.idealweightlosscentralmass.com HOURS OF OPERATION: Tue, Thur 10:00 am - 7:00 pm Wed, Fri 8:00 am - 4:00 pm Sat 8:00 am - 12:00 pm Mon, Sun Closed We are the only independently owned We are proud to offer flexible hours and operated Ideal Protein Center six days a week to Littleton and the located in Littleton, MA. Our location is surrounding towns including Groton, conveniently located at 671 Great Road! Westford, Ayer, Acton, Chelmsford, We offer one-on-one coaching with our Pepperell, Harvard, and Boxboro. registered nurse/health director and our Stop by and check us out—no nutritionist, as well as our exceptional appointment is needed! coaches. All of our employees have completed the Ideal Protein Protocol and are here to help you succeed! Middlesex West Chamber of Commerce ~ 978-263-0010 29

ISS, Inc. 2 Shaker Road, D103 Shirley, MA 01464 978-425-3600 www.issondemand.com HOURS OF OPERATION: Mon - Fri 9:00 am - 5:00 pm Sat, Sun Closed Special accommodations can be made for rush orders, weekend deliveries, and early or late pickup requests. Make your business look its best with printing value. When you choose to work with us, you services from ISS. are gaining a partner; we will work with you to Your printed material, from business cards to understand your project requirements and business outdoor signs, is a reflection of your business, and objectives to deliver the results you expect. we are committed to making your business look Increase your productivity and profitability its best. We use state-of-the-art digital printing by using ISS for all of your printing and branding presses, high-quality papers, and offer free proofs needs. We are your single source for graphic design to ensure your products look exactly as intended. services, printing services, and direct mailing Confidently build your brand with help from our services. Think of ISS when you need business exceptional team. At ISS, there is nothing more cards, postcards, brochures, letterhead, envelopes, important than making our customers happy. We banners, posters, trade show materials, outdoor prioritize building relationships and providing signs, and more. We are here each step of the way outstanding customer service to deliver the best to help your growing business. See our ad on page 25 Patricia Sutherland Connolly with Keller Williams Realty – Boston Northwest Patricia Sutherland Connolly Broker-Associate REALTOR, MBA, SRES, ASP Keller Williams Realty - Boston Northwest 200 Baker Avenue, Suite 205 Concord, MA 01742 Mobile: 978-844-6397 Office: 978-369-5775 HOURS OF OPERATION: Meetings by appointment, seven days a week, to suit my clients’ schedules. As a trusted resource for local real estate through closing and beyond, Patty guides you through expertise, Patty Connolly has proven herself as the complexities of buying and selling a home. a positive, helpful partner in buying and selling The housing market is not the same everywhere, residential and investment property. Patty believes so you need someone you can trust for up-to- that when your lifestyle changes, your home should date information. Patty has over 25 years of too. She understands the unique set of emotions real estate experience with designations such that come with selling your current home and as Senior Real Estate Specialist and Accredited buying a new one. As a transition specialist, she Staging Professional. Acton is her childhood home. takes the front seat in this often chaotic and paper- She serves as a member of several community laden process, from the moment you decide to move organizations. Patty presents the perfect through to when you settle into your new place. combination of industry and area knowledge to seamlessly guide you to the area as well as to the Providing innovative marketing strategies, strong home that meets the next phase in your life. negotiation skills, targeted searches, and support 30 www.mwcoc.com

Law Offices of Susan D. Stamps 9 Damonmill Square Suite 5D Concord, MA 01742 978-371-3131 [email protected] www.stamps-law.com The Law Offices of Susan D. Stamps provides Stamps and Karen B. Cohen offer our clients a outstanding litigation and mediation services broad range of expertise in all aspects of this in all aspects of family law, including divorce area of practice, from sophisticated financial and separation, custody, support, parenting matters to the complex psychological dynamics plans, prenuptial agreements, and post-divorce of families going through divorce. Rounding out matters. We value and respect our clients and our legal team is our highly skilled paralegal, include them in every aspect of decision-making. Laura Sirois, who is welcoming and accessible Good communication is the foundation of our and offers invaluable support to our clients. practice and the best way to find solutions that Free initial are right for our each of our clients. With decades of experience in family law consultation. litigation and mediation, Attorneys Susan D. Littleton Liquors, LLC 320 Great Road Littleton, MA 01460 978-486-3200 HOURS OF OPERATION: Mon, Tue 10:00 am - 9:00 pm Wed - Sat 10:00 am - 10:00 pm Sun 10:00 am - 7:00 pm Littleton Liquors features a wide variety of special drink? We also will order and stock your the finest wines, alcohol, and beer from around favorites. the world. Littleton Liquors is managed by Domenic Choose from your favorite domestic mainstays Sebben who has over 20 years of experience in like Budweiser and Miller, as well as a large the liquor industry. Domenic is a retired veteran assortment of IPAs and craft beers. Our large who plays an active and committed role serving selection of wine includes domestic and the community. imported varieties, sparkling wine, Prosecco, rosé, champagne, and more. From top-shelf liquor to economy brands, we offer an amazing selection of liqueurs and distilled spirits. Have a Middlesex West Chamber of Commerce ~ 978-263-0010 31

Ludwig Agency 239 Littleton Road, Suite 5A Westford, MA 01886 978-703-4166 [email protected] www.ludwigagency.com HOURS OF OPERATION: Mon - Fri 8:30 am - 4:30 pm Sat By Appointment Sun Closed My passion for giving back to the community and I have an MBA from Babson College and also strong desire to help families and businesses protect achieved my LUTCF designation from The American those things that they value most led me to open College, signifying my knowledge in Life and the Ludwig Agency in 2009, after a successful career Disability Income Protection Insurance solutions. The in high technology business development. While Ludwig Agency is a member of the Middlesex West offering traditional risk management solutions for Chamber of Commerce and The Massachusetts Farm home, auto, and business is a core part of our model, Bureau Federation, and is a proud supporter of both I really enjoy focusing on helping individuals and the Acton-Boxborough and Harvard Farmers Markets. business owners secure their family’s financial future I live in Harvard and serve the town as a member of by creating what we call the three vaults of money. the Harvard Finance Committee. This approach makes sure your family is taken care of should you live too long, become disabled, or die too Free, No-obligation, soon. Life Happens, and we are here to make sure Life Contingency Review that when it does, you are prepared! MarcelineParent WELLBEING 25 B Stow Road Boxborough, MA 01719 978-692-0047 [email protected] www.marceline.massagetherapy.com HOURS OF OPERATION: By appointment only. MarcelineParent Wellbeing is your local source • improve athletic performance at all levels for improved health, de-stressing, pain relief, and injury recovery. My clients leave my sessions feeling rejuvenated, I use a combination of techniques such as Touch balanced, sometimes energized, and with improved for Health, B.E.S.T, reflexology, and massage to find focus. the root cause of your ailment, and help you develop In addition to working with individual clients, I your best course of action to feel and be your best. have partnered with Pfizer, DraftKings, and other To name a few shared experiences, I have helped corporate clients to: facilitate stress reduction in c•l imenatnsatgoe: depression and anxiety with effective the workplace, reduce absenteeism, and improve alternatives to long-term dependency on employee performance. • mfineddisctarteiossn-srelated sources of chronic pain, and I provide services onsite as well as in my studio • dmeavienltoapinafowcauys to long-term relief in the heart of Boxborough, Rte 111 across from and consistently achieve the goals the church, behind the pond at 25 B Stow Road of weight loss programs Boxborough. Contact me directly at 978-692-0047 or marceline. [email protected] 32 www.mwcoc.com

Middlesex Savings Bank 291 Main Street Acton, MA 01720 978-263-7751 www.middlesexbank.com HOURS OF OPERATION: Mon - Wed, Fri 8:30 am - 5:00 pm Thur 8:30 am - 6:30 pm Sat 9:00 am - 1:00 pm Sun Closed Our drive-up opens Monday through Friday at 8:00 am. Lobby ATM and Dritve-up ATM Middlesex Savings Bank, with assets of over $4 billion We focus on providing personal attention and excellent and 30 branches, is one of the largest and strongest service to all of our customers. banks in Massachusetts. We are also a mutual form of institution, that is, one without stockholders. We cannot Finally, with roots dating back over 175 years, be acquired and are firmly committed to remaining Middlesex Savings Bank is very much a community- independent. oriented bank. Our employees live and are actively involved in the communities we serve. We offer a full range of products and services to meet the financial needs of consumers and businesses. This includes various checking, savings, loan, and investment products for individuals and households, as well as commercial checking and savings, cash management, commercial loans and mortgages, and lines of credit for small and medium-sized businesses. In addition, we offer convenient access to your accounts through our branch network, online banking, telephone banking, and thousands of ATMs—our own, as well as through the Allpoint ATM network. We are more than products and facilities, though. Middlesex West Chamber of Commerce ~ Kathleen McDonald - Executive Director 179 Great Road Suite 104B Acton, MA 01720 978-263-0010 [email protected] www.mwcoc.com HOURS OF OPERATION: Mon - Fri 9:00 am - 4:00 pm Sat, Sun Closed The Middlesex West Chamber of Commerce - Developing CONNETIONS vital to your success is a well-established regional chamber of commerce through monthly networking events; serving the eight communities of Acton, Boxborough, Carlisle, Concord, Littleton, Maynard, Stow and Westford - Increasing VISIBILITY and expanding EXPOSURE in Middlesex County. With members from 19 towns, our through Marketing, Advertising, Sponsorship, Hosting reach extends beyond our eight-town region to include and Presentation opportunities; members as far west as Townsend, as far east as Boston, as far north as Lawrence and as far south as Cape Cod. - Staying at the forefront of your profession/industry We are a vibrant organization offering over 60 events and with BUSINESS DEVELOPMENT and EDUCATION programs throughout the year. offerings; As a non-profit 501(c)6 organization, our mission is to strengthen our communities by voicing support for and - Highlighting the BEST OF MIDDLESEX through annual advocating the promotion of business. The Middlesex major events. West Chamber is proactively reaching out into our region to help businesses, both individually and collectively, - Awards Celebration & Scholarship Fundraiser grow and succeed. honoring Community and Business “stars” for their Chamber membership benefits your business in contributions and achievements. numerous ways: - Taste of Middlesex – Food, Wine & Beer Extravaganza showcasing Middlesex’s exceptional Restaurants, Wineries and Breweries. We invite you to experience our dynamic chamber! We are here to serve you and your business! Middlesex West Chamber of Commerce ~ 978-263-0010 33

Minute Man Arc 5 Forest Ridge Road Concord, MA 01742 978-287-7900 www.minutemanarc.org HOURS OF OPERATION: Mon - Fri 8:00 am - 4:30 pm Sat, Sun Closed Minute Man Arc is a lifespan agency for people Concord, Lincoln, Littleton, Maynard, Stow, and the with developmental disabilities. We are committed surrounding communities. to enhancing inclusion in the community, We offer a wide range of programs including maximizing personal choice and decision making, Early Intervention for young children birth and supporting all people to achieve potential in all to age three; Family Services & Recreation areas of life. for teens and adults; and programming in The agency assists more than 700 individuals Employment Services, Day Habilitation, each year through a variety of supports such and Residential Services for adults. Living as physical/occupational therapy, socialization, choices for our Residential participants include nine physical fitness, life skill training, vocational community group homes as well as Adult Foster services, and more. Participants come to Minute Care, Shared Living, and Independent Living Man Arc from Acton, Bedford, Boxborough, Carlisle, arrangements with support from Minute Man Arc. Mr. Trashman 100 Powdermill Road Suite 248 Acton 01720 508-278-6910 www.mrtrashman.com HOURS OF OPERATION: Mon - Fri 8:00 am - 5:00 pm Sat 9:00 am - 1:00 pm Sun Closed Mr. Trashman is the premier residential and and involved small business owner can provide. commercial trash and recycling service operating Our customers can look forward to receiving within the towns of Acton, Bolton, Boxborough, the best service from seasoned waste Concord, Hudson, Stow, and Sudbury. management and recycling professionals Our goal is to provide our customers with who utilize newer model, split-body trucks the best waste disposal services possible with designed to process your trash and recycling a commitment to customer satisfaction and in one pass. The split body truck means less loyalty. Mr. Trashman is owned and operated by large truck traffic on your street and in the Patrick Norris, who leads the daily operation and neighborhood. management of the company. This means our Mr. Trashman offers weekly curbside service customers’ needs and new service sign-ups will for $39.00 per month—not an introductory be handled with the attention only a committed rate, no hidden fees. 34 www.mwcoc.com

NorthBridge Insurance Agency, Inc. 1150 Main Street Concord, MA 01742 978-369-5656 [email protected] www.northbridgeins.com HOURS OF OPERATION: Read our letter on page 3 Mon - Fri 9:00 am - 5:00 pm Sat, Sun Closed For your convenience, we are available before or after hours by appointment. Welcome to NorthBridge Insurance, located in helping us to keep in touch with the changing needs West Concord and providing insurance products of our clients. Some of these organizations include: since 1997. Our team of professionals are licensed - Concord Business Partnership and focused on service. We offer a full range of - Concord Chamber of Commerce insurance products to protect individuals and - Massachusetts Association of Independent Agents families as well as corporate clients and businesses - Middlesex West Chamber of Commerce of every shape and size. - Society of Certified Insurance Counselors Our goal is to provide service that exceeds NorthBridge has been a Reader’s Choice Award your expectations and we have been careful to winner for the past eight years, and we are very partner with strong insurance companies that offer proud of our reputation for careful attention and products, technology, and services that meet our thoughtful service. We invite you to contact us and high standards. together we will develop an insurance program that is right for you. Thank you. We are members of many professional groups, each Northeast Numismatics Read our letter on page 11 100 Main Street, Suite 330 Concord, MA 01742 978-369-9155 [email protected] www.northeastcoin.com HOURS OF OPERATION: Mon - Fri By Appointment Sat, Sun Closed Serving collectors for over 50 years. Owner and President Tom Caldwell started Dealers and collectors alike visit our site, which is his coin business in Littleton back in 1964 with updated daily. this as his maxim: Rare Coins - Personal Service. Northeast is always looking to purchase Tom moved the business to Concord in 1980 individual rarities or entire collections of coins. and has continued to offer the finest coins while We work with banks, attorneys, and individuals in growing the business to a locally, nationally, and regards to estate valuations of coins. And now we internationally well-respected numismatic firm. would like to offer the chance for local residents Tom and other members of the firm frequently to get a complimentary expert coin appraisal of travel to coin shows and auctions around the their collection. Please contact us to set up an world to buy and sell coins. Our entire inventory is appointment. listed on our website at www.northeastcoin.com, We invite you to see for yourself that Rare Coins where we have nearly 5,000 U.S. and world coins. - Personal Service is what Northeast is known for. Middlesex West Chamber of Commerce ~ 978-263-0010 35

Northern Bank 414 Massachusetts Ave Kathy Arpano Acton, MA 01720 Acton Branch Manager – AVP 978-263-9501 978.569.1910 www.nbtc.com [email protected] HOURS OF OPERATION: Mon - Wed 8:30 am - 4:30 pm Thur 8:30 am - 7:00 pm Fri 8:30 am - 6:00 pm See our ad on page 2 Sat 8:30 am - 12:00 pm Sun Closed Since 1960, Northern Bank has been the S&P Global Market Intelligence Rankings – banking partner of choice for businesses and Northern Bank was rated #1 nationally and in New consumers throughout New England. We take England among Banks with $1B to $10B in assets in an entrepreneurial, commonsense approach to 2015. From 2010-2014, Northern Bank was rated #1 providing a complete line of banking and investment in New England among Banks with $500M to $5B in solutions. assets. We are deeply invested in the communities we serve and passionately committed to helping you, our customers, grow. Thanks to the unwavering dedication of our team and the loyalty of our customers, we have been named the #1 performing Community Bank in New England for six straight years and #1 in the United States in 2015. See our ad on page 13 Periwinkle Art and Glassworks 586 Massachusetts Avenue Acton, MA 01720 508-479-9699 [email protected] www.periwinkleglassworks.com HOURS OF OPERATION: Tue 11:00 am - 9:00 pm Wed - Sat 11:00 am - 5:00 pm Mon, Sun By Appointment Periwinkle Art & Glassworks, located in the heart possibilities for expression through color and design. of West Acton Village, opened its doors in November We have unique, ready-to-sell stained glass panels 2013. We specialize in creating and teaching upcycled fused and stained glass art, flamework, felting, jewelry, and tiny fused paintings with millefiori and bits of glass. textile recycling, and many other options to come. In We also have fused glass jewelry, wind chimes, and addition, we are a shop and gallery, featuring the work other handmade glass gifts created on-site. of an eclectic group of over 70 local artists. Paintings, jewelry, pottery, quilts, fiber arts, blown glass, soaps, Please stop in, say hello, and enjoy what’s happening and candles, you will find something special and unique at the studio daily! when you come to Periwinkle Art and Glassworks! “You use a mirror to see your face, and art to see Periwinkle offers a variety of classes and workshops your soul.” for kids and adults including Glass Night Out, birthday parties for all ages, drop-in and scheduled weekly 10% off any class classes, and studio time for seasoned students. coupon code MWC16 Glass is a versatile medium which offers endless Does not apply to parties or class “specials”. Bring coupon code. Expires:Never! 36 www.mwcoc.com

Star Custom Framers Read our letter on page 11 117 Great Road, Suite 11A Stow Shopping Center Stow, MA 01775 978-461-2155 [email protected] www.starcustomframers.com HOURS OF OPERATION: Tue, Wed, Fri 10:00 am - 6:00 pm Thur 10:00 am - 7:00 pm Sat 10:00 am - 4:00 pm Mon, Sun Closed I bought Star Custom Framers in the spring of membership in the Middlesex West Chamber 2005, desiring to have my own company and to of Commerce have been vital to our success in utilize my extensive retail/wholesale experience growing our business. gained in 30+ years in the footwear industry. As I What’s special about our shop is our passion searched various options of potential businesses, for continuously learning the craft as well as the I knew for certain that I wanted to continue the science of Conservation Custom Picture Framing. creativity I so enjoyed in designing shoes. I have All work is handcrafted in our shop and comes thoroughly enjoyed the experience of serving with an unconditional guarantee for our clients’ the wonderful people that frequent our center satisfaction. This attitude has helped us maintain as well as being a good neighbor through our an A+ rating from the Better Business Bureau support of the many fine local organizations that over the last nine years that we have been surround the Stow area. I feel that our strong members. We live by our motto “We Specialize sense of community involvement and our active in Quality, Service & Design.” TD Bank 408 Massachusetts Avenue Acton, MA 01720 978-263-7061 978-500-1012 www.tdbank.com HOURS OF OPERATION: Mon - Wed 8:00 am - 6:00 pm Thur, Fri 8:00 am - 7:00 pm Sat 8:00 am - 2:00 pm Sun 11:00 am - 3:00 pm TD Bank, America’s Most Convenient Bank, is one of 2012, and has worked to become a strong and of the 10 largest banks in the U.S., providing nearly contributing member of the community. The Acton 8 million customers with a full range of retail, small TD team is dedicated to creating WOW customer business, and commercial banking products and service experiences. It is an important focus services at more than 1,300 convenient locations. for every member of the team to provide great To learn more, visit www.tdbank.com. customer service, and we truly enjoy providing for TD Bank offers value and convenience for our customers’ needs and goals as well as those of our customers. We use logically matched services to help local communities. our customers achieve their financial goals, ranging Joseph Badenhoff, manager, has been with TD from personal and business checking and savings to Bank since 2011 and a member of the Acton team mortgage and loan offerings. It is our mission is to since 2012. Joseph prides himself on working with create an accurate and ethical financial relationship dedication and energy to provide true value to his based on individual banking necessities. team, community, and customers. TD Bank in Acton, MA was first opened in May Middlesex West Chamber of Commerce ~ 978-263-0010 37

The Atrium at Drum Hill 2 Technology Drive Chelmsford, MA 01863 978-934-0000 [email protected] www.benchmarkseniorliving.com HOURS OF OPERATION: Mon - Sun 8:00 am - 8:00 pm The Atrium at Drum Hill is proud to be a part safe and familiar, empowering and fulfilling. Our of the Benchmark Senior Living family. Founded unique, single story residence is designed to in 1997, Benchmark is the largest senior living maintain independence and connect residents provider in New England, setting the benchmark with the people who love them—their families in senior living, through our care, dining, passion and their extended family here at The Atrium. for innovation, and exceptional team. Our life’s We encourage residents with memory loss work is helping seniors live happier, healthier, to enjoy all of the benefits of our assisted living more fulfilling lives. At The Atrium, memory care lifestyle, supported by a caring team, specialized is all we do. We are a community where every programs, and a neighborhood designed just for sight, sound, taste, feeling, and experience is them. Our Live Now, Live Engaged® program designed to help seniors with memory loss lead gives residents freedom, choice, and the more rewarding lives. opportunity to enjoy a meaningful day every day. Our goal is to create an environment that feels The Curry House 313 Littleton Road #12 Chelmsford, MA 01824 617-257-0083 [email protected] www.thecurryhouse.biz HOURS OF OPERATION: Dinner 4:30 pm - 9:30 pm Lunch Mon -Thu 4:30 pm - 10:00 pm Mon - Fri 11:30 am - 2:30 pm Fri - Sat 4:30 pm - 9:00 pm Sat - Sun. 12:00 pm - 4:30 pm Sun Where you can find the most authentic North Indian cuisine. The Curry House is an Indian restaurant in Chelmsford and Franklin, MA. We are a diverse team of individuals that pride ourselves in bringing you an experience of contemporary Indian restaurant. We aspire to offer a dining experience to satisfy everyone. We offer you culture, atmosphere and the best of the best Indian food, with a specialization in North Indian cuisine. Lunch Buffet and Dinner served every day. 38 www.mwcoc.com

Title Boxing Club Littleton 365 Constitution Avenue Littleton, MA 01460 978-486-0100 [email protected] www.titleboxingclub.com/littleton-ma HOURS OF OPERATION: Mon, Wed 5:00 am - 8:00 pm Tue, Thur 6:00 am - 8:00 pm Fri 5:00 am - 7:00 pm Sat, Sun 7:30 am - 12:00 pm TITLE Boxing Club delivers the amazing results of journey. We want to know your name and your story. boxing, minus the combat, to sculpt and strengthen We promise to help reawaken the fighting spirit your body from head to toe. Perfect for people of all in you. ages and fitness levels, we combine no-hit boxing and kickboxing techniques with cardio and toning Erin Bibber, the owner, comes to TITLE with a exercises to help you reach your goals quickly and love of fitness and people. With a computer science continue conquering new ones. Our stress-busting, degree and 20+ years in corporate America, Erin high-sweat, group fitness workouts are as fierce as finally made the leap out from behind the desk, to they are fun. Try our signature POWER HOUR free follow her true passion of staying active, staying and see how good it feels to blast away calories. fit, and helping others. Erin loves to learn from anyone she meets and is even more excited about Our people have heart. Every owner, trainer, and the amazing team growing at TITLE Boxing Club staff member is here to connect with you through Littleton, MA! the workout and stand alongside you in your life’s Visiting Angels - Home Care Services 498 Great Road Acton, MA 01720 978-263-1212 [email protected] www.visitingangels.com/acton HOURS OF OPERATION: Mon - Fri 9:00am - 5:00pm Weekends On Call We provide PEACE of MIND to clients and families. Visiting Angels home care was started by our medication reminders, homemaking (meals, founders in the 1990s and is now throughout the laundry, light housekeeping, and shopping), and United States and several other countries. The companionship by certified home health aides or first office in Massachusetts opened 15 years nurse assistants. Our caregiver employees are ago, and there are now 15 offices in the state. screened and bonded, and supervised by our Karen and Tony Rivero of Acton found Visiting Registered Nurse. Our local agency is licensed, Angels when they were looking for care for insured, and accredited, and serves towns from Karen’s parents, and opened the current office Lexington to Lancaster, Tyngsborough to Stow. in 2007. Visiting Angels provides private duty Our goal is to build relationships with our clients services for seniors and adults in the comfort and their families. Complimentary in-home of their own home. Our personalized non- safety and fall evaluations provided. medical services include personal hygiene care, Middlesex West Chamber of Commerce ~ 978-263-0010 39

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 ACCOUNTING / CPAS Periwinkle Art and Glassworks  Harsip & Stuart, P.C. (see pg. 11) (see pgs. 13,36) 289 Great Road Brad M. Capland, CPA 586 Massachusetts Avenue  Acton, MA 01720 2250 Main Street Acton, MA 01720 978-264-0250 Concord, MA 01742 508-479-9699 www.harsip-stuart.com 978-371-8000 www.periwinkleglassworks.com www.bradcapland.com Law Office of Kathleen P. Ryder and Resident Artist Studio Associates, P.C. Coughlin, Sheff & Associates, P.C.  438 Hill Road 4 Lan Drive - Suite 110 (see pg. 25) Boxborough, MA 01719 Westford, MA 01886 125 Nagog Park 978-635-9162 978-957-7000 Acton, MA 01720 www.eyepalusa.com www.ryderlaw.net 978-263-3777 www.csa-pc.com Star Custom Framers (see pgs. 11,37) Law Offices of Susan D. Stamps (see pg. 30) 117 Great Road, Suite 11A 9 Damonmill Square, Suite 5D KAC’s Accounting Services Stow Shopping Center Concord, MA 01742 4 Mount Pleasant St. Stow, MA 01775 978-371-3131 Billerica, MA 01862 978-461-2155 www.stamps-law.com 978-262-9814 www.starcustomframers.com Levine-Piro Law, PC Kristin M. Cressman, CPA, MST Sunlight Photography 63 Great Road Suite 101 Maynard, MA 01754 PO Box 1234 9 Overlook Drive 978-637-2048 http://www.levinepirolaw.com Westford, MA 01886 Acton, MA 01720 Levitt Law Group (see pg. 2) 978-265-0463 508-982-7744 4 Meeting House Rd., Suite 3 Chelmsford, MA 01824 www.sunlightphotography.net 978-458-5550 www.levittlawgroup Midge Belcourt, CPA Rafanelli & Kittredge, PC 201 Great Road, Suite 302 ATTORNEYS / LEGAL SERVICES 1 Keefe Road Acton, MA 01720 Acton, MA 01720 978-369-6001 www.rkpclaw.com 978-263-0212 Alphen & Santos Richard Mandel, Esquire www.belcourtcpa.com 200 Littleton Road 30 Rowes Wharf Boston, MA 02110 Westford, MA 01886 617-529-3549 www.okdllp.com Sechrest & Bloom, LLC 978-692-3107 Scheier, Katin & Epstein, P.C. 526 Main Street, Suite 301 103 Great Road - Wetherbee House Acton, MA 01720 Acton, MA 01720 Bay State Elder Law, P.C.  978-264-4655 www.skactonlaw.com 978-263-7771 (see pgs. 9,18) The Parents Estate Planning Law Firm, P.C. www.sechrestcpa.com Two convenient locations 289 Great Road, Suite 302 Acton, MA 01720 in Acton and Sudbury 978-263-6900 www.parentsestateplanning.com ARCHITECTS / INTERIOR DESIGN AUTOMOTIVE 978-263-0006 AAA Northeast EAV Inc. www.baystateelderlaw.com 342 Great Road Acton, MA 01720 218 Littleton County Rd. (978) 266-1000 X3395 Harvard, MA 01451 Bullwinkel & Brooks, LLC  Acton Ford, Inc. 76 Powdermill Road 978-501-9007 (see pg. 20) Acton, MA 01720 978-897-7000 www.linkedin.com/pub/peter-deng/1/2a8/604 2 Lan Drive, Suite 120 www.actonford.com Westford, MA 01886 Acton Toyota of Littleton 221 Great Road Elza B. Design, Inc 978-320-3400 Littleton, MA 01460 978-263-1500 91 Main Street, Suite 302 www.bullwinkelbrooks.com Concord, MA 01742 781-859-7817 Caprara Law, PC www.elzabdesign.com 179 Great Road, Suite 212 Acton, MA 01720 Joyce Contract Interiors, Inc. 617-999-9859 319 Littleton Rd, Suite 304  www.caprara-law.com Westford, MA 01886 978-251-2226 Clock Tower Law LLC 537 Massachusetts Avenue ART / FRAMING / PHOTOGRAPHY Acton, MA 01720 978-263-0400 Catherine Meeks Fine Art & Design www.clocktowerlaw.com 65 Nashoba Road Acton, MA 01720 Eckel, Morgan & O’Connor 978-263-5341 267 Great Road catherinemeeks.blogspot.com Acton, MA 01720 978-266-0101 Catherine Pfau Photography www.eckel-law.com 52 Quaker Lane Bolton, MA 01740 Gould Law Offices 978-337-3059 311 Great Road www.catherinepfauphotography.com Littleton, MA 01460 978-486-9566 40 www.mwcoc.com

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 Boch Honda West Middlesex Savings Bank (see pg. 32) Vinmark Group Inc. 299 Littleton Road 291 Main Street 82 Russells Way Westford, MA 01886 Acton, MA 01720 Westford, MA 01886 978-589-4201 978-263-7751 617-953-0500 www.bochhondawest.com www.middlesexbank.com www.vinmarkgroup.com Colonial Chevrolet of Acton  Mortgage Network, Inc. CHILD CARE (see pg. 22) 239 Littleton Road 171 Great Road  Westford, MA 01886 Goddard School Acton, MA 01720 978-399-1341 162 Concord Road 978-263-1000 www.tompopson.com Westford, MA 01886 www.buycolonialchevrolet.com 978-692-3531 Northern Bank (see pgs. 2,35) www.goddardschool.com Quick Lane, Tire and Auto Center 414 Massachusetts Avenue 60 PoweRoadermill Road Acton, MA 01720 CHIROPRACTIC Acton, MA 01720 978-263-9501 978-897-3000 www.nbtc.com Barron Chiropractic & Wellness Center www.quicklaneofacton.com 83 Great Road TD Bank (see pg. 37) Acton, MA 01720 Village European 408 Massachusetts Avenue 978-266-9286 50 Concord Turnpike Acton, MA 01720 www.barronchiro.com Concord, MA 01742 978-263-7061,978-500-1012 978-369-4700 www.tdbank.com Stow Family Chiropractic www.villageeuropean.com 118 Great Road Workers Credit Union (see pg. 24) Stow, MA 01775 BAKERY 452 Great Road 978-897-1770 Acton, MA 01720 www.stowfamilychiropractic.com Concord Teacakes (see pg. 23) 978-264-4526 59 Commonwealth Avenue CLOTHING AND SHOE STORES Concord, MA 01742 BUSINESS COACHING 978-369-7644 Gould’s Distinctive Clothing (see pg. 27) www.concordteacakes.com Emerge Coaching for Success 260 Great Road P.O. Box 1001 Acton, MA 01720 Cookie Lady Treats Littleton, MA 01460 978-263-0374 22 Howard Road 978-952-6984 www.gouldsclothing.com Maynard, MA 01754 www.emergewithcoaching.com 978-298-5754 Michael’s Shoe Ideal Group Incorporated 262 Great Road Dunkin’ Donuts Acton, MA 01720 P.O. Box 2767 BUSINESS CONSULTING / 978-263-8772 Acton, MA 01720 QUANTITATIVE ANALYSIS 978-263-6960 COIN DEALER www.dunkindonuts.com Cambridge Focus 2 Clock Tower Place Northeast Numismatics (see pgs. 11,35) Golden Girl Products, LLC Maynard, MA 01754 100 Main Street, Suite 330 2 Shaker Road, Suite C205 978-344-5141 Concord, MA 01742 Shirley, MA 01464 978-369-9155 978-425-5058 Carl Belack Consulting www.northeastcoin.com www.goldengirlgranola.com 111 Waterside Clearing Acton, MA 01720 COMPUTER & IT SERVICES BANKS / MORTGAGES 978-266-3716 Ekaru, LLC Cambridge Savings Bank (see pg. 21) BUSINESS SERVICES / STAFFING 319 Littleton Road, Suite 105 202 Sudbury Road AGENCY Westford, MA 01886 Concord, MA 01742 978-692-4200 617-441-7115 Alpha Business Group www.ekaru.com www.cambridgesavings.com 4 Cricket Way Acton, MA 01720 Not Your Problem, Inc. Digital Federal Credit Union 978-263-4828 176 Great Road 207 Constitution Avenue www.alphabizgroup.com Maynard, MA 01754 Littleton, MA 01460 978-525-0110 978-486-6394 Capstone Practice Systems, Inc. 193 Bolton Road CONTRACTORS / PLUMBING / Enterprise Bank (see pg. 26) Harvard, MA 01451 ELECTRIC 237 Littleton Road 978-456-3424 Westford, MA www.capstonepractice.com Acton Handyman, LLC  978-656-5557 (see pgs. 16,24) Clarity Advantage Corp. 7 Post Office Square 340 Great Road 163 College Road, Suite 1 Box 2812 Acton, MA 01720 Concord, MA 01742 Acton, MA 01720 978-656-5707 978-369-4755 978-844-6359 www.EnterpriseBanking.com www.clarityadvantage.com www.actonhandyman.com Middlesex West Chamber of Commerce ~ 978-263-0010 41

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 ARC Remodelling, LLC DISASTER CLEANUP/ FITNESS / SPORTS / RECREATION 151 Depot Street ENVIRONMENTAL CONSULTING Westford, MA 01886 Acton Recreation Dept (see pg. 14) 617-797-0799 FS Engineers, Inc. 472 Main Street www.arcremodeling.com Suite 630 2 Clock Tower Place Acton, MA 01720 Maynard, MA 01754 978-929-6640 Joseph G. Perry Plumbing & Heating 978-298-5956 www.acton-ma.gov/recreation 29 Homestead Street www.fsengrs.com Acton, MA 01720 Colonial Figure Skating Club 978-263-5595 Servpro of Marlboro/Concord 34 Mass. Avenue www.joeperryplumbing.com 110 Middlesex St. Acton, MA 01720 Chelmsford, MA 01863 978-263-3450 Mark Roth Electrical Services 508-328-2144 www.colonialfsc.com 15 Old Village Road www.servpronashua.com Acton, MA 01720 Fitting Fitness In 978-263-2834 DRIVING SCHOOL 172 West Acton Road Stow, MA 01776 P-S Berube Construction Design- Nashoba Valley Auto School LLC 978-502-8781 Build (see pg. 48) 2 Park Drive, Suite 3 www.FittingFitnessIn.com 123 Pierce Road Westford, MA 01886 Townsend, MA 01469 978-692-2244 Get in Shape for Women, Acton  978-597-2020 www.nashobavalleyautoschool.com (see pgs. 14,27) www.psberubeconst.com 133 Great Road EDUCATIONAL SERVICES Acton, MA 01720 Patrick A. Gallagher, Contractor 978-929-9449 25 Keefe Road Acton-Boxborough Regional Schools www.getinshapeforwomen.com Acton, MA 01720 36 Charter Road 978-369-4022 Acton, MA 01720 InMotion Cycling Studio, LLC 978-264-4700 7 Littleton Road, Unit G1 Pete’s Plumbing & Heating, Inc. www.ab.mec.edu Westford, MA 01886 Concord Meadows 300 Baker Avenue  978-319-9074 Concord, MA 01742 Creation Station www.inmotioncycling.com 978-571-6596 1 Park Drive #9  Westford, MA 01886 Nashoba Valley Ski Area (see pg. 7) COUNSELING 978-496-1563 79 Powers Rd Westford, MA 01886 Dana Snyder-Grant, LICSW Huntington Learning Center 978-857-0886 18 Half Moon Hill 504 Nagog Park Orangetheory Fitness Westford 160 Littleton Road Acton, MA 01720 Acton, MA 01720 Westford, MA 01886 978-237-8936 978-266-9409 978-263-6677 www.orangetheoryfitness.com www.snyder-grant.org/dana The Thoreau Club 275 Forest Ridge Rd Maynard Education Foundation Concord, MA 01742 978-831-1212 DENTAL P.O. Box 89  www.thoreau.com Maynard, MA 01754 Title Boxing Club Littleton (see pg. 39) 365 Constitution Avenue Cornerstone Dental Group (see pgs. 5,23) 978-938-4262 Littleton, MA 01460 978-486-0100 5 Cornerstone Square, Suite 202 www.titleboxingclub.com/littleton-ma Westford, MA 01886 National Aviation Academy Wedgewood Pines Country Club 215 Harvard Road 978-692-6012 130 Baker Avenue Extension Stow, MA 01775 978-897-1790 SmileWestford.com Concord, MA 01742 www.wedgewoodpines.com 781-274-8448 WestFit 4 Littleton Road Dental POSSE, LLC Westford, MA 01886 978-692-7597 35 Beharrell Street, #1417 Open Door Education Westford Regency Health Club Concord, MA 01742 492 Main St 219 Littleton Rd. Westford, MA 01886 978-369-8070 Acton, MA 01720 978-692-8200 www.westfordregency.com 978-505-8948 Emerson Dental, PC www.OpenDoorTestPrep.com 133 Littleton Rd Suite 201 Westford, MA 01886 Roudenbush Community Center 978-399-0017 65 Main Street www.emerson-dental.com Westford, MA 01886 978-692-5511 Gilbert E. Carley, D.M.D. www.roudenbush.org Acton Dental Building 418 Mass Avenue ELECTRONICS / DESIGN & Acton, MA 01720 DEVELOPMENT 978-263-3971 Cracom Engineering Technologies, Inc. North Acton Dental P.O. Box 723 255 Great Road Westford, MA 01886 Acton, MA 01720 978-264-9889 978-266-1614 www.cracom.com www.northactondental.com 42 www.mwcoc.com

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 FLORIST Bridges by EPOCH Emerson Hospital 108 Littleton Rd. (see pgs. 26,47) Concord Flower Shop Westford, MA 01886 Route 110, 133 Littleton Road 135 Commonwealth Ave 978-692-9541 Westford, MA 01886 Concord, MA 01742 www.bridgesbyepoch.com 978-589-6999 978-369-2404 www.emersonhospital.org www.concordflowershop.com Bullock’s Nursing Service  (see pgs. 20,24) Footcare Focus FOOD STORES / SPECIALTY 747 Main Street, Suite 316 34 George St FOOD BUSINESSES Concord, MA 01742 Littleton, MA 01460 978-369-0463 617-417-2149 Ferns Country Store bullocksnursingservice.com 8 Lowell Rd. Gateway Vision PC Carlisle, MA 01741 CareOne at Concord 288 Littleton Road Ste 2 978-369-0200 57 ORNAC Westford, MA 01886 www.FernsCountryStore.com Concord, MA 01742 978-692-2521 978-371-3400 Idylwilde Farm, Inc. Healthcare Insights 366 Central Street ComForCare Home Care 64 Seminole Road Acton, MA 01720 70 Broadway Street Acton, MA 01720 978-263-5943 Westford, MA 01886 978-621-1926 www.idylwildefarm.com 978-256-2468 www.brainwellness.com,www.bu.edu/ www.middlesexnorth.comforcare.com alzresearch/about/team/faculty/lombardo/ Kimball Farm 400 Littleton Rd Home Is Best Home Healthcare LLC Ideal Weight Loss of Central MA - Littleton  Westford, MA 01886 24 Nile Street (see pg. 29) 978-486-3891 Billerica, MA 01821 671 Great Road, Unit 4 www.kimballfarm.com 978-435-3775 Littleton, MA 01460 978-486-1012 Roche Bros. Supermarket Life Care Center of Acton (see pg. 9) www.idealweightlosscentralmass.com 387 Mass Ave One Great Road Acton, MA 01720 Acton, MA 01720 Juice Plus+ 978-263-0404 978-263-9101 17 Green Needles Road www.rochebros.com www.lcca.com Littleton, MA 01460 978-479-4110 FUNERAL SERVICES Life Care Center of Nashoba Valley www.LuannColombo.com 191 Foster Street Acton Funeral Home  Littleton, MA 01460 MarcelineParent WELLBEING (see pg. 14) 978-486-3512 (see pg. 32) P.O. Box 882 www.lifecarecenterofnashobavalley.com 25 B Stow Road Acton, MA 01720 Boxborough, MA 01719 978-263-5333 The Atrium at Drum Hill (see pg. 38) 978-692-0047 www.actonfuneralhome.com 2 Technology Drive www.marceline.massagetherapy.com Chelmsford, MA 01863 Acton Monument Co., Inc. 978-934-0000 New England Center for Mental Health P.O. Box 2349 www.benchmarkseniorliving.com 289 Great Road Suite G1 Acton, MA 01720 Acton, MA 01720 978-263-5205 Visiting Angels - Home Care 978-678-1200 www.actonmonument.com Services (see pg. 39) 498 Great Road New England Forever Aloe HEALTH & ELDER CARE Acton, MA 01720 55 Taylor St 978-263-1212 Littleton, MA 01460 24 Hours Care (see pg. 15) www.visitingangels.com/acton 978-501-5779 73 Lexington Steet, Suite #LL5 www.flp.com Newton, MA 02466 HEALTH, MEDICAL & WELLNESS 617-792-0500,617-244-4676 Ptfitstyle Ideal Weight Loss www.24hourscare.com Acton Medical Associates, PC 359 Littleton Road 321 Main Street Westford, MA 01886 Acton Nursing Service  Acton, MA 01720 978-204-3556 (see pgs. 16,48) 978-263-1425 www.ptfitstyleideal.com 30 Sudbury Road  www.actonmedical.com 2 North Simon Acupuncture and Nutrition Acton, MA 01720 Acton Pharmacy, Inc. 438 King St 978-929-6650 563 Mass Avenue Littleton , MA 01460 www.actonnursingservices.com Acton, MA 01720 617-470-6205 978-263-3901 Benchmark Senior Living at Robbins www.actonpharmacy.com The Virginia Thurston Healing Garden Brook (see pg. 18) Cancer Support Center 10 Devon Drive ChiroPro Performance Center 145 Bolton Road Acton, MA 01720 30 Great Road Suite 103 Harvard, MA 01451 978-264-4666 Acton, MA 01720 978-456-3532 www.benchmarkatrobbinsbrook.com 978-429-8952 www.healinggarden.net Middlesex West Chamber of Commerce ~ 978-263-0010 43

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 HOBBIES Ludwig Agency (see pg. 31) MARKETING, ADVERTISING, 239 Littleton Road, Suite 5A DESIGN, WEB, WRITING Create! Sewing Studio Westford, MA 01886 274 Great Road (lower level) 978-703-4166 Brandmarketing & Design Acton, MA 01720 www.ludwigagency.com 508-320-5475 CMB Virtual Services www.createsew.com NorthBridge Insurance Agency, Inc.  18 Notre Dame Road (see pgs. 3,34) Acton, MA 01720 HOTEL & CONFERENCE CENTER 1150 Main Street 978-314-6232 Concord, MA 01742 Boxboro Regency Hotel & Conference 978-369-5656 Elizabeth West Center (see pg. 7) www.northbridgeins.com 526 Stow Road 242 Adams Place Boxborough, MA 01719 Boxborough, MA 01719 Perennial Advisors Group 978-263-2853 978-263-8701 270 Littleton Road Suite 19 www.eduwrite.com www.boxbororegency.com Westford, MA 01886 978-577-6025 Market Dynamics Concord’s Colonial Inn (see pg. 25) http://www.perennialadvisorsgroup.com 10 MacLeod Lane 48 Monument Square Acton, MA 01720 Concord, MA 01742 KITCHEN & BATH DESIGN, 978-635-5411 978-371-2908 X544 CABINETS www.marketdynamics.info Courtyard by Marriott Boston-Littleton Great Spaces, Inc. (see pg. 28) My Hometown Map 40 Wayerfield Road 102 Constitution Ave.  25B Stow Road Osterville, MA 02655 508-930-7065 Littleton , MA 01460 Boxborough, MA 01719 Winning Content Strategy 978-440-5040 978-760-0729 22 Elizabeth Dr. Stow, MA 01775 www.marriott.com/hotels/travel/boslt- www.greatspacesinc.com 978-835-4354 www.winningcontentstrategy.com courtyard-boston-littleton MUSEUMS / MUSIC & LANDSCAPING PERFORMING ARTS Residence Inn by Marriott Concord - Boston Lombardo Loam and Gravel Co., Inc. 320 Baker Avenue 30 Stow Street Concord, MA 01742 Acton, MA 01720 978-341-0003 978-263-8045 www.residenceinnconcordma.com www.lombardoloam.com Westford Regency Inn and Strawberry Hill Co. Indian Hill Music Conference Center 124 Pope Road 36 King Street 219 Littleton Road Acton, MA 01720 Littleton, MA 01460 Westford, MA 01886 978-265-4992 978-486-9524 978-692-8200 www.indianhillmusic.org www.westfordregency.com MANUFACTURING / EQUIPMENT Open Door Theater INSURANCE / FINANCIAL ADVISORS A.C. & M. Fire Equipment Co. c/o Sam Gould Gould Law Offices, 311 Great Road P.O. Box 481 Littleton, , MA 01460 978-486-9566 Boston Harbor Wealth Advisors (see pg. 19) Concord, MA 01742 The Discovery Museums 289 Great Road, Suite #304 978-264-4412 177 Main St. Acton, MA 01720 Acton, MA 01720 978-264-4200 www.discoverymuseums.org 978-767-8667 Coatings2Go, LLC Theatre III www.bostonharborwealth.com 399 Concord Street 250 Central Street Acton, MA 01720 Carlisle, MA 01741 978-263-9070 www.theatre3.org Boxborough Insurance Agency 978-369-7411 NON-PROFITS 650 Massachusetts Ave. Acton Lions Club Boxborough, MA 01719 Cynosure PO Box 2391 Acton, MA 01720 978-635-0044 5 Carlisle Rd 978-621-8005 Westford, MA 01886 Acton-Boxborough United Way 49 Stoneymeade Way Diane Jaques Insurance Agent 978-256-4200 Acton, MA 01720 978-263-1777 12 Kenney Lane www.cynosure.com www.abuw.org Concord, MA 01742 978-764-7477 Haartz Corporation 87 HaywaRoad Road Gallant Insurance Agency, Inc. Acton, MA 01720 199 Great Road 978-264-2600 Acton, MA 01720 www.haartz.com 978-263-3500 www.gallantins.com RH Products Inc. 308 Old High Street Insurance Center of New England, Acton, MA 01720 Inc. (see pg. 2) 978-897-8000 304 Littleton Road rhadhesives.com Westford, MA 01886 413-750-7137 44 www.mwcoc.com

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 ActonTV (see pg. 17) Fish Nook Pet Center EXIT Realty Partners – The Roser 16A Craig Road Acton, MA 01720 266 Great Road Realty Group 978-263-6033 www.actontv.org Acton, MA 01720 9 Cornerstone Sq. #200 American Cancer Society 978-263-9370 Westford, MA 01866 43 Nagog Park #110 Acton, MA 01720 978-660-5750 781-314-2632 PRINTING / PROMOTIONAL ITEMS Habitat for Humanity North Central Massachusetts (see pg. 28) Karen Guerin - Coldwell Banker 138 Great Road, 2nd Floor Acton, MA 01720 Facilitations, Ltd. Residential Brokerage  978-348-2749 ncmhabitat.org 22 Smart Road (see pgs. 13,30) Household Goods, Inc. Acton, MA 01720 626 Main Street 530 Main Street Acton, MA 01720 978-263-8589 Bolton, MA 01740 978-635-1710 x 7 www.facilitations.com 978-779-2247, FAX:978.779.5154 Middlesex West Chamber of Commerce (see pg. 33) www.karenguerinrealtor.com 179 Great Road, Suite 104B Acton, MA 01720 ISS, Inc. (see pg. 29) 978-263-0010 www.mwcoc.com 2 Shaker Road, D103 MassDevelopment Shirley, MA 01464 360 Merrimack Street Building 5 978-425-3600 Lawrence, MA 01843 www.issondemand.com (978) 459-6100 x 101 Passion Print & Design Services New Habitat Partners LLC 75 Maple Street 537 Mass Ave, #202 Acton, MA 01720 Acton, MA 01720 978-505-8070 617-765-4493 www.passionprint.net www.newhabitatpartners.com The Red Apple Northeast Association of Realtors 70 Central Street Suite 204 6 Lyberty Way  Acton, MA 01720 Westford, MA 01886 978-302-9480 978-577-6138 Minute Man Arc (see pg. 33) PUBLISHERS / NEWSPAPERS Omni Properties, LLC 35 Forest Ridge Road 200 Baker Ave.Suite 303 Concord, MA 01742 GateHouse Media New England Concord, MA 01742 978-287-7900 WICKED LOCAL 978-369-4884 www.minutemanarc.org P.O. Box 9191 www.omniproperties.com Concord, MA 01742 Westford Community Access 978-371-5723 Patricia Sutherland Connolly with Television, Inc. Keller Williams Realty – Boston 487 Groton Road, Suite B The Homesteader Northwest  Westford, MA 01886 PO Box 1072 (see pgs. 25,36) 978-692-7152 Acton, MA 01720 200 Baker Avenue www.westfordcat.org 978-461-0028 Suite 205 www.TheHomesteader.biz Concord, MA 01742 PAYROLL SERVICES 978-369-5775 REAL ESTATE & DEVELOPMENT www.SutherlandRealtyGroup.com Payright Payroll Services, Inc. 468 Great Road Acton Real Estate Company (see pg. 17) Spound Development Associates, LP Acton, MA 01720 978-263-5004 525 Massachusetts Avenue 238 Littleton Rd www.payrightpayroll.com Acton, MA 01720 Westford, MA 01886 PEST CONTROL 978-263-1166 978-692-0710 Locke’s Pest Control P.O. Box 1100 www.acton-realestate.com Concord, MA 01742 978-369-3802 RESTAURANTS / CATERING / www.lockespestcontrol.com Artisan Realty Group EVENTS PET SERVICES, SITTING & SUPPLIES 100 Main Street 2nd Floor, Suite 11 Acton Critter Sitters Maynard, MA 01754 110 Grill  14 Stow Street Acton, MA 01720 (see pg. 9) 978-263-6578 Avery and Associates 116 Chelmsford Street  Especially For Pets 444 Great Road 282 Central Street Chelmsford , MA 01824 Acton, MA 01720 (617) 964-0453 x22 Acton, MA 01720 978-256-2777 www.especiallyforpets.com 978-263-5002 110grill.com Betsy Purcell with Keller Williams Atlantic Sea Grill & Fish Market  Realty – Boston Northwest (see pg. 19) (see pg. 5) 200 Baker Avenue, Suite 205 77 Great Road Concord, MA 01742 Acton, MA 01720 978-758-7414 978-263-3162 www.betsypurcell.com Bueno Y Sano Coldwell Residential Brokerage 263 Main Street 97 Great Road Acton, MA 01720 Acton, MA 01720 978-263-9200 978-263-3303 www.buenoysano.com www.newenglandmoves.com Middlesex West Chamber of Commerce ~ 978-263-0010 45

MIDDLESEX WEST CHAMBER MEMBER DIRECTORY Unless indicated otherwise, all towns are Acton, MA 01720 Burtons Grill & Bar  A Spa For You Sprint Nexgen Wireless LLC (see pg. 21) 434 Littleton Road 701 Constitution Ave One Cornerstone Square Westford, MA 01886 Littleton, MA 01460 Westford, MA 01886 978-486-8900 978-203-9070 978-692-1220 www.aspaforyouusa.com www.burtonsgrill.com Westford Xfinity Store - Comcast Margo’s Hair Design & Margo’s Too 6B Cornerstone Square Evviva Cucina 253 Arlington Street Westford, MA 01886 7 Cornerstone Square Acton, MA 01720 800-934-6489 Westford, MA 01886 978-263-7836 978-692-9050 www.margosdesign.com TRAVEL AGENCY / CRUISE evvivacucina.com SPECIALIST Mary Kay Cosmetics EWhitney Events LLC 5 Phillips Drive CruiseOne 149 Arlington Street Westford, MA 01886 85 Strawberry Hill Road Acton, MA 01720 978-692-3418 Acton, MA 01720 617-633-1862 978-263-2600 SOFTWARE DEVELOPMENT / www.cruiseone.com/dbennett McDonald’s of Acton (see pg. 3) ECOMMERCE 55 Great Road Vacation with the Magic, LLC Acton, MA 01720 Allegro Software Development 315-A Central Street 978-440-7251 1740 Massachusetts Avenue Acton, MA 01720 www.mcstate.com/31731 Boxborough, MA 01719 978-263-5854 978-264-6600 www.vacationwiththemagic.net Not Your Average Joe’s www.allegrosoft.com 305 Main St. TREE & LANDSCAPE SERVICE Acton, MA 01720 Netscout Systems, Inc. 978-635-0101 310 Littleton Road Axe Brothers Tree Service Westford, MA 01886 P.O. Box 2782 Rapscallion Table & Tap 978-614-4333 Acton, MA 01720 5 Strawberry Hill Road www.netscout.com 978-263-9961 Acton, MA 01720 617-869-5701 WatchRx WASTE MANAGEMENT 10 Barker Road The Curry House (see pg. 38) Acton, MA 01720 Mr. Trashman (see pg. 34) 313 Littleton Road #12 978-263-7788 100 Powdermill Road Chelmsford, MA 01824 www.amethystsoft.com Suite 248 617-257-0083 Acton 01720 www.thecurryhouse.biz STORAGE / PACKAGING & 508-278-6910 SHIPPING www.mrtrashman.com True West Brewery 525 Massachusetts Avenue, #107 Chelmsford Storage Solutions WINE & SPIRITS Acton, MA 01720 296 Littleton Road 978-206-1600 Chelmsford, MA 01824 Aaronap Cellars (see pg. 5) 978-256-1800 28 Carlisle Road RETAIL www.chelmsfordstoragesolutions.com Westford, MA 01886 617-401-5535 Acton Ace Hardware M. Moreau & Sons Trucking,Inc. 210 Main Street 16 Marble Farm Road Colonial Spirits (see pg. 22) Acton, MA 01720 Maynard, MA 01754 87 Great Road 978-263-7754 978-897-4981 Acton, MA 01720 978-263-7775 Boston Bijoux Inc. Maynard Storage Solutions www.ColonialSpirits.com 342 Great Road 109 Powder Mill Road Littleton Liquors, LLC (see pg. 31) 320 Great Road Acton, MA 01720 Maynard, MA 01754 Littleton, MA 01460 978-486-3200 978-264-0216 978-298-5096 YOGA INSTRUCTION www.bostonbijoux.com Tranquility Yoga The UPS Store #0286 235 Littleton Rd unit 1 Westford, MA 01886 The Three Trolls, Inc. 100 Powder Mill Road 978-729-4731 www.westfordyoga.com 7 Summer Street, #16 Acton, MA 01720 Chelmsford, MA 01824 978-897-4800 978-250-0566 www.theupsstore.com www.3trolls.com TELECOMMUNICATIONS / VIDEO SALON & SPAS / HAIR, NAILS, SKIN SURVEILLANCE 1 on 1 Self Indulgence Spa & Sanctuary  Palia Corporation dba IM Wireless (see pgs. 11,15) (Verizon Wireless) 457 Great Road 117 Great Road Acton, MA 01720 Stow, MA 01775 978-266-1800 978-637-2626 www.1on1si.com www.imwireless.net 46 www.mwcoc.com

Read about us on page 26 EXEPXEPRETRITS EI S E MinimaMlliynimnvaalslyivienvkanseiveeskunregersieusr.geries. High-rHiskighp-rreigsknapnrceygncanrec.y care. SophisStiocpahteisdtidcaiatgendodsitaicgnimosatgicinigm. aging. WeighWt loeisgshstulrogsesrsyu. rgery. And thAencdotmhefocrot moffoarftrioefnadlfyrisemndilley. smile. emersoenmhoesrpsoitnalh.orsgpital.orgJoin ourJooinlionuercoonmlimneunciotymomnunFiatcyeobnooFka,cTewbiottoekr,TawnditYteoruTaunbdeYouTube Middlesex West Chamber of Commerce ~ 978-263-0010 47

Acton • Boxborough • Carlisle Concord • Littleton • Stow Since 1923 î Visiting Nurses î Physical Therapy Acton Nursing Services î Occupational Therapy is dedicated to fostering î Speech Therapy individual and community î Medical Social Services health in the Acton area. î Home Health Aides We offer a full-range of Medicare-Certified Home Health (VNA) services to help people safely age in place. 978-929-6650 P • 978-929-6341 F 12/8/16 3:02 PM www.actonnursingservices.com Read about us on page 16 ans034_v1_middlesexcoc_1216.indd 1 P-S BERUBE Construction DESIGN • BUILD Fine Quality Additions & Remodeling FULLY INSURED TALK TO US ABOUT YOUR IDEAS H.I.C. #166703 CSL #792 Aging-In-Place Certified Builder 978-597-2020 psberubeconst.com | info@ psberubeconst.com