2023 Catalogue EUR PA Type 2 Devices for TN-C-S Earthing Systems Type 1&2 Devices for TN-S Earthing Systems Separate devices New required for live Range and neutral Suitable for TN-C-S (PME) earthing systems Suitable for TN-S earthing systems. For all lightning protection systems (LPS) with lightning protection levels, (LPL) up to 100kA or for an overhead supply line. Protects against surges and from direct lightning strikes Part Number Description Part Number Description 954405 4 Mod Type 1&2 Three Phase TN-S + c/o 952070 1 Mod. Type 2 Single Phase TN-C-S contact 952090 1 Mod. Type 2 Single Phase TN-C-S* Type 1&2 Devices for TN Earthing Systems * + Monitoring Contacts Compact Type 2 Devices for TT/TN Earthing Systems New Range Suitable for TN earthing systems. For all lightning protection systems (LPS) with lightning protection levels, (LPL) up to 50kA or for an overhead supply line. Protects against surges and from direct lightning strikes Part Number Description Suitable for all earthing systems TT, TN-S & TN-C-S (PME) 954205 2 Mod Type 1&2 Single Phase TN + c/o contact Part Number Description Type 1&2 Devices for TT/TN Earthing System 900450 1 Mod. Type 2 Single Phase TT/TN 900455 2 Mod.Type 2 Three Phase TT/TN SAumrgeeriPcraonteFcutsieosn Type 3 Devices for all Earthing Systems New Range Suitable for all earthing systems TT, TN-S & TN-C-S (PME), For all lightning protection systems (LPS) with lightning protection levels, (LPL) up to 50kA or for an overhead supply line. Protects against surges and from direct lightning strikes Part Number Description 954115 2 Mod Type 1&2 Single Phase TT/TN + c/o contact Part Number Description Type 1&2 Devices for TT/TN-S Earthing System 924396 Flush Mount Type 3 Single Phase + Buzzer New 953200 1 Mod. Type 3 Single Phase 25A Range 953205 1 Mod. Type 3 Single Phase 25A* 953228 1 Module Type 3 Single Phase 32A Suitable for TT and TN-S earthing systems. For all lightning protection 953229 1 Module Type 3 Single Phase 32A* systems (LPS) with lightning protection levels, (LPL) up to 100kA or for 953010 Type 3 Spare Plug Single Phase an overhead supply line. Protects against surges and from direct 953400 2 Module Type 3 Three Phase 25A lightning strikes 953405 2 Module Type 3 Three Phase 25A* * + Monitoring Contacts Part Number Description 954315 4 Mod Type 1&2 Three Phase TT/TN-S + c/o contact sales@europa-plc.com technical@europa-plc.com 49
EUR PA 2023 Catalogue Plugs & Sockets • High Reliability IP44 Surface Sockets • High Quality Housing • IEC 60309 • Op. Temp: -25°C to 40°C PG21 Cable Entry • Easy Installation • Long Life IP44 Industrial Plugs Part Number Voltage Amps No. of Poles Part Number Voltage Amps No. of Poles IP163F 110V 16A 2P + E ISS163F 110V 16A 2P + E IP323F 110V 32A 2P + E ISS323F 110V 32A 2P + E IP163P 230V 16A 3P + E ISS163P 230V 16A 3P + E IP323P 230V 32A ISS323P 230V 32A IP633P 230V 63A 3P + N + E ISS633P 230V 63A 3P + N + E IP164N 415V 16A ISS164N 415V 16A IP324N 415V 32A ISS324N 415V 32A IP634N 415V 63A ISS634N 415V 63A IP165N 415V 16A ISS165N 415V 16A IP325N 415V 32A ISS325N 415V 32A IP635N 415V 63A ISS635N 415V 63A IP44 Panel Sockets IP44 In-line Sockets Part Number Voltage Amps No. of Poles IPS163F 110V 16A 2P + E PSluApgepscpi&lfiiccSaoFtuicoksneests IPS323F 110V 32A 2P + E IPS163P 230V 16A 3P + E IPS323P 230V 32A IPS633P 230V 63A 3P + N + E IPS164N 415V 16A IPS324N 415V 32A IPS634N 415V 63A IPS165N 415V 16A IPS325N 415V 32A IPS635N 415V 63A Part Number Voltage Amps No. of Poles IP44 Outlet Splitter IS163F 110V 16A 2P + E IS323F 110V 32A 2P + E Part Number Voltage Amps No. of Ways ISP2163F 110V 16A 2 Way IS163P 230V 16A 3P + E ISP2163P 230V 16A IS323P 230V 32A 3 Way IS633P 230V 63A 3P + N + E ISP3163F 110V 16A ISP3163P 230V 16A IS164N 415V 16A IS324N 415V 32A IS634N 415V 63A IS165N 415V 16A IS325N 415V 32A IS635N 415V 63A 50 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA IP44 Angled Panel Mount Socket IP67 Industrial Plugs Part Number Voltage Amps No. of Poles Part Number Voltage Amps No. of Poles IPSA163F 110V 16A 2P + E IPW163F 110V 16A 2P + E IPSA323F 110V 32A 2P + E IPW323F 110V 32A 2P + E 3P + E IPSA163P 230V 16A IPW163P 230V 16A 3P + E IPSA323P 230V 32A 3P + N + E IPW323P 230V 32A IPW633P 230V 63A 3P + N + E IPSA164N 415V 16A IPW1253P 230V 125A IPSA324N 415V 32A IPW164N 415V 16A IPSA165N 415V 16A IPW324N 415V 32A No. of Poles IPSA325N 415V 32A IPW634N 415V 63A 2P + E IPW1254N 415V 125A 2P + E IP44 Appliance Inlet IPW165N 415V 16A 3P + E PG21 Cable Entry IPW325N 415V 32A 3P + N + E IPW635N 415V 63A 3P + N + E IPW1255N 415V 125A 3P + N + E IP67 In-line Sockets 51 Part Number Voltage Amps No. of Poles Part Number Voltage Amps PSluApgepscpi&lfiiccSaoFtuicoksneests IAP163F 110V 16A 2P + E ISW163F 110V 16A IAP323F 110V 32A 2P + E ISW323F 110V 32A IAP163P 230V 16A 3P + E ISW163P 230V 16A IAP323P 230V 32A 3P + N + E ISW323P 230V 32A ISW633P 230V 63A IAP164N 400V 16A ISW1253P 230V 125A IAP324N 400V 32A ISW164N 415V 16A IAP165N 400V 16A ISW324N 415V 32A IAP325N 400V 32A ISW634N 415V 63A ISW1254N 415V 125A IP44 Panel Mount Appliance Inlet ISW165N 415V 16A Part Number Voltage Amps No. of Poles ISW325N 415V 32A IAPP163F 110V 16A 2P + E ISW635N 415V 63A IAPP323F 110V 32A 2P + E ISW1255N 415V 125A 3P + E IAPP163P 230V 16A IAPP323P 230V 32A 3P + N + E IAPP164N 415V 16A IAPP324N 415V 32A IAPP165N 415V 16A IAPP325N 415V 32A sales@europa-plc.com technical@europa-plc.com
EUR PA 2023 Catalogue IP67 Surface Sockets IP67 Outlet Splitters Complete with cable gland PG21 Part Number Voltage Amps No. of Poles ISSW163F 110V 16A 2P + E ISSW323F 110V 32A Part Number Voltage Amps No. of Poles PG42 PG21 ISSW163P 230V 16A 2P + E ISPW2163F 110V 16A 2P + E ISSW323P 230V 32A ISPW2323F 110V 32A 2P + E ISSW633P 230V 63A 3P + E ISSW1253P 230V 125A ISPW2163P 230V 16A ISPW2323P 230V 32A 3P + N + E PG42 M40 PG21 PG42 PG21 ISSW164N 415V 16A 3P + E 2P + E ISSW324N 415V 32A ISPW2164N 415V 16A 2P + E ISSW634N 415V 63A ISPW2324N 415V 32A 3P + E ISSW1254N 415V 125A ISPW2165N 415V 16A 3P + N + E ISSW165N 415V 16A 3P + N + E ISPW2325N 415V 32A ISSW325N 415V 32A ISSW635N 415V 63A ISPW3163F 110V 16A ISSW1255N 415V ISPW3323F 110V 32A 125A ISPW3163P 230V 16A IP67 Panel Sockets ISPW3323P 230V 32A PSluApgepscpi&lfiiccSaoFtuicoksneests ISPW3164N 415V 16A ISPW3324N 415V 32A ISPW3165N 415V 16A ISPW3325N 415V 32A Part Number Voltage Amps No. of Poles Delivery Options IPSW163F 110V 16A 2P + E IPSW323F 110V 32A 2P + E Rates available on our website * IPSW163P 230V 16A 3P + E Standard Delivery IPSW323P 230V 32A (Usually 1 - 2 Days) IPSW633P 230V 63A 3P + N + E IPSW1253P 230V 125A Next Day Delivery (Pre 10AM*) IPSW164N 415V 16A IPSW324N 415V 32A Saturday AM Delivery IPSW634N 415V 63A IPSW1254N 415V 125A No Surcharge for Direct to Site IPSW165N 415V 16A *Pricing available on request for delivery to the IPSW325N 415V 32A Channel Islands, Scottish Islands, Isle of Man and IPSW635N 415V 63A Countries outside the UK. IPSW1255N 415V 125A 52 Sales: 01582 692 440 Technical: 01582 692 444
steel screws. individual version and 11 in the double version. 2023 Catalogue HATCH PUSH-THROUGH ENTRIES PA Available with blind Up to 4 push-through M25 lid or transparent hatch. and M32 entries in the SPIRIT LEVEL individual version and 5 in Flush-mounted to speed up and simplify installation. EURthe double version. CONNECTABLE MODULES Boards can be perfectly connected by means of inserts. VERSATILE HOUSING IK 08 Built in technical Configurable SwitchedFor Key Block interlocked polymer with high sockets and both domestic shock resistance. and industrial reduced flange sockets. Interlocked SocketsPROTECTION LEVEL EASY ASSEMBLY HINGE SYSTEM Available with protection Thanks to the design IP65 level IP65. Holds the interlock fast The socket The installer allowing for easy screwdriver use. duringAwtiritnag,cmhakintghite qiunickteer arnldoecaskieer. d can now work will safely socket to the rest, leaning on wiring the • Choose Your Enclosure socket safely, enclosure via forwards, NEW HINGE SYSTEM the 2 screws exposing the quickly and • Choose Your Interlocked Sockets The Hands Free System is the new hinge at the bottom wires hassle free system that makes socket assembly quick 123 and easy. Simply fix the two lower ends of the • Choose Your RCCB Devices socket with 1-2 turns of the screws and The spirit level allows easy installation to the socket will automatically turn forwards, Themsockaetkweill tusrun reThtehopeeraetorn, wcithlosure is upright and fifoxrewdmatrodstoh, eruebmonaairntdine. gd wfcreioree hrtharenedcsac,bclteaslny allowing the operator to have both hands Fix the interlocked socket at the two quickly and easily. free and quickly and simply wire the lower ends with 1-2 turns of the screws. cables. Subsequently, simply complete fixing of the upper and lower screws to lock the socket into place. See our full range of RCCBS Using the correct attachments these f o r o u r s o c k e t e n c l o s u rSePIsRIT LEVEL enclosures can be ganged together VERSATILE ANDaMlloOwDUinLgARa bespoke combination of boards on Page 42 Specific inserts (supplied) can be click-fitted behind the product, allowing for the perfect combination Wof bitoahrdst, thheerebay elxutenmdinignthieuwmork key removed, the csournfacterhoomlogleenovueslyrascreaqnuirned.ot be operated Empty Industrial Socket Enclosure (IP65) Interlocked Sockets (IP67) Range PSluApgepscpi&lfiiccSaoFtuicoksneests Extended Manufactured from self-extinguishing & shock resistant thermoplastic / IEC EN 60309-2 Four cable inlets: M25 / M32 top, bottom and side entry (IK08) Compact size / Manufactured from self-extinguishing & shock resistant Inox screws resist chemical agents / Accepts IP67 Plugs / Compact size thermoplastic (IK08) Includes spirit level to make installation easier Part Number Voltage Amps No. of Poles Part Number Description 73240-3531A 230V 16A 2P+E 73260-3531A 230V 32A 74175-3531G IP65 Single Socket Back Box w/ Din Rail & Window 74176-3531A IP65 Double Socket Back Box 73244-3531A 400V 16A w/ Din Rail & Window 73264-3531A 400V 32A 3P+E 74184-3531A Triple Socket Back Box W/ Din Rail & Window 74189-3531A Blank Flange for Fanton Socket Enclosure 73245-3531A 400V 16A 3P + N + E 73265-3531A 400V 32A 73992-3531A Spare Keys 73990-3531A Key Block Wall Case 73999-3531A Spare Lid for Single Back Boxes sales@europa-plc.com technical@europa-plc.com 53
EUR PA 2023 Catalogue Switched Interlocked Sockets Switched Interlocked Sockets with key (IP67) Compact size / Manufactured from self-extinguishing & shock resistant thermoplastic / Two cable inlets M25 / M32 one top and bottom / Inox screws resist chemical agents. Part Number Voltage Amps No. Of Poles Complete with 30mA RCCB or RCBO pre-fitted / Manufactured from self- SISW163FF 110V 16A 2P + E extinguishing & shock resistant thermoplastic / Four cable inlets: M25 / M32 top, bottom and side entry / Inox screws resist chemical agents / SISW323FF 110V 32A 2P + E Accepts IP67 plugs / Compact size / Interlock mechanism prevents plugs from being pulled out in the ON position SISW163PF 230V 16A 2P + E SISW323PF 230V 32A 2P + E Switched Interlocked Sockets (RCBO Protected) (IP65) SISW164VF 400V 16A 3P + E SISW324VF 400V 32A 3P + E Part Number Voltage Amps Device Fitted SISRCBOAW163P 230V 230V 16A 16A 30mA 2P Type SISW165VF 400V 16A 3P + N + E SISRCBOAW323P A RCBO SISW325VF 400V 32A 3P + N + E 73992-3531A 32A 32A 30mA 2P Type Weatherproof Switched Interlocked Sockets (IP67) A RCBO Spare Key Switched Interlocked Sockets (Type A RCCB Protected) (IP65) Part Number Voltage Amps Device Fitted SISRAW163F 110V SISRAW323F 110V 16A 25A Type A, 30mA, 2P RCCB SISRAW163P SISRAW323P 32A 40A Type A, 30mA, 2P Polycarbonate enclosure / 3 x M25 + 1 x M32 cable entries 3 x M25 SISRAW633P RCCB blanking plugs + 1 x M32 cable gland included / Quick turn screws reduce installation time / Padlockable in the OFF position SISRAW164V PSluApgepscpi&lfiiccSaoFtuicoksneests SISRAW324V 25A Type A, 30mA, 2P Part Number Voltage Amps No. Of Poles SISRAW634V RCCB 230V 16A SISW163F 110V 16A 2P + E SISRAW165V 230V SISRAW325V 230V 32A 40A Type A, 30mA, 2P SISW323F 110V 32A 2P + E SISRAW635V RCCB SISW163P 230V 16A 2P + E 63A 80A Type A, 30mA, 2P SISW323P 230V 32A 2P + E RCCB SISW633P 230V 63A 2P + E 400V 16A 25A Type A, 30mA, 3P SISW1253P 230V 125A 2P + E 400V RCCB 400V 32A 40A Type A, 30mA, 3P SISW164N 415V 16A 3P + E RCCB SISW324N 415V 32A 3P + E SISW634N 415V 63A 3P + E 63A 80A Type A, 30mA, 3P SISW1254N 415V 125A 3P + E RCCB 400V 16A 25A Type A, 30mA, 4P SISW165N 415V 16A 3P + N + E 400V RCCB SISW325N 415V 32A 3P + N + E 400V SISW635N 415V 63A 3P + N + E 32A 40A Type A, 30mA, 4P SISW1255N 415V 125A 3P + N + E RCCB 63A 80A Type A, 30mA, 4P RCCB 54 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Horizontal Interlocked Sockets (IP44) 13A RCD Spur Outlets BS7288 30mA trip / Test facility / ON/OFF indicator / Rated voltage 240V, 50Hz Rated current 13A / Trip time less than 40mS / Mechanically latching (Passive) / Spur will not trip in the event of a power failure Part Number Voltage Amps No. Of Poles Part Number Description SISH163F 110V 16A 2P + E RCDFSPA Plastic Type A 13A Single Spur Outlet SISH323F 110V 32A 2P + E RCDFSPMCA Metal Clad Type A RCD 13A Spur Outlet SISH163P 230V 16A 2P + E Insulated Socket Enclosures (IP55) SISH323P 230V 32A 2P + E SISH164N 400V 16A 3P + E SISH324N 400V 32A 3P + E SISH165N 400V 16A 3P + N + E SISH325N 400V 32A 3P + N + E RCD Sockets and Enclosures Europa 13A RCD safety sockets provide added protection against the risk of electric shock. The sockets are simple to install, fitting standard socket outlet boxes for surface or flush mounting. 13A RCD Sockets Accommodates standard socket, spur, switches and RCDs / 20mm cable entries located top, bottom, side and back / Grey enclosure / Corrosion 5 resistant / Padlockable for added security (1 padlock). The ECWSK1 3 & SK2 have an improved design to accommodate most styles of 13A sockets and moulded plugs. Part Number Description ECWSK1 1 Gang Socket Enclosure ECWSK2 2 Gang Socket Enclosure PSluApgepscpi&lfiiccSaoFtuicoksneests ECWSK21 2 x 1 Gang Socket Enclosure Socket Adaptors 4 21 13A Socket Adaptors BS7288 1 Trip current 30mA / Trip speed: 40mS / ON/OFF indicator / Test facility Mechanically latching (Passive) Sockets will not trip in the event of a power failure Part Number Description 1 RCD13A1GSA Plastic RCD Type A 13A 2 Single Socket Unswitched 2 RCD13AP1GSA Plastic RCD Type A 13A Single Socket Switched 3 RCD13ASSA Plastic RCD Type A 13A Ideal for caravans, campsites, generators and distribution equipment. Double Socket Switched Includes a spring-return lid on the socket for additional protection. 4 RCD13AMC1GSA Metal Clad RCD Type A 13A Part Number Description Single Socket Switched IP44 16A to 13A Adaptor Socket Metal Clad RCD Type A 13A Double 1 IPA163P13A Socket Switched 5 RCD13AMCA 2 IPS133P IP54 13A 3-Pin Panel Socket sales@europa-plc.com technical@europa-plc.com 55
EUR PA 2023 Catalogue Caravan Hook Ups Caravan Hook Ups Benefits • Compact size • Includes spirit level Configurable • Fully compliant Range • Durable • Configurable • Aesthetic uniformity • Available from stock Features • Accepts IP67 plugs • RCCB conforms to BS EN 61008 • RCBO conforms to BS EN 61009 • Interlocked Socket conforms to IEC EN 60309-2 • Self-extinguishing & shock resistant thermoplastic • Cable inlets: M25 / M32 top, bottom & side entry • Inox screws resist chemical agents PSluApgepscpi&lfiiccSaoFtuicoksneests Contact Sales for Technical: 01582 692 444 • Your application | site requirements • Part numbers • Lead times • Pricing 56 Sales: 01582 692 440
2023 Catalogue EUR PA New ULISSE | Keybox Range Distribution Boards Flexible Modular Build Systems Choose the enclosure, devices and sockets to suit your application requirement 1 Step 1 Enclosure 10kA, C Curve MCBs 30mA RCDs 100A Mainswitch Selection 25A, 40A, 63A, 100A 2 POLE + 4 POLE 2 16A, 32A, 63A, 100A Step 2 Device Sockets Selection Straight and angled flush mounting Argo sockets Step 3 Socket 3 Key lock interlocked sockets (fuse and non-fused options) Selection POLIFEMO | Site Distribution Boards Contact us for your 1 MIDI MAXI specific requirements PSluApgepscpi&lfiiccSaoFtuicoksneests 574 x 750 x 430mm Custom single / multiple socket 743 x 770 x 430mm solutions available 2 10kA, C Curve MCBs 30mA RCDs 100A Mainswitch 16A, 32A, 63A, 100A 25A, 40A, 63A, 100A 2 POLE + 4 POLE Sockets Interlocked Sockets 3 Choice of 32A | 63A fixed plug 16A | 32A | 63A | 240V | 415V kW Power Ratings: 12 | 15 | 18 | 21 | 30 | 35 | 55 2P + E | 3P + E | 3P + N + E sales@europa-plc.com i Scan the QR code for all configurations 57 technical@europa-plc.com
EUR PA 2023 Catalogue Motor Starters & Control Gear Direct On Line Motor Starters Overload relays must be ordered separately (Page 67). The overload Overload relays must be ordered separately (Page 67). The overload relay setting must not exceed the contactor rating relay setting must not exceed the contactor rating. Metal Clad DOL’s will accept the range of TA8 side mounting auxiliaries (Page 68). ABS Enclosure 2 Button 110V DOL (IP65) Metal Enclosure 2 Button 240V DOL (IP54) Part Number Description Part Number Description LE1-D123F7 12A 5.5kW 110V AC Coil BE1-T1235U7 12A 5.5kW 240V AC Coil LE1-D253F7 25A 11kW 110V AC Coil BE1-T2535U7 25A 11kW 240V AC Coil BE1-T3235U7 32A 15KW 240V AC Coil* ABS Enclosure 2 Button 240V DOL (IP65) Part Number Description Metal Enclosure 2 Button 415V DOL (IP54) LE1-D123U7 12A 5.5kW 240V AC Coil LE1-D253U7 25A 11kW 240V AC Coil Part Number Description BE1-T1235N7 12A 5.5kW 415V AC Coil BE1-T2535N7 25A 11kW 415V AC Coil ABS Enclosure 2 Button 415V DOL (IP65) BE1-T3235N7 32A 15KW 415V AC Coil* Part Number Description *Use TR2-D32353 Overload Relay Only LE1-D123N7 12A 5.5kW 415V AC Coil LE1-D253N7 25A 11kW 415V AC Coil ABS & Metal Clad DOL Starter Dimensions (mm) MoCtoornIStnrtdoaerl txGeersarand Measurements ABS A B S Metal Clad Metal Clad 12A 25A 12A 25 - 32A a 120 135 116 135 b 140 155 128 147 c 166 185 214 252 d 150 165 134 162 e 88 101 123 156 58 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA EUR PA Reversing Starters Safe Start Metal Clad Reversing Starters (IP54) Direct On Line Motor Starters With Isolator With or without isolator / 5.5 & 11kW starter ratings Compact design / Cover: RAL 7035 / Base: RAL 7012 Standard coil voltages: 230V or 415V 50/60Hz Suitable for 3 phase motors only The Europa Safe Start direct on line motor starter (DOL) is designed Overload Relays must be ordered separately (Page 67). The overload to switch a single or three phase induction motor at rated voltage; it relay setting must not exceed the contactor rating comprises of a 3P + Sw. neutral isolator (Padlockable in the OFF position), steel enclosure, contactor, start contact, link wires and Part Number Description stop / start buttons. MS-DOLRS5.5P7MC 12A 5.5kW 230V AC Coil Various factors should be considered when selecting the correct DOL. MS-DOLRS5.5N7MC 12A 5.5kW 415V AC Coil The size of unit is dictated by the motor that is being supplied. MS-DOLRS11P7MC 25A 11kW 230V AC Coil Lid: RAL 7035 / Base: RAL 7012 MS-DOLRS11N7MC 25A 11kW 415V AC Coil MS-DOLRS5.5P7ISOMC Reversing Starter + ISO Europa Safe Start DOL’s with isolator will accept the range of TA8 side 12A 5.5kW 230V AC Coil mounting auxiliaries (Page 67). MS-DOLRS5.5N7ISOMC Reversing Starter + ISO 12A 5.5kW 415V AC Coil Please Note: Overload relays must be ordered separately (Page 67). MS-DOLRS11P7ISOMC Reversing Starter + ISO NB: The overload relay setting must not exceed the contactor rating 25A 11kW 230V AC Coil MS-DOLRS11N7ISOMC Reversing Starter + ISO Metal Enclosed 2 Button 240V DOL + Isolator (IP54) 25A 11kW 415V AC Coil Part Number Description BE2-D123U7 12A 5.5kW 240V AC Coil BE2-D253U7 25A 11kW 240V AC Coil Metal Enclosed 2 Button 415V DOL + Isolator (IP54) Part Number Description PC & Metal Clad DOL Starter Dimensions (mm) MoCtoornIStnrtdoarel txGeersarand BE2-D123N7 12A 5.5kW 415V AC Coil BE2-D253N7 25A 11kW 415V AC Coil Type Height Width Depth Depth (mm) (mm) (mm) (Inc Switch) (mm) Without Isolator 250 180 165 - With Isolator 240 310 165 200 sales@europa-plc.com technical@europa-plc.com 59
EUR PA 2023 Catalogue Compact Star Delta Starters Star Delta Starters in Metal Enclosure Metal Clad Compact Star Delta Starters (IP54) Star Delta Starters in Metal Enclosure (IP65) Compact design Epoxy coated strong steel enclosure / RAL 7035 11, 15 & 22kW starter ratings Supplied complete with overload relay & with internal wiring Cover: RAL 7035 / Base: RAL 7012 terminated to the terminal block. Standard coil voltages: 230V or 415V 50/60Hz Please Note: Overload relays must be ordered separately (Page 67) Part Number Description NB: Overload relay based on 58% of motors full load current (FLC). SDS11EIP7 11kW 230V Coil (with Isolator) TR2-D18321 Overload 12 - 18A Part Number Description SDS11EIN7 11kW 415V Coil (with Isolator) TR2-D18321 Overload 12 - 18A MS-SDS11P7MC 11kW 230V AC Coil SDS15EIP7 15kW 230V Coil (with Isolator) TR2-D18321 Overload 12 - 18A MS-SDS11N7MC 11kW 415V AC Coil 15kW 415V Coil (with Isolator) TR2-D18321 SDS15EIN7 Overload 12 - 18A MS-SDS15P7MC 15kW 230V AC Coil 22kW 230V Coil (with Isolator) TR2-D25322 Overload 17 - 25A SDS22EIP7 MS-SDS15N7MC 15kW 415V AC Coil 22kW 415V Coil (with Isolator) TR2-D25322 Overload 17 - 25A SDS22EIN7 MS-SDS22P7MC 22kW 230V AC Coil 30kW 230V Coil (with Isolator) TR2-D40355 Overload 30 - 40A MS-SDS22N7MC 22kW 415V AC Coil SDS30EIP7 SDS + ISO 11kW SDS30EIN7 30kW 415V Coil (with Isolator) TR2-D40355 230V AC Coil Overload 30 - 40A MS-SDS11P7ISOMC 37kW 230V Coil (with Isolator) TR2-D40355 SDS37EIP7 Overload 30 - 40A MS-SDS11N7ISOMC SDS + ISO 11kW SDS37EIN7 37kW 415V Coil (with Isolator) TR2-D40355 415V AC Coil Overload 30 - 40A MS-SDS15P7ISOMC SDS + ISO 15kW SDS45EIP7 45kW 230V Coil (with Isolator) TR2-D65357 230V AC Coil Overload 37 - 50A SDS45EIN7 45kW 415V Coil (with Isolator) TR2-D65357 Overload 37 - 50A SDS + ISO 15kW MS-SDS15N7ISOMC 415V AC Coil SDS55EIP7 55kW 230V Coil (with Isolator) TR2-D65357 Overload 48 - 65A MoCtoornIStnrtdoaerl txGeersarand MS-SDS22P7ISOMC SDS + ISO 22kW SDS55EIN7 55kW 415V Coil (with Isolator) TR2-D65357 230V AC Coil Overload 48 - 65A MS-SDS22N7ISOMC SDS + ISO 22kW NB: Europa star delta starters are built using industry proven quality 415V AC Coil components to guarantee the safety and protection you need for your applications. Metal Clad Compact Star Delta Starter Dimensions (mm) Star Delta Starter Dimensions (mm) kW Rating Height Width Depth 300 200 Type Height Width Depth Depth 11kW (Inc Switch) 400 15kW 400 500 - Without Isolator 240mm 310mm 165mm 22kW 30kW 37kW 600 45kW With Isolator 240mm 310mm 165mm 200mm 55kW 60 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Star Delta Starter Thermal Overload Selection Chart Manual Motor Starter Accessories Overload based on 58% of FLC. Please consult the motor manufacturer for Full MMS Range Accessories Load Current (FLC) or from the motor rating plate 1 Thermal Overload Part Relay Range Motor Rating 3 Number 400V/3PH AC-3 4 kW Hp TR2-D09306 1.0 to 1.6 1.1 1.5 TR2-D09307 1.6 to 2.5 1.5 2.0 TR2-D09307 1.6 to 2.5 1.8 2.5 TR2-D09308 2.5 to 4.0 2.2 3.0 TR2-D09308 2.5 to 4.0 3.0 4.0 TR2-D09310 4.0 to 6.0 3.7 5.0 2 TR2-D09310 4.0 to 6.0 4.0 5.5 Description IP55 enclosure for MMS TR2-D09312 5.5 to 8.0 5.5 7.5 0.1 - 32A Auxiliary contact TR2-D09314 7.0 to 10.0 7.5 10.0 Part Number 1N/O + 1N/C (Top Mount) Auxiliary contact TR2-D18321 12.0 to 18.0 11.0 15.0 1 MMSENC 2 N/O (Top Mount) 2 MMSAUXAE11 Auxiliary Contact TR2-D18321 12.0 to 18.0 15.0 20.0 1N/O + 1N/C (Side Mount) MMSAUXAE20 Auxiliary Contact TR2-D25322 17.0 to 25.0 22.0 30.0 2N/O (Side Mount) 3 MMSAUX11SM DOL Manual Motor Starters Under voltage trip 24V MMSAUX20SM MMS Range up to 32A 15kW Under voltage trip 110V 4 MMSU24 Under voltage trip 220-240V MMSU110 MMSU240 Under voltage trip 380-415V MMSU415 Main application: Thermal and short circuit protection of AC electric Part Number Setting Range (A) Operating Current of motors with power up to 15kW (380 / 440V) 32A, it can also be used as Short-Circuit Release (A) MMS-016S 0.10 - 0.16A a main switch. Simple snap fitting on 35mm din rail. MMS-025S 0.16 - 0.25A 1.9 MMS-04S 0.25 - 0.40A 2.6 Part Number Description MMS-063S 0.40 - 0.63A 4.4 MMS-1S 0.63 - 1.00A 8 MMS-016S 0.10 - 0.16A MMS-1.6S 1.00 - 1.60A 11 MMS-2.5S 1.60 - 2.50A 19 MMS-025S 0.16 - 0.25A MMS-4S 2.50 - 4.00A 30 MMS-6.3S 4.00 - 6.30A 42 MMS-04S 0.25 - 0.40A MMS-10S 6.00 - 10.00A 69 MMS-14S 9.00 - 14.00A 110 MMS-063S 0.40 - 0.63A MMS-18S 13.00 - 18.00A 210 MMS-23S 17.00 - 23.00A 210 MMS-1S 0.63 - 1.00A MMS-25S 20.00 - 25.00A 220 MMS-32S 24.00 - 32.00A 330 MMS-1.6S 1.00 - 1.60A 330 MoCtoornIStnrtdoarel txGeersarand MMS-2.5S 1.60 - 2.50A MMS-4S 2.50 - 4.00A MMS-6.3S 4.00 - 6.30A MMS-10S 6.00 - 10.00A MMS-14S 9.00 - 14.00A MMS-18S 13.00 - 18.00A MMS-23S 17.00 - 23.00A MMS-25S 20.00 - 25.00A MMS-32S 24.00 - 32.00A sales@europa-plc.com technical@europa-plc.com 61
EUR PA 2023 Catalogue Variable Frequency Drives Europa Component's FR200 series 3 phase variable frequency drives - A compact, reliable and economical solution to motor, pump & fan control applications requiring a power range of 1.5kW to 18kW. These drives include sensor-less vector mode improving low speed response and energy efficiency. The keypad can also be remotely mounted/operated if required. IP54 Steel Enclosed Variable Frequency Drives (Machine-Install-Ready) Part Number Description FR200-4T-1.5ME IP54 Steel Enclosed 1.5kW 3 Phase 380V AC FR200-4T-2.2ME IP54 Steel Enclosed 2.2kW 3 Phase 380V AC FR200-4T-4.0ME IP54 Steel Enclosed 4.0kW 3 Phase 380V AC FR200-4T-5.5ME IP54 Steel Enclosed 5.5kW 3 Phase 380V AC FR200-4T-7.5ME IP54 Steel Enclosed 7.5kW 3 Phase 380V AC IP54 Steel Enclosed 11kW 3 Phase 380V AC Selection Chart for Machine-install ready, IP55 Steel Enclosed IP54 Steel Enclosed 15kW 3 Phase 380V AC DSD Flash Drive Device for VFD’s Part Number Product Description External Dim’s MCB FR200-4T-011ME (mm) Rating FR200-4T-015ME FR200-DSD HWD 16 16 FR200-4T-1.5ME 1.5/2.2kW 3 Phase 400V AC VFD 500 400 250 25 32 FR200-4T-2.2ME 2.2kW 3 Phase 400V AC VFD 500 400 250 40 63 FR200-4T-4.0ME 4.0/5.5kW 3 Phase 400V AC VFD 500 400 250 63 FR200-4T-5.5ME 5.5/7.5kW 3 Phase 400V AC VFD 500 400 250 FR200-4T-7.5ME 7.5/11kW 3 Phase 400V AC VFD 500 400 250 FR200-4T-011ME 11/15kW 3 Phase 400V AC VFD 700 500 300 FR200-4T-015ME 15/18.5kW 3 Phase 400V AC VFD 700 500 300 New Products MoCtoornIStnrtdoaerl txGeersarand • Vector control • AC 3PH 380V 0.75-450kW Coming • Independent air duct design Soon • Unique up/download module • Three phase output to ground short circuit protection We’re continuously expanding our VFD range throughout the year. Keep checking back for the latest updates as we develop new products. 62 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Contactors & Accessories Wiring Modules for MC1 Range Mini Contactors & Accessories Part Number Description MC1-RWM16LIS LINE SIDE Wiring Module MC1-RWM16LDS LOAD SIDE Wiring Module Complies to EN60947-4-1 / IP20 protected terminals / Ambient MC1 Overload Relays operating temperature -5°C to +40°C / Contactor closing time 8-20ms / opening time 6 -13ms / Coil consumption pull in 16VA / Coil consumption hold 2-4VA / Maximum terminal capacity 2.5mm² 4kW 9A AC3 (20A AC-1) 3 Pole Part Number Description Part Number Description MC1-09P3001A024B 24V AC 50/60 Hz (1N/C Aux) MC1-TR0.40 0.28-0.4A for MC1 Contactors MC1-09P3010A024B MC1-TR0.63 0.4-0.63A for MC1 Contactors 24V AC 50/60 Hz (1N/O Aux) MC1-TR0.80 0.56-0.8A for MC1 Contactors MC1-09P3001A110F MC1-TR1.20 0.8-1.2A for MC1 Contactors 110V AC 50 Hz MC1-TR1.80 1.2-1.8A for MC1 Contactors MC1-09P3010A110F 120V 60Hz (1NC Aux) MC1-TR2.80 1.8-2.8A for MC1 Contactors MC1-TR4.00 2.8-4A for MC1 Contactors MC1-09P3001A230B 110V AC 50 Hz MC1-TR6.30 4-6.3A for MC1 Contactors MC1-09P3010A230B 120V 60Hz (1NO Aux) MC1-TR8.0 5.6-8A for MC1 Contactors MC1-09P3001A400B MC1-TR10.0 7-10A for MC1 Contactors MC1-09P3010A400B 230V AC 50/60 Hz (1NC Aux) MC1-TR12.5 8-12.5A for MC1 Contactors MC1-TR15.0 10-15A for MC1 Contactors 230V AC 50/60 Hz (1NO Aux) MC1-TR17.0 11-17A for MC1 Contactors 400V AC 50/60 Hz (1NC Aux) 400V AC 50/60 Hz (1NO Aux) 7.5kW 16A AC-3 (22A AC-1) 3 Pole Part Number Description Mechanical Interlock for MC1 Range MC1-16P3001A024B 24V AC 50/60 Hz (1NC Aux) MC1-16P3010A024B Part Number Description 24V AC 50/60 Hz (1NO Aux) MC1-MI Mechanical Interlock MC1-16P3001A110F 110V AC 50 Hz MC1-16P3010A110F 120V 60Hz (1NC Aux) MC1-16P3001A230B 110 V AC 50 Hz MC1-16P3010A230B 120V 60Hz (1NO Aux) MC1-16P3001A400B MC1-16P3010A400B 230V AC 50/60 Hz (1NC Aux) 230 V AC 50/60 Hz (1NO Aux) 400V AC 50/60 Hz (1NC Aux) 400V AC 50/60 Hz (1NO Aux) Front Mounting Auxiliary Contacts for MC1 Range Surge Suppressors for MC1 Range 10A 230V AC-15 Description Part Number Description MoCtoornIStnrtdoarel txGeersarand Front Mounted Aux Contact 1NO + 1NC MC1-RCA024B 12-24V 50/60Hz Part Number Front Mounted Aux Contact 2NO + 2NC MC1-RCA048B 24-48V 50/60Hz MC1-FA11 Front Mounted Aux Contact 2NO MC1-RCA127B 50-127V 50/60Hz MC1-FA22 Front Mounted Aux Contact 2NC MC1-RCA250B 130-250V 50/60Hz MC1-FA20 Front Mounted Aux Contact 4NC MC1-RCA510B 400-510V 50/60Hz MC1-FA02 Front Mounted Aux Contact 4NO MC1-VSAD048 12-48VAC/12-60VDC MC1-FA04 Front Mounted Aux Contact 3NO + 1NC MC1-VSAD127 50-127VAC / 60-180VDC MC1-FA40 Front Mounted Aux Contact 1NO + 3NC MC1-VSAD250 130-250VAC / 180-300VDC MC1-FA31 MC1-VSA510 400-510 VAC MC1-FA13 sales@europa-plc.com technical@europa-plc.com 63
EUR PA 2023 Catalogue TC1 3 Pole Contactors with AC Coils TC1 11kW 25A AC3 (40A AC1) 3 Pole 3 Pole Part Number Description Contactors with DC coils TC1-D2510B7 24V AC 1N/O Aux also available TC1-D2510F7 110V AC 1N/O Aux TC1-D2510P7 230V AC 1N/O Aux TC1-D2510N7 415V AC 1N/O Aux TC1-D2501B7 24V AC 1N/C Aux TC1-D2501F7 110V AC 1N/C Aux TC1-D2501P7 230V AC 1N/C Aux TC1-D2501N7 415V AC 1N/C Aux TC1 15kW 32A AC3 (50A AC1) 3 Pole Part Number Description TC1-D3210B7 24V AC 1N/O Aux TC1-D3210F7 110V AC 1N/O Aux TC1-D3210P7 230V AC 1N/O Aux TC1-D3210N7 415V AC 1N/O Aux CE, CSA, UL Listed, EN 60947-4-1 TC1-D3201B7 24V AC 1N/C Aux Made in India TC1-D3201F7 110V AC 1N/C Aux TC1-D3201P7 230V AC 1N/C Aux Maximum rated operational voltage 690V TC1-D3201N7 415V AC 1N/C Aux TC1 4kW 9A AC3 (25A AC1) 3 Pole TC1 22kW 40A AC3 (60A AC1) 3 Pole Part Number Description Part Number Description TC1-D0910B7 24V AC 1N/O Aux TC1-D4011B7 24V AC 1N/O + 1N/C Aux TC1-D0910F7 110V AC 1N/O Aux TC1-D4011F7 110V AC 1N/O + 1N/C Aux TC1-D0910P7 230V AC 1N/O Aux TC1-D4011P7 230V AC 1N/O + 1N/C Aux TC1-D0910N7 415V AC 1N/O Aux TC1-D4011N7 415V AC 1N/O + 1N/C Aux TC1-D0901B7 24V AC 1N/C Aux TC1 25kW 50A AC3 (80A AC1) 3 Pole TC1-D0901F7 110V AC 1N/C Aux TC1-D0901P7 230V AC 1N/C Aux Part Number Description TC1-D0901N7 415V AC 1N/C Aux TC1-D5011B7 24V AC 1N/O + 1N/C Aux TC1-D5011F7 110V AC 1N/O + 1N/C Aux TC1 5.5kW 12A AC3 (25A AC1) 3 Pole TC1-D5011P7 230V AC 1N/O + 1N/C Aux TC1-D5011N7 415V AC 1N/O + 1N/C Aux Part Number Description TC1-D1210B7 24V AC 1N/O Aux TC1 37kW 65A AC3 (80A AC1) 3 Pole TC1-D1210F7 110V AC 1N/O Aux TC1-D1210P7 230V AC 1N/O Aux Part Number Description TC1-D1210N7 415V AC 1N/O Aux TC1-D6511B7 24V AC 1N/O + 1N/C Aux TC1-D6511F7 110V AC 1N/O + 1N/C Aux TC1-D1201B7 24V AC 1N/C Aux TC1-D6511P7 230V AC 1N/O + 1N/C Aux TC1-D1201F7 110V AC 1N/C Aux TC1-D6511N7 415V AC 1N/O + 1N/C Aux TC1-D1201P7 230V AC 1N/C Aux MoCtoornIStnrtdoaerl txGeersarand TC1-D1201N7 415V AC 1N/C Aux TC1 45kW 80A AC3 (125A AC1) 3 Pole TC1 9kW 18A AC3 (32A AC1) 3 Pole Part Number Description TC1-D8011B7 24V AC 1N/O + 1N/C Aux Part Number Description TC1-D8011F7 110V AC 1N/O + 1N/C Aux TC1-D1810B7 24V AC 1N/O Aux TC1-D8011P7 230V AC 1N/O + 1N/C Aux TC1-D1810F7 110V AC 1N/O Aux TC1-D8011N7 415V AC 1N/O + 1N/C Aux TC1-D1810P7 230V AC 1N/O Aux TC1-D1810N7 415V AC 1N/O Aux TC1 45kW 95A AC3 (125A AC1) 3 Pole TC1-D1801B7 24V AC 1N/C Aux Part Number Description TC1-D1801F7 110V AC 1N/C Aux TC1-D9511B7 24V AC 1N/O + 1N/C Aux TC1-D1801P7 230V AC 1N/C Aux TC1-D9511F7 110V AC 1N/O + 1N/C Aux TC1-D1801N7 415V AC 1N/C Aux TC1-D9511P7 230V AC 1N/O + 1N/C Aux TC1-D9511N7 415V AC 1N/O + 1N/C Aux 64 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA TC1 4 Pole Contactors with AC Coils TC1 11kW 25A AC3 (40A AC1) 4 Pole 4 Pole Part Number Description Contactors TC1-D25004B7 24V AC 4N/O with DC coils TC1-D25004F7 110V AC 4N/O also available TC1-D25004P7 230V AC 4N/O TC1-D25004N7 415V AC 4N/O TC1-D25006B7 24V AC 4N/C TC1-D25006F7 110V AC 4N/C TC1-D25006P7 230V AC 4N/C TC1-D25006N7 415V AC 4N/C TC1-D25008B7 24V AC 2N/O + 2N/C TC1-D25008F7 110V AC 2N/O + 2N/C TC1-D25008P7 230V AC 2N/O + 2N/C TC1-D25008N7 415V AC 2N/O + 2N/C TC1 22kW 40A AC3 (60A AC1) 4 Pole CSA, UL Listed, EN 60947-4-1 Part Number Description Made in India TC1-D40004B7 24V AC 4N/O Maximum rated operational voltage 690V TC1-D40004F7 110V AC 4N/O Overload relays are not compatible with 2N/O + 2N/C TC1-D40004P7 230V AC 4N/O main pole TC1 contactors TC1-D40004N7 415V AC 4N/O TC1 4kW 9A AC3 (25A AC1) 4 Pole TC1-D40008B7 24V AC 2N/O + 2N/C TC1-D40008F7 110V AC 2N/O + 2N/C Part Number Description TC1-D40008P7 230V AC 2N/O + 2N/C TC1-D09004B7 24V AC 4N/O TC1-D40008N7 415V AC 2N/O + 2N/C TC1-D09004F7 110V AC 4N/O TC1-D09004P7 230V AC 4N/O TC1 37kW 65A AC3 (80A AC1) 4 Pole TC1-D09004N7 415V AC 4N/O Part Number Description TC1-D09008B7 24V AC 2N/O + 2N/C TC1-D65004B7 24V AC 4N/O TC1-D09008F7 110V AC 2N/O + 2N/C TC1-D65004F7 110V AC 4N/O TC1-D09008P7 230V AC 2N/O + 2N/C TC1-D65004P7 230V AC 4N/O TC1-D09008N7 415V AC 2N/O + 2N/C TC1-D65004N7 415V AC 4N/O TC1-D65008B7 24V AC 2N/O + 2N/C TC1-D65008F7 110V AC 2N/O + 2N/C TC1-D65008P7 230V AC 2N/O + 2N/C TC1-D65008N7 415V AC 2N/O + 2N/C TC1 5.5kW 12A AC3 (25A AC1) 4 Pole TC1 45kW 80A AC3 (125A AC1) 4 Pole Part Number Description Part Number Description TC1-D12004B7 24V AC 4N/O TC1-D80004B7 24V AC 4N/O TC1-D12004F7 110V AC 4N/O TC1-D80004P7 230V AC 4N/O TC1-D12004P7 230V AC 4N/O TC1-D80004F7 110V AC 4N/O TC1-D12004N7 415V AC 4N/O TC1-D80004N7 415V AC 4N/O TC1-D12006B7 24V AC 4N/C TC1-D80008B7 24V AC 2N/O + 2N/C MoCtoornIStnrtdoarel txGeersarand TC1-D12006F7 110V AC 4N/C TC1-D80008P7 230V AC 2N/O + 2N/C TC1-D12006P7 230V AC 4N/C TC1-D80008F7 110V AC 2N/O + 2N/C TC1-D12006N7 415V AC 4N/C TC1-D80008N7 415V AC 2N/O + 2N/C TC1-D Range & TP1 Contactor Dimensions TC1-D12008B7 24V AC 2N/O + 2N/C Amp Height 3 Pole Width 4 Pole Width Depth AC Depth DC TC1-D12008F7 110V AC 2N/O + 2N/C 9-12A 74mm 45mm 45mm 80mm 115mm TC1-D12008P7 230V AC 2N/O + 2N/C 18A 74mm 45mm - 85mm 120mm TC1-D12008N7 415V AC 2N/O + 2N/C 25A 84mm 56mm 56mm 93mm 130mm 32A 84mm 56mm - 98mm 135mm 38A 84mm 56mm - 98mm 135mm 40-65A 127mm 75mm 85mm 114mm 171mm 80A 127mm 85mm 96mm 125mm 181mm 95A 127mm 85mm - 125mm - sales@europa-plc.com technical@europa-plc.com 65
EUR PA 2023 Catalogue TC1-D Range Average AC Coil Consumption 50 / 60Hz Enclosed Contactors Contactor TCA2 TC1-D09 TC1-D25 TC1-D40 3 Pole Enclosed Contactors 50/60Hz Control Relay to D18 to D38 to D95 Pull In / Holding 70/8 VA 70 / 8VA 100 / 8.5 VA 245 / 26 VA TP1-D Range Average DC Coil Consumption DC Contactor TP1-D09 to D18 TP1-D25 to D38 TP1-D40 to D80 22 / 22W Pull In / Holding 9 / 9W 11 / 11W TC1-D Range Contactor Closing Times Opening Times 25, 40 & 60A IP54 Metal Clad Enclosed / Screw on lid / Lid: RAL7035 / Operating Times (milliseconds) (milliseconds) Base: RAL 7012 80 & 125A IP65 Steel Enclosed / Hinged Lid / RAL 7035 / 230V AC Coil / TC1-D09 / D12 / D18 12....22 4....12 Neutral Terminal / 1NO Auxiliary / Pre-assembled TC1-D25 / D32 / D38 15....24 5....19 TC1-D40 / D50 / D65 20....26 8....12 TC1-D80 / D95 20....35 6....20 TC1-D Range Contactor Replacement Coil Look Up Table Part Number Description CON253P7MC IP54 AC-1 25A 230V AC Coil Volts 12 24 48 110 230 240 380 400 415 AC B7 E7 F7 P7 U7 Q7 V7 N7 CON403P7MC IP54 AC-1 40A 230V AC Coil 50/60 Hz JD BD ED FD - - - - - CON603P7MC IP54 AC-1 60A 230V AC Coil DC CON803P7ME IP65 AC-1 80A 230V AC Coil Replacement AC Coils for TC1 Contactors CON1253P7ME IP65 AC-1 125A 230V AC Coil 4 Pole Enclosed Contactors Other voltages available on request TC1D09-D18 (AC) 50/60Hz 25, 40 & 60A IP54 Metal Clad Enclosed / Rated at AC-1 / Screw on lid / Cover: RAL 7035 / Base: RAL 7012 Part Number Description 80 & 125A IP65 Steel Enclosed / Hinged lid / RAL 7035 / Rated at AC-1 / TX1D2B7 24V AC 230V AC coil / Neutral terminals x 4 / 1N/O + 1N/C auxiliary TX1D2E7 48V AC TX1D2F7 110V AC Part Number Description TX1D2P7 230V AC CON254P7MC IP54 AC-1 25A 4N/O TX1D2Q7 380V AC TX1D2N7 415V AC CON404P7MC IP54 AC-1 40A 4N/O CON604P7MC IP54 AC-1 60A 4N/O CON804P7ME IP65 AC-1 80A 4N/O TC1D25-D32 (AC) 50/60Hz CON1254P7ME IP65 AC-1 125A 4N/O Contactor Enclosures Part Number Description MNX Polycarbonate Contactor Enclosures (IP67) TX1D4B7 24V AC MoCtoornIStnrtdoaerl txGeersarand TX1D4E7 48V AC TX1D4F7 110V AC TX1D4P7 230V AC TX1D4Q7 380V AC TX1D4N7 415V AC TC1D40-D95 (AC) 50/60Hz Part Number Description TX1D6B7 24V AC UL, CSA, KEMA, FIMKO, DNV, LR IK08 / Flammability rating UL94-5V / Temp range: -40°C to +120°C TX1D6E7 48V AC (Short term) / -40°C to +80°C (Long term) TX1D6F7 110V AC TX1D6P7 230V AC Part Number Description TX1D6Q7 380V AC PB25C For 9-32A H: 180 x W: 130 x D: 150mm TX1D6N7 415V AC PB65C For 40-65A H: 255 x W: 180 x D: 175mm NB: PB65C can also accommodate the 80A & 95A contactors but without side mounting auxiliaries. 66 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Metal Clad Contactor Enclosures (IP54) TC1-D & TP1-D Range Contactor Overload Relays Lid: RAL 7035 / Base: RAL 7012 / Powder coated steel enclosure Part Number Description CSA, UL Listed & IEC EN 60947 Overload relays do not fit on TC1 contactors with 2N/O + 2N/C main Centred Din Rail pole contacts MC18CD For 9-18A H: 186 x W: 120 x D: 126mm MC38CD For 25-38A H: 216 x W: 144 x D: 130mm Part Number Description MC65CD For 40-65A H: 264 x W: 190 x D: 159mm TR2-D09301 0.10 - 0.16A for use with D09 - D38 Contactors Offset Din Rail TR2-D09302 0.16 - 0.25A for use with D09 - D38 Contactors MC18C For 9-18A H: 186 x W: 120 x D: 126mm 0.25 - 0.40A for use with MC38C For 25-38A H: 216 x W: 144 x D: 130mm TR2-D09303 D09 - D38 Contactors MC65C For 40-65A H: 264 x W: 190 x D: 159mm TR2-D09304 0.40 - 0.63A for use with D09 - D38 Contactors Point of Sale ABS Enclosures TR2-D09305 0.63 - 1.00A for use with D09 - D38 Contactors TR2-D09306 1.00 - 1.65A for use with D09 - D38 Contactors TR2-D09307 1.6 - 2.5A for use with D09 - D38 Contactors TR2-D09308 2.5 - 4A for use with D09 - D38 Contactors TR2-D09310 4 - 6A for use with D09 - D38 Contactors TR2-D09312 5.5 - 8A for use with D09 - D38 Contactors TR2-D09314 7 - 10A for use with D09 - D38 Contactors TR2-D12316 9 - 13A for use with D09 - D38 Contactors IP67, IK08 / Supplied with 35 x 7.5m Din Rail / Heavy duty screw type enclosure / Gasket supplied / Operating temperature -40°C to +85°C, TR2-D18321 12 - 18A for use with Great for housing Terminal Blocks and Industrial Equipment / Material D09 - D38 Contactors made from ABS UL94-HB TR2-D25322 17 - 25A for use with D09 - D38 Contactors Part Number Description 23 - 32A for use with CPB12127D 125 x 125 x 75 w/ Din Rail 0.112m TR2-D32353 D25 - D38 Contactors CPB121210D 125 x 125 x 100 w/ Din Rail 0.112m TR2-D32355 28 - 36A for use with D32 - D38 Contactors CPB1387D 130 x 80 x 70 w/ Din Rail 0.118m 23 - 32A for use with CPB17127D 175 x 125 x 75 w/ Din Rail 0.164m TR2-D40353 D40 - D65 Contactors MoCtoornIStnrtdoarel txGeersarand CPB171210D 175 x 125 x 100 w/ Din Rail 0.164m TR2-D40355 30 - 40A for use with D40 - D65 Contactors CPB201513D 200 x 150 x 130 w/ Din Rail 0.182m 37 - 50A for use with CPB202010D 200 x 200 x 100 w/ Din Rail 0.182m TR2-D65357 D50 - D65 Contactors CPB202013D 200 x 200 x 130 w/ Din Rail 0.182m TR2-D65359 48 - 65A for use with D65 Contactors CPB281913D 280 x 190 x 130 w/ Din Rail 0.251m TR2-D65361 55 - 70A for use with D65 Contactors TR2-D80363 63 - 80A for use with D80 Contactors TR2-D95365 80 - 93A for use with D95 Contactors sales@europa-plc.com technical@europa-plc.com 67
EUR PA 2023 Catalogue TR2 Overload Mounting Plates TC On / Off Delay For remote mounting of TC1 overload relays Suitable for use with TC1-D, TP1-D & F range contactors Din Rail Mounted or fixing screws (Not supplied) (Adding 52mm to the depth of the TC1-D & TP1-D range) Part Number Description Part Number Description TA7-D0964 From TR2-D09 to TR2-D25 TA2-DT0 0.1 - 3 Sec On Delay TA7-D3264 TR2-D32 Only TA7-D4064 From TR2-D40 to TR2-D95 TA2-DT2 1 - 30 Sec On Delay TA2-DT4 10 - 180 Sec On Delay Side Mounting Auxiliary Contact Blocks TA3-DR0 0.1 - 3 Sec Off Delay TA3-DR2 1 - 30 Sec Off Delay TA3-DR4 10 - 180 Sec Off Delay Star Delta 0.1 - 30 Seconds Rated thermal current (Ith) 10A AC-15 / Suitable for use with TC1-D range contactors and TP1-D09-D36 contactors (adding 12.5mm to the width) Part Number Description Suitable for use with TC1-D, TP1-D & F range contactors TA8-DN11 1N/O + 1N/C (Adding 52mm to the depth of the TC1-D & TP1-D range) TA8-DN20 2N/O NB: Not suitable for use with F Range contactors Part Number Description TA2-DS2 Star Delta 0.1 - 30 Sec Front Mounting Auxiliary Contact Blocks Mechanical Interlocks for TC1-D and TP1-D Range UL & CSA Will fit both TC1-D range and TP1-D range contactors Rated Thermal Current 10A AC-15 / Suitable for use with TC1-D, TP1-D & F Part Number Description range contactors (adding 33mm to the depth of the TC1-D & TP1-D range) LA9-D09978 TC1-D09 to D32 Part Number Description TA1-DN11 1N/O + 1N/C LA9-D50978 TC1-D40 to D65 TA1-DN13 1N/O + 3N/C LA9-D80978 TC1-D80 to D95 TA1-DN20 2N/O Replacement Start Button for DOL Starters TA1-DN02 2N/C MoCtoornIStnrtdoaerl txGeersarand TA1-DN22 2N/O + 2N/C TA1-DN31 3N/O + 1N/C TA1-DN40 4N/O TA1-DN04 4N/C Coil Suppressor Fits directly on top of TC contactors Part Number Description LA9-D09906 Start Button for DOL 230V AC max / 400V DC max Part Number Description LA9-D09980 Suppressor Block 68 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA LC1- F Range Dimensions (mm) LC1-F Range Contactors AC3 3 Pole 3 Pole 3 Pole 4 Pole 4 Pole 4 Pole Rating Height Width Depth Height Width Depth LC1-F range contactors are supplied without a coil. The required coil voltage must be ordered separately. F115A 162 164 171 162 201 171 F150A 170 170 A supporting range of auxiliaries and accessories are available 174 209 181 including spare terminal shrouds, see page 70. F185A 174 169 181 197 245 213 F225A 197 203 261 219 Maximum rated operational voltage 690V 288 232 F265A 203 202 213 206 389 255 Supplied with incoming and outgoing terminal shrouds F330A 206 213 219 238 F400A 304 F500A 238 233 232 F630A 304 309 255 3 Pole / 3 Normally Open (Supplied Without Coil) 4 Pole / 4 Normally Open (Supplied Without Coil) Part Number Description Part Number Description MoCtoornIStnrtdoarel txGeersarand LC1-F115A-A65 59kW 115A AC3 (200A AC1) LC1-F1154A-A65 59kW 115A AC3 (200A AC1) LC1-F150A-A65 80kW 150A AC3 (250A AC1) LC1-F1504A-A65 80kW 150A AC3 (250A AC1) LC1-F185A-A65 100kW 185A AC3 (275A AC1) LC1-F1854A-A65 100kW 185A AC3 (275A AC1) LC1-F225A-A65 110kW 225A AC3 (315A AC1) LC1-F2254A-A65 110kW 225A AC3 (315A AC1) LC1-F265A-A65 140kW 265A AC3 (350A AC1) LC1-F2654A-A65 140kW 265A AC3 (350A AC1) LC1-F330A-A65 180kW 330A AC3 (400A AC1) LC1-F3304A-A65 180kW 330A AC3 (400A AC1) LC1-F400A-A65 220kW 400A AC3 (500A AC1) LC1-F4004A-A65 220kW 400A AC3 (500A AC1) LC1-F500A-A65 280kW 500A AC3 (700A AC1) LC1-F5004A-A65 280kW 500A AC3 (700A AC1) LC1-F630A-A65 355kW 630A AC3 (1000A AC1) LC1-F6304A-A65 375kW 630A AC3 (1000A AC1) sales@europa-plc.com technical@europa-plc.com 69
EUR PA 2023 Catalogue Accessories for LC1-F Contactors Mechanical Interlocks for LC1-F Range AC Coils for LC1 Contactors Part Number Description Part Number Description LC1-F115-F150A (AC) LA9-FF970 LC1-FF115 to 150 Horizontal LX9-FFB 24V AC LA9-FF971 LC1-FF115 to 150 Vertical LX9-FFF 110V AC LA9-FG970 LC1-FF185 to 225 Horizontal LX9-FFU 240V AC LA9-FG971 LC1-FF185 to 225 Vertical LX9-FFN 415V AC LA9-FJ970 LC1-FF265 to 500 Horizontal LA9-FJ971 LC1-FF265 to 500 Vertical LC1-F185-F225A (AC) 24V AC LA9-FL970 LC1-FF630 Horizontal LX9-FGB 110V AC LA9-FL971 LC1-FF630 Vertical LX9-FGF 240V AC LX9-FGU 415V AC Spare Terminal Shrouds for LC1-F Range LX9-FGN 24V AC Part Number Description LC1-F265-F330 (AC) 110V AC LA9-F701 LC1-F115 & LR1-FM105 to 125 LX1-FHB 240V AC LA9-F702 LC1-F150 to LR1-F200 LX1-FHF 415V AC LA9-F703 LC1-F225 to 500 LX1-FHU LA9-F704 LC1-F630 & LR1-F400 to 630 LX1-FHN 110V AC MoCtoornIStnrtdoaerl txGeersarand 240V AC Choosing the Correct Contactor LC1-F400A (AC) 415V AC LX1-FJF To help our dedicated technical team deal with LX1-FJU 110V AC your enquiry quickly and accurately, please find LX1-FJN 240V AC 415V AC out the following information: LC1-F500A (AC) LX1-FKF 110V AC What current rating is required? LX1-FKU 240V AC What is the load type? LX1-FKN 415V AC - AC-1 Resistive LC1-F630A (AC) - AC-3 Inductive (Motor Load) LX1-FLF What coil voltage is required? LX1-FLU How many poles are needed? LX1-FLN Do you require auxiliary contacts? Do you need an overload? Do you require an enclosure? 70 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Switch Mode Power Supplies Panel Transformers 12V DC Output Wide AC and DC input range / Fully protected against overload and UL Approved; EN 61558-2-6 compliant; Class F Rated over voltage / High load stability / Adjustable DC output + / - 1% / LED Dual input voltage 230/400V AC / Output voltage 55-0-55 (110V) AC, Indication for power on Operating time: Continuous / Open frame (IP00) Part Number Amp Description 55-0-55 (110V) Output Open Frame Transformers (IP00) SMP-20-12 1.67A 20W - Compact SMP-60-12 5A 60W - Compact SMP-100-12 7.5A 100W - Compact Part Number Description Amps SMP-120-12 10A 120W CFM-050-CC09 50VA 0.45A CFM-100-CC09 100VA 0.9A 24V DC Output CFM-250-CC09 250VA 2.2A CFM-500-CC09 500VA 4.5A 85 - 264V AC / 120 - 370V DC / multiple input voltage range CFM-1K0-CC09 1KVA Fully protected against overload and over voltage 9A Din rail mount / High load stability / Adjustable DC output + / - 10% LED indication for power on 24V AC Output Open Frame Transformers (IP00) Part Number Amp Description Part Number Description Amps SMP-20-24 1A 20W - Compact CFM-040-CC02 40VA 1.6A CFM-050-CC02 50VA 2A SMP-60-24 2.5A 60W - Compact CFM-063-CC02 63VA 2.6A CFM-100-CC02 100VA 4A SMP-100-24 4A 100W - Compact CFM-160-CC02 160VA 6.6A CFM-250-CC02 250VA 10A SMP-120-24 5A 120W CFM-300-CC02 300VA 12.5A CFM-500-CC02 500VA 20A SMP-240-24 10A 240W CFM-1K0-CC02 1KVA 41.6A The difference between SMP’s 24V AC Output Safety Transformer (IP20) and Transformers... Switch Mode Power supplies change an AC (85-264V) or DC (120-370V) input voltage to a reduced DC voltage Transformers change an AC (230/400V) input voltage MoCtoornIStnrtdoarel txGeersarand to a reduced AC voltage UL Approved; EN 61558-2-6 standard; Class B rated Dual input voltage: 230/400V / Output voltage: 24V AC Operating time: Continuous / Enclosed (IP20) / Din rail mounting If you need further advice on product selection Part Number Description Amps call our technical helpline IPB-050-CC02 50VA 2A IPB-100-CC02 100VA 4A 01582 692 444 IPB-160-CC02 160VA 6.6A IPB-250-CC02 250VA 10A IPB-300-CC02 300VA 12.5A NB: Other sizes and types available on request sales@europa-plc.com technical@europa-plc.com 71
EUR PA 2023 Catalogue Plastic Push Buttons & Selector Switches Indicator Lamps & Holders Plastic Weatherproof Stay Put Selector Switches + Lamp Holder (BA9 Type) + Collar Mounting Clip (IP67) Lamps not included / LP6 & LP7 lamp holders are suitable for use with illuminated push buttons and selector switches Part Number Description Part Number Description RAP2-BD2 2 Position Stay Put RAS-LP3 Transformer Type 110V > 6V RAP2-BD3 3 Position Stay Put Transformer Type 240V > 6V RAP2-BHZ Mounting Clip for RAP2 range RAS-LP4 Direct Connected (any voltage) RAS-CBNC N/C Collar Mounting Contact Block RAS-LP6 Diode & Series Resistor 230V > 110V RAS-CBNO N/O Collar Mounting Contact Block RAS-LP7 RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block Plastic Key Operated Selector Switches + Mounting Clip (IP65) LED BA9 Bayonet (10 x 23mm) Part Number Description AC/DC / For use with illuminated push buttons and selector switches / RP2-BG4 2 Pos Key Removable 2 Pos Long life: 30,000 Hours / Operating temperature: -25°C to + 55°C RP2-BG2 2 Pos Key Removable - Left Pos RP2-BG0 3 Pos Key Removable - 3 Pos Part Number Description RP2-BG3 3 Pos Key Removable Centre Only BA9LED1B 24V White 2 Chip LED RP2-BG5 3 Pos Key Removable L & R Pos BA9LED3B 24V Green 1 Chip LED BA9LED4B 24V Red 2 Chip LED RAS-CBNC N/C Contact Block Collar Mounting BA9LED5B 24V Amber 2 Chip LED RAS-CBNO N/O Contact Block Collar Mounting BA9LED6B 24V Blue 2 Chip LED BA9LED1F 110V White 4 Chip LED Plastic Push Buttons + Mounting Clip (IP65) BA9LED3F 110V Green 2 Chip LED BA9LED4F 110V Red 2 Chip LED BA9LED5F 110V Amber 2 Chip LED BA9LED6F 110V Blue 2 Chip LED BA9LED1P 230V White 4 Chip LED BA9LED3P 230V Green 2 Chip LED BA9LED4P 230V Red 2 Chip LED BA9LED5P 230V Amber 2 Chip LED BA9LED6P 230V Blue 2 Chip LED Lamp Head Only MoCtoornIStnrtdoaerl txGeersarand IP65 rated when installed / Complete with mounting clip Used for plastic control stations or panel mount (See page 78) Part Number Description Collar is supplied with the lamp holder (Sold separately) RP2BA1 Flush P/B Head White RP2BA2 Flush P/B Head Black Part Number Description RP2BA3 Flush P/B Head Green RAS-LP01 White RP2BA4 Flush P/B Head Red RAS-LP03 Green RP2BA5 Flush P/B Head Yellow RAS-LP04 Red RP2BA6 Flush P/B Head Blue RAS-LP05 Amber RP2-BL4 Projecting P/B Head Red RAS-LP06 Blue RAS-LP07 Clear RAS-CBNC N/C Contact Block Collar Mounting RAS-CBNO N/O Contact Block Collar Mounting RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block 72 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Illuminated Push Buttons & Selector Switches Metal Push Buttons & Selector Switches Twin Push Button (IP40) Metal Flush Push Button Head + Collar (IP65) Collar is supplied with the lamp holder (Sold separately - see page 72) Part Number Description Part Number Description RAS-PB1534 Off-On (Illuminated) RCAS-PBF1 White RCAS-PBF2 Black RCAS-PBF34 Off-On (Not Illuminated) + collar RCAS-PBF3 Green RCAS-PBF4 Red RAS-CBNC N/C Collar Mounting Contact Block RCAS-PBF5 Yellow RAS-CBNO N/O Collar Mounting Contact Block RCAS-PBF6 Blue RCAS-PBF3-I Green Button White I Symbol Illuminated Flush Push-Button Head Only (IP65) RB2-BA3347 White Button Black Arrow RB2-BA3357 Black Button White Arrow RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block NB: Both RB2 parts do NOT include the mounting collar. (See page 72) Collar is supplied with the lamp holder (Sold separately - see page 72) Part Number Description Metal Booted Push-Button + Collar (IP65) RAS-PB131 White RAS-PB133 Green RAS-PB134 Red RAS-PB135 Amber RAS-PB136 Blue RAS-PB137 Clear RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block IP65 rated when installed NB: Please refer to our range of BA9 bulbs (see page 72) Part Number Description RCAS-PBB2 Black Illuminated Stay Put Selector Switches (IP65) RCAS-PBB3 Green RCAS-PBB4 Red RCAS-PBB5 Yellow RCAS-PBB6 Blue RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block Metal Projecting Push Button + Collar (IP65) IP65 rated when installed Collar is supplied with the lamp holder (Sold separately - see page 72) Part Number Description MoCtoornIStnrtdoarel txGeersarand RB2-BK123 2 Position Green RB2-BK124 2 Position Red RB2-BK125 2 Position Amber RAS-CBNC N/C Collar Mounting Contact Block IP65 rated when installed RAS-CBNO N/O Collar Mounting Contact Block Part Number Description Adapt existing Europa RCAS-PBP1 White products with our Fibre RCAS-PBP2 Black Laser Cutting Machine RCAS-PBP3 Green RCAS-PBP4 Red RCAS-PBP5 Yellow RCAS-PBP6 Blue RCAS-PBP4-O Red Button White O Symbol RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block sales@europa-plc.com technical@europa-plc.com 73
EUR PA 2023 Catalogue Metal Key Operated Selector Switches + Collar (IP65) Auxiliary Contact Blocks 1 2 3 IP65 rated when installed Rated at 240V @ 10A AC-1 / N/O Green, N/C Red Part Number Description Part Number Description RCAS-SWK2RS 2 Position RCAS-SWK2 Key Removable in 2 Pos. 1 RAS-CBNC N/C Collar Mounting RCAS-BG6 RCAS-SWK3RS 2 Position RAS-CBNO N/O Collar Mounting RCAS-SWK3 Key Removable in the Centre Off Pos. RCAS-BG7 2 RAS-BCBNC N/C Back Mounting for 2 Position Plastic Control Stations Key Spring Return Right to Centre Pos. RAS-BCBNO N/O Back Mounting for Plastic Control Stations 3 Position 3 RAS-BCBNCM Key Removable in 3 Pos. N/C Back Mounting Contact Block for RAS-BCBNOM Metal Pre-assembled Stations 3 Position N/O Back Mounting Contact Block for Key Removable in the Centre Off Pos. Metal Pre-assembled Stations 3 Position Key Spring Return to Centre Pos. RAS-CBNC N/C Collar Mounting Contact Block Mushroom Head Push Button RAS-CBNO N/O Collar Mounting Contact Block Metal Mushroom Head (Spring Return) (IP65) Metal Standard Handle Selector Switches + Collar (IP65) IP65 rated when installed Part Number Description IP65 rated when installed / 40mm mushroom head RCAS-SW2 RCAS-SWR2 2 Position Stay Put Part Number Description RCAS-SWL2 2 Position Spring Return to RCAS-ES54B Black Spring Return with Collar RCAS-SW3 Centre Position RCAS-SWR3 RCAS-ES54G Green Spring Return with Collar 2 Position Stay Put RCAS-SWL3 Long Handle RCAS-ES54R Red Spring Return with Collar 3 Position Stay Put RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block 3 Position Spring Return to Centre Position 3 Position Stay Put Long Handle MoCtoornIStnrtdoaerl txGeersarand RAS-CBNC N/C Collar Mounting Contact Block RAS-CBNO N/O Collar Mounting Contact Block Accessories for 22.5mm Push Buttons We have a wide range of control gear options suitable for projects using our Accessories for 22.5mm Push Buttons new Fibre Laser Cutting Machine. Part Number Description For bespoke enquiries visit RB2-K455 Spare Key for Selector Switches www.europa-plc.com/bespoke-solutions RB2-PY9330 60mm Emergency Stop (Suitable for use with all 22mm diameter push buttons) Technical: 01582 692 444 RAS-FB Mounting Collar 74 Sales: 01582 692 440
2023 Catalogue EUR PA Emergency Stops Plastic Emergency Stop Buttons (Latching) (IP65) Metal Emergency Stop Buttons + Collar (Latching) (IP65) 12 3 NONE 45 6 IP65 rated when installed / 40mm mushroom head Mounting clip required for panel use. Part Number Description RP2-ES14 Key Release (Plastic Body) RP2-ES54 Twist Release (Plastic Body) 40mm mushroom head RAS-BCBNC N/C Back Mounting for IP65 rated when installed RAS-BCBNO Plastic Control Stations N/O Back Mounting for Plastic Control Stations Part Number Description Reflex Pendant Control Stations Twist Release + 1N/O 1 RCAS-ES541 Reflex Pendant control stations (IP65) 2 RCAS-ES542 Twist Release + 1N/C 3 RCAS-EST4 4 RCAS-ES14 Push/Pull 5 RCAS-ES142 Key Release 6 RCAS-ES54 Key Release + 1N/C Twist Release RAS-CBNC N/C Collar Mounting RAS-CBNO Contact Block N/O Collar Mounting Contact Block 60mm Metal Mushroom Head Twist Release Bespoke Emergency Stop (Latching) (IP65) configurations in 2-12 buttons available EN 60947-5-1 The ergonomically designed, IP65 pendants are resistant to oils and atmospheric agents. The rugged, shockproof casing has a working temperature range between -25°C and +70°C. Switching is provided by mechanically interlocked, self-cleaning silver MoCtoornIStnrtdoarel txGeersarand alloy contacts. They are available in single contact (N/O or N/C), dual speed (2x N/O), dual redundancy (2x N/C) and electrically interlocked (N/O + N/C) versions. 60mm mushroom head Part Number Description IP65 rated when Installed ECPEND02P 2 Button ECPEND03PP Up, Down Part Number Description ECPEND04P01 ECPEND04P02 3 Button - Interlocked RCAS-ES564 Twist Release + Collar ECPEND05P01 E-stop, Up, Down ECPEND05P02 RAS-CBNC N/C Collar Mounting Contact Block 4 Button RAS-CBNO N/O Collar Mounting Contact Block Up, Down, Right, Left 4 Button -2 speed Up, Down, Right, Left 5 Button E-stop, Up, Down, Right, Left 5 Button - 2 speed E-stop, Up, Down, Right, Left sales@europa-plc.com technical@europa-plc.com 75
EUR PA 2023 Catalogue Plastic Pre-assembled Control Stations 2 Position Plastic Control Station (IP65) Plastic Enclosed Emergency Stop Stations (IP65) IP65 rated when installed Part Number Description RC2PGES55 Green / Emergency Stop + 1N/O + 1N/C RC2PGR Green / Red + 1N/O + 1N/C RC2PWB White / Black + 2N/O IP65 rated when installed RAS-BCBNC N/C Back Mounting Contact Block for Plastic Rated up to 240V at 10A AC-1 RAS-BCBNO Control Stations N/O Back Mounting Contact Block for Plastic Control Stations Part Number Description 3 Position Plastic Control Station (IP65) RCAS-ESB141NC Key Release + 1N/C RCAS-ESB541NC Twist Release + 1N/C RCAS-ESBC41NC Spring Release + 1N/C RCAS-ESBT42NC Pull Release + 2N/C RCAS-ESB5641NC 60mm Head Twist Release + 1N/C RAS-BCBNC N/C Back Mounting Contact Block for Plastic RAS-BCBNO Control Stations N/O Back Mounting Contact Block for Plastic Control Stations IP65 rated when installed 1 Position Plastic Control Station (IP65) Part Number Description RC3PGRG Green / Red / Green + 2N/O + 1N/C RC3PWRB White/Red/Black + 2N/O + 1N/C RAS-BCBNC N/C Back Mounting for Contact Block Plastic RAS-BCBNO Control Stations N/O Back Mounting for Contact Block Plastic Control Stations MoCtoornIStnrtdoaerl txGeersarand IP65 rated when installed Part Number Description RC1PBG4 Key Removable in ON & OFF + 1N/O Plastic Control Station Enclosure Dimensions (mm) RC1PG Green + 1N/O Measure 1 Hole 2 Hole 3 Hole 4 Hole H 51 164 128 RAS-BCBNC N/C Back Mounting Contact Block for Plastic W 68 RAS-BCBNO Control Stations L 74 104 134 N/O Back Mounting Contact Block for Plastic Control Stations W 1 54 L 1 38 68 68 76 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Metal Pre-assembled Control Stations 2 Position Metal Control Station (IP65) Metal Enclosed Emergency Stop Stations (IP65) IP65 rated when installed / Rated up to 240V at 10A AC-1 IP65 rated when installed Part Number Description Part Number Description RM1BS142 Key Release + 1N/C Green + 1N/O Emergency Stop + 1N/C RM1BS542 Twist Release + 1N/C RM2GES55 RM1BS5642 60mm Head Twist Release + 1N/C RM2GR Green / Red + 1N/O + 1NC RAS-BCBNCM N/C Back Mounting Contact Block for Metal RAS-BCBNCM N/C Back Mounting Contact Block for Metal RAS-BCBNOM Pre-assembled Stations RAS-BCBNOM Pre-assembled Stations N/O Back Mounting Contact Block for Metal N/O Back Mounting Contact Block for Metal Pre-assembled Stations Pre-assembled Stations 1 Position Metal Control Station (IP65) 3 Position Metal Control Station (IP65) IP65 rated when installed Part Number Description RM1BG4 Key Removable in ON & OFF IP65 rated when installed + 1N/O Part Number RM1BG7 3 Position Key Release Spring Return to RM3GRG Description Centre + 2N/O Green / Red / Green RM1G Green + 1N/O 2N/O + 1N/C RAS-BCBNCM N/C Back Mounting Contact Block for Metal RAS-BCBNCM N/C Back Mounting Contact Block for RAS-BCBNOM Pre-assembled Stations RAS-BCBNOM Metal Pre-assembled Stations N/O Back Mounting Contact Block for Metal Pre-assembled Stations N/O Back Mounting Contact Block for Metal Pre-assembled Stations MoCtoornIStnrtdoarel txGeersarand Metal Control Station Enclosure Dimensions (mm) Measure 1 Hole 2 Hole 3 Hole 4 Hole H 51 164 138 W 68 L 74 105 134 W 1 54 L 1 46 78 108 Legend Plates are included with each control station sales@europa-plc.com technical@europa-plc.com 77
EUR PA 2023 Catalogue Empty Control Station Enclosures Metal Empty Control Stations with Shroud (IP65) Plastic Empty Control Stations (IP65) IP65 rated when installed Part Number Description IP65 rated when installed / Complete with protective shroud to guard against accidental operation of the switch. RC1P 1 Hole PG16 x 1 cable entry (on top). RC1PY 1 Hole (Yellow Lid) Part Number Description RC2P 2 Hole RC-1MS 1 Hole H: 72 x W: 72 x D: 57mm RC3P 3 Hole 2 Hole RC4P 4 Hole RC-2MS H: 112 x W: 72 x D: 57mm N/C Back Mounting Contact Block for Plastic RC-3MS 3 Hole Control Stations H: 142 x W: 72 x D: 57mm RAS-BCBNC RAS-BCBNO N/O Back Mounting Contact Block for Plastic RAS-CBNC N/C Collar Mounting Control Stations RAS-CBNO N/O Collar Mounting Metal Empty Control Stations (IP65) Plastic & Metal Empty Control Station Enclosure Dimensions (mm) Measure 1 Hole 2 Hole 3 Hole 4 Hole H 51 W 68 L 74 104 134 164 IP65 rated when installed / Cable entry top & bottom W 1 54 Part Number Description L 1 38 68 68 128 MoCtoornIStnrtdoaerl txGeersarand RC-1M 1 Hole RC-1MY 1 Hole (Yellow Lid) RC-2M 2 Hole RC-3M 3 Hole RC-4M 4 Hole RAS-CBNC N/C Collar Mounting RAS-CBNO N/O Collar Mounting 78 Sales: 01582 692 440 Legend Plates are included with each control station Technical: 01582 692 444
2023 Catalogue EUR PA LED Lamps 22mm LED With Lamp Test Facility (IP65) Multi segment / Long life: 30,000 hours / Low temperature 24V & 110V AC/DC / 230V AC / Complete with locking nut Current rating 20mA 16mm LED Pilot Lamps (IP65) Part Number Description Colour Part Number Description Colour RADT221B White (with test) 24V AC RAD161B White 24V AC/DC RADT223B Green (with test) 24V AC RAD163B Green 24V AC/DC RADT224B Red (with test) 24V AC RAD164B Red 24V AC/DC RADT225B Amber (with test) 24V AC RAD165B Amber 24V AC/DC RADT226B Blue (with test) 24V AC RAD166B Blue 24V AC/DC RADT221F White (with test) 110V AC RAD161F White 110V AC/DC RADT223F Green (with test) 110V AC RAD163F Green 110V AC/DC RADT224F Red (with test) 110V AC RAD164F Red 110V AC/DC RADT225F Amber (with test) 110V AC RAD165F Amber 110V AC/DC RADT226F Blue (with test) 110V AC RAD166F Blue 110V AC/DC RADT221P White (with test) 230V AC RAD161P White 230V AC RADT223P Green (with test) 230V AC RAD163P Green 230V AC RADT224P Red (with test) 230V AC RAD164P Red 230V AC RADT225P Amber (with test) 230V AC RAD165P Amber 230V AC RADT226P Blue (with test) 230V AC RAD166P Blue 230V AC NB: This range of LEDs offers a Lamp Test (or push to test) facility 22mm LED Pilot Lamps (IP65) enabling individual or groups of lamps to be tested from a single push button by the application of a test voltage without interrupting normal operation. Will fit all 22mm LED with Sounder Sound Output 80DB standard control Flashing LED stations With Buzzer Part Number Description Colour RAD221B White 24V AC/DC Part Number Description Colour MoCtoornIStnrtdoarel txGeersarand RAD223B Green 24V AC/DC RAD22SM4B Red 24V AC/DC LED Buzzer RAD224B Red 24V AC/DC RAD22SM5B RAD225B Amber 24V AC/DC RAD22SM6B Amber 24V AC/DC LED Buzzer RAD226B Blue 24V AC/DC RAD22SM4F Blue 24V AC/DC LED Buzzer RAD221F White 110V AC/DC RAD22SM5F RAD223F Green 110V AC/DC RAD22SM6F Red 110V AC/DC LED Buzzer RAD224F Red 110V AC/DC Amber 110V AC/DC LED Buzzer RAD225F Amber 110V AC/DC RAD22SM4P Blue 110V AC/DC LED Buzzer RAD226F Blue 110V AC/DC RAD22SM5P RAD22SM6P Red 230V AC LED Buzzer RAD221P White 230V AC Amber 230V AC LED Buzzer RAD223P Green 230V AC Blue 230V AC LED Buzzer RAD224P Red 230V AC RAD225P Amber 230V AC RAD226P Blue 230V AC RAD-ADD22 Spanner sales@europa-plc.com technical@europa-plc.com 79
EUR PA 2023 Catalogue Xenon Beacons Point of Sale High Profile Xenon Beacons IP67 (When installed) / Height: 95mm Width: 76mm / Flash rate 75 per min Part Number Description LT4XMV/2 2W Multi-volt 10-100V DC / 20-72V AC Amber LT4XMV/2RED 2W Multi-volt 10-100V DC / 20-72V AC Red Low Profile Xenon Beacons IP67 (When installed) / Height: 45mm Want to display Europa goods? Width 76mm / LP1 flash rate 60 per min LP4 flash rate 75 per min We can advise you about products and displays suitable for your shop floor. Part Number Description • Eco-friendly solutions LP4XMV/2 2W Multi-volt • Aesthetic, attractive design 10-100V DC / 20-72V AC Amber • Save money on a range of adaptable solutions • Full support & guidance on bespoke solutions LP4XMV/2RED 2W Multi-volt • Compact - both front of counter & warehouse 10-100V DC / 20-72V AC Red • Combined POS/bulk - enabling cost effective POS MoCtoornIStnrtdoaerl txGeersarand LP1X230/2 2W 230V AC Amber Bespoke profiles mean more space to stock faster moving lines - resulting in higher sales. LP1X230/2RED 2W 230V AC Red Traditional stands are also available as is a wide variety of control gear products, supported by large stock holdings. Accessories for High / Low Profile LED & Xenon Beacons Contact your account manager to discuss the options we can provide. LPFX2 Mounting Base 521058 for LP & LT Beacons sales@europa-plc.com 01582 692 440 Sounder + Pole for LP & LT Beacons 72dB 12-24V AC/DC 80 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Time Clocks 7 Day Time Clocks Dual Mounting 230V Timers - Panel or Din Rail Mounted ET1624HD (Surface or Din Rail Mounted) 12 (Din Rail or Surface Mount) Digital A 3 module 1 channel (1N/O + 1N/C Panel mounting instructions contacts) timer with up to 16 ON/OFF • Remove lid by undoing the fixing screws periods can be set for each day of • Cut panel hole: 67 x 67mm the week. Any one period can be set • Locate the main body of the timer under the panel between 1 minute and 168 hours. To • Connect the terminals as required beneath the panel simplify the setting of the day or days that are required there are a number of (Before re-attaching the lid) preset combinations of days within the • Secure in position by re-attaching the lid, sandwiching the panel programme. Manual Summer / Winter adjustment. Battery back up. between the lid and the body of the timer • Using a screwdriver turn out the secure holding tags Part Number Description ET1624HD 16A (AC-1) 230V AC 7 Day 24 Hour Digital ET167D2C (Din Rail Mounting) Part Number Description (Din Rail Mount) Digital A 2 module 2 channel (2N/O + 1 ET1624HAPM 24 Hour Analogue 2N/C contacts) timer with up to 44 (15 Minute Segments) memory settings. 24hr (1minute) (Panel or Din Rail Mount) ON/OFF periods can be set for each day of the week. Ideal for switching 2 ET1624HDPM 7 Day Digital 1 Channel 16 Period lighting or alarm systems. Channels (1 Minute Segments) independently programmable. Auto (Panel or Din Rail Mount) Summer / Winter adjustment. Battery back up. 24 Hour Time Clocks ET1624HA (Surface or Din Rail Mounted) Part Number Description ET167D2C (Din Rail or Surface Mount) Analogue 16A (AC-1) 230V AC A 3 module 1 channel (1N/O + 1N/C 7 Day 24 Hour Digital contacts) timer with 96 segments on the wheel, each segment relating to 15 minutes. ET167DYD (Din Rail Mounting) Any segment can be used to operate the time relay either in discreet 15 minute (Din Rail Mount) Digital intervals or in multiple blocks of 15 minutes A 2 module 1 channel (1N/O + 1N/C together. Battery back up. contacts) timer with up to 16 ON/ OFF periods can be set for each day of Part Number Description the week. Any one period can be set ET1624HA between 1 minute and 168 hours. To 16A (AC-1) 230V AC simplify the setting of the day or days 24 Hour Analogue that are required there are a number of preset combinations of days within ET1624HEA (Din Rail Mounted) the programme. Battery back up. MoCtoornIStnrtdoarel txGeersarand (Din Rail Mount) Analogue Part Number Description A 1 module 1 channel (1N/O contact) ET167DYD timer with 96 segments on the wheel, 16A (AC-1) 230V AC each segment relating to 15 minutes. Any 7 Day 24 Hour Digital segment can be used to operate the time relay either in discreet 15 minute intervals NB: See pages 82 - 83 for staircase timers, multifunction timers and relays. or in multiple blocks of 15 minutes together. Battery back up. Part Number Description ET1624HEA 16A (AC-1) 230V AC 24 Hour Analogue sales@europa-plc.com technical@europa-plc.com 81
me setting potentionmeter--TRTiimemleaeysscscataalleteu0s0..1i1sssin--Wd11i0c20ad4dtae0ayd:ysAsbdCydiiv/LvDiEiddCDeed.1di2innVttoo-2114000rraVannggeess.. --R1e-MlaOy DstUaLtuEs,DisINindraicilamteodubnytinLgE.D. me deviation 5%-mechanical setting G E YA E L E C T R I C A LGGAdEEd:YWYAeAnzE■hE■oLL-uMMEB1GEoroCi-gCRdMdeTeTTIenORldR8luaDaIsICntCnUridaAdALl ZcLEcLoono,CenDCn,BnOnIOeNoio.b.t,at,arLiaLxa2tiTatTii:inolD2oDgmn×nTooSwunP,nDtinTg. ■Model and connotation 01 / □ Rated control supply voltage: A230:AC230V W240:AC/DC12V-240V Number of contacts usGtpRiuTot8an-EtMuMre coecient 0.05%/℃,at=20℃(0.05%℉,at=68℉) GEYA2E0LE2C3TRCICaAtaL lCoOg.,uLTeI:FMaox:b0il0e8:060-58767-1-632576171777501207 GRT8-M1 sU(mmR) PA FunctioDnismDeinasgiroanms(mm)DI:MEo-mbialeil::0s0a8le6@-1c3n5y6e7y7a7.0c2o0m7 EW-meba:ilw:swawle.g@ecynay.neeyta.com 1×SPDT 2× DimensionWeb:www.geya.net epeat accuracy 0.2%-set value stabilityAYdude:qWinegn,zZhhoeujiBaGnriggR,eCTIhnid8nuas3tr2i5a6l Z0o3ne,Beibaixiang Town, 2:2×SPDT Add:Wenzhou Brige Industrial Zon YTueel :q0i0n8g6, Z- 5h7e7j i a- 6n2g7, C11h0i n7a9 3 2 5 6 0 3 MuRltaitfeudncocnttiroolnsutpipmlyevorlteaglae:y eGmRp eTr8 - TFeal:x0:008068-65-7577-76-267217110177951 RatAe2d3c0o:AntCro2l3s0uVpply voltage: Yueqing,Zhejiang,China 325603 Add:Wenzhou BrigTeeInl:d0u0s8tr6ia-l5Z7o7ne-6,B2e7ib1a1ix0ia7n9g Town, GRT8 SeriesAW223400:A:ACC2/3D0CV12V-240V W240:AC/DC12V-240V S P D T2:2×SPDT euvrrenet ralRtienclgayos ntrol relayPanGe1lR6DA/LiAaCg81ramLatching Relays Wiring Diagramaall tions M2u:l2ti×fuSnPcDtiTon time relay Yu e q i n g , Z h e j i aPnagn, CFe lhaDixni:aa0g30r2a85m66 0- 53 7 7 - 6 2 7 11 7 5 1 MGuRltTif8unScetriioens time relay Tel:0086-577-6271M10o7b9ile:0086-13567770207 GRT8 Series Lswi-neMit.tbc1rvhreiunaegkMcivnlogutlctlcatiaigoopFeaucnnniGtcyttRiDMorTCn8o-TaMilm2nerrues al al y G R2L508V5A00Cm/2W4VDC GRL8-01 2 level controlaarraammeetteerrssvuhinhoonecenlcattasatitiotigoinnnenggt),ti.,immmmeoeotrtroeoerlrlasas,y,ypcpcuauamnmnpbpbseseauaunsnsdededfdfaafnfonosrsre(e(1l1le0e0ccftfutrurinicnccacatltilioaoanpnpspsp,l,li1ia1a0n0nctJctiJeime:m:sse,e,crcraoaonnnngtgtreroeoslsl,o,off 12FMEW-a-oemx2bb:ai40:lwie0l0::w8s0V6aw0A-l.8eA51g6@7eC-7y1cA/-a32n6D.5y2n6Ce7UeEnC7yEW1t L7Ra1-0 7.1e7mc 05boR2a1 m:0wi l7:w s awl .SeOgu up@teppulytyiicnnaddniicc.aaynttiiooeenn((gryteredae) n.) co m PPaanneell DDiiaaggrraamm Latching Relays nutsputt rinudiccattioino n M a n u a l red LEDMulti Function Timer 0-10 Days 16A 12-230V AC/DC ncnoctFtliFtioeoaenangastsetu:u:)r.-re--e5s54stttiimimmeeefGffuGuunnnRcRcctTttiTioioo8n8nns-ss-McMccooAo1n1nn,tBttrrro,ooCllllel,eeDddd,bbEbyyy,sFscu,uoGppnp,ptHlrlyoy,Ilvv,iGoJnGolpltRtaRuagtgTTee88--MM22 Max Min Supply indication(green) Supply indication(green) echanical life G e nGe rea1n×l 1e0r a lA,B,CA,D1-,EA,2F,G,H,I,J MUnax Technicaloshrecrettsaasa.bl.bellee0a.a1--n-n41ds1dtf-wfiwuum1enen0lecllcl-dt-ftaiuaaioornrynrnrascaoAnotdAnifAgfoCiglCvlaenCae/itd/sDdtdcD0cecfhCf.huCAdou7iinn1nn,-i1gcBn3t2gc2rttV,rti-oori-oCe2oeAl2Anll14,Anlea4/Da010Dady10ay-,nVr-CnVEbAaAd(dy(,n2502Ft5gcti0.,im0o5emG--n6s-e6e,1.t0-Hr0-r.Hor7a,HaIlnWz,nziJgn)g)epeussteettttiinnggbbyyrroottaarryy Un R Un R U1n0m 1h 10h R UP DOWN 1toff 1toff PUMP U n 1h1101m11s0m10ssm 1h 10h 1d R Output indication(red) 1ton 1ton Technical Data: Latching Relays ECLR01-02 10d Output indication(red) 1m10m1s 505016d06O1O00OF7ONdF0F7N80F08900 22 eescetrtitciamlelife(AC1) ■mA1ap×xp.1l2i0c00amtios nsD0.C7-132V-A24/D0CV(05.05--610.7HWz) ■ApplicationsDaaDscnsnUntUatdacdaLlLteectuEcuEos0o,s,nD.nDi1nisInsINosNiointntar-daraAdt1aAitiiicCio0ilcColamnamdntmtmeoaeodauydauxsnbxnb.tyd.t1iAy1ininL2vCL2ggEiVEA.dVA.0DAeDACC../d7./121-2i.n33.333t0VW-o0W1VAV15(/0(D5%50rC0a;-+-n6061g0.005eHH%s-Az1A.z)C.)C7mWmaaxx..1122VVAA//11..99WW4010h Sensitivity 40 60 95 30 1d 230040 10d 20 80 95 10sD120100E F G 90 ON Time setting 5 6 100(kΩ) DiagGArdaEdm:WYeAnzhEoWLu BiErirnigCgeDTIniadRgursIatCmria:Al ZLoneC,BOeib.a,iLxiaTnDg Tow Time setting 4 Wiring 2 Tt -Designed for monitoring level in wellss, basins, reservoirs, taAC 230V(50-60Hz) ■ -Designed for monitoring level in wellMssin, basins, reDseimrveonisrsio, ntasn(mksm..)...nce -1g5r%ee;+n1L0E%D 8 95 BCBCAD E F G1HIsHJI OFF Functions Diagram0.1 10s GEYA ELECYuTeRqiInCg,AZhLejiCanOg,.C2,2Lh2iTn4aD325603 A 40 50 60 70 Add:Wenzhou BrigTeeInl:d0u0s8tr6ia-l5Z7o7ne-6,B2e7ib1a1ix0ia7n9g Town, J 30 80 perating temperature -20℃ to +55℃(-4℉ to 131℉)Function Features Dimensions: 16 1Rated control supp0ly.v1oslt-ag1gre0e:deanyLsE,ODN,OFF Le■veFul nccotinontrFoelartuerleasy GRL8VA/1.3W AC max.12VA/1.9W -In one device you can choose the following configurations:RaAtWAe22d32304c0:0oA::nAACtCrC2o23/lD30s0CVuVp1p20lVy.-v21o4slp0t-aVo1gte0e:dnatiyosn,mONet,eOrFF Function setting Yu e q i n g , Z h e j i a n g , CFhaixn:a03028566 0- 53 7 7 - 6 2 7 11 7 5 1 Function setting 20 90 Tel:0086-577-6271M10o7b9ile:0086-13567770207 torage temperature -35℃ to +L7e5v℃-eIn(l co-2on2en℉tdrteoovl1irc5ee8l℉ayy)ouGRcaLn8 choose the following configurations:- 2 level control mod 11-14W240:AC/DC125V%-24-pm0Voetcehnatinoincmalesteetrting FMEa-omxb:ai0lie0l::8s06a0A-l8e51 6@7-71cA-32n65y26e77yEW17a1-7.e7mc05bo2a1m:0wil7:wsawl.eg@eycan.yneeyt a.c o m 10 GRL8-01 2 level controlGRL8-02 Instruction Manual-15%;+10%2:2×SPDT 50%.2-%m-escehtavnailcuael ssteatbtiinligty 21 GRT8-M1 E FG GRT8-M1C H mo)unting/DIN rail Din rail EN- 2/IEleCv6e0l 7c1o5ntrol mode-I1nsletvruelcctioonntrMolamnoudael 11-12nt D I Web:www.geya.net m) - 1 level control modegreen LED -Choice of function PUMP UP, PUMP DOWN.t GMGMRuR2ulT:tlT2it8fi×8ufSuSnSnePce1crtD0riite0×oiiTeo.sn.s0n0Sti5tmi5Pm%0e%eD.r/re2/℃Te℃l%alay,y,a-astt=e=2t2v00a℃℃lu((0e0..s00t5a5%b%i℉l℉it,y,2aa×tt==S66P88D℉℉T)) J Max Min B 12 CL Un L Un R rotection degree IP40 for front-pCahnoeli/cIPe2o0f tfeurnmcintiaolns PUMP UP, PUMP DOWN.0.1s-10days,OPNan,OelFDF Wirin-gAdDjiuasgtarabmle time delay on the oGutepnuet r(a0l.1 - 10s).1×SPDT 2×SPDT A General UP DOWN 1toff PUMP Max 1toff 1ton 1ton ■■AF--IupDn-npe2o■■clsinltceiiegAFao-v-nItnduepDineoelFnpdnevcoeclsiosinacftcnoieitegaoutrryrntnomdeoileoesuoFmdnnvceoisiatacdfonoetrucirnyhrmgoeolosuo1es4vnceeiattlhoinne1r1ciwfnoh1egl1ollol-Msl1oAwesi14sni,vSnebegASGea0n2.221RstlitciL24vs5h0it8yio-i40n60en2n821600ssT81wf0t0f0(,ikΩog) reuelllrsolasewtsrivoi,nonbisgra:sc,stoia2nBAn111ns2fSk2,isg2ABr4.22u.e..rs.aetri Panel Diiaaggrraamm Wirin-gSDeniasgitrivaimty adjustable by a potentiometer (5-100kΩ).2501V6AAC/A/2C41VDC 16A/AC1 perating position -Aandyjustable time delay on the output (0.1 - 10s).potentionmeter -Galvanically separated supply voltage AC/DC 24-240V. LOAD 15GyRDTC8-M2 voir s , 250V5A0C0/m24WVDC ons : tanks..... yRDTC8-M2 5r0e0dmLEWD ovlelurvtioolntadgeegcraetehegory solid wire max.1×2.5or 2×1---.SGR5ea/ewnllviasthaiytnsislviectieatavyetlulamysdasxijs.ue1×spinta2ad.rb5aic(ltAeaeWtdbeGysd1ua2bp)pypoLltyEevDnot.ilotamgIeet tiAserpCo(/5sD-sC1ib0l2e04kto-Ω2c4)o.0nVne. ct load%50%./2℃-%m,a-est=ceh2t av0a℃nliuc(0ae.ls0st5ea%tbtii℉nlitg,y at=68℉) ■ -- R1-eMlaOyDsUtaLtuEs,DisINinrdaiicl amteodunbtyinLgE. D. 4.2GRT8-M1re 4.2 - 1-MODULE,DIN rail mounting. (e.g contactor , control of lighModel and connotationxe.12VA/1.9W Wiemigehntsions 1×SWPDirTi:n■W90g2×4D01-8i×6a26gg4,Amr2am3m0-60g doef rveiclaey, (wloitahdoiust ednisetrugribziendg wahcPDT 16A/AC1 2×SPDT GRL8 01.12VA/1.9W re1d×LE10D ----CASG-deha1jnoluvlsiescai--vttenaCiAevi--obclidhtfla21cyejoflouulalltyineeniscdmtscvvterjueaoteeeisploobdlltmanfaleccreobfPlaooaudlttUeynneniemMdttobcrrnyPsooteiuatlloUhdpmmpnePpeo,loooPltyPaeuddUvUnyt■eepotMMMioulotoPta1nPmd1(geD0t-eeUl1h.1Ota11A2eePn1Wr-C2d,o(11cN/5P4Do0u11.-42nUsC1tn)p0oM.1C2t1u0a4ktPti-oΩ2(nD04).0.O1VW.- 1N0.s1)1.12 14 -20℃ t1o1U0m11U11s0ms01n1sms0+nm15h13h0m51m01h℃011ah11ad1×O1×dO0xO1×FONd0x(FFNdF.811.R201R2-0004000℉0mmtsos 131℉) R1-eMlaOy--DSGsUteaaLntluEvss,aiDtinsiIvNiicnitradFyailuicllanyamdctsetojiuedouFspnnbusttaynianDcrLbgtaiEia.oltDegnesr.dbaDmysiauagrpappmo0l1tye/vn□otilotamRgaAteee24d3t0.cAe:2oAnCrCtr2o(3l/05sDVup-pC1ly0Fv2ou0lt4ankgce-Ω:t2io4)n.0s VD.iagram: I-P--33245500℃℃℃fDoDtttoirooinnf+BCr++BCrADro7aD12750a0312E00n50iE55il℃tl℃℃FEFEpGGN(HaIN((HI 8n/90-/0I9--0Ie2E24El2C℉/2C℉I℉P66t2o0t0to0o71711t131e55515r8℉8m℉℉i)n))als 16 18 - IP40 for frAont paanneyl/IP20 terminals 16 18 - ■Model - Relay status isEGiCRnLMdR80i-0c11ated by LED.EGCRLMR8W-0022240:AC/DC12V-240V -an1d-McoOnnDoUtaLGtiRoEMn,8D-0I1N gG.R M 8 - 0 2N u m b er of contacts rail m o u n t i n B1 B2 EN 61810 / EN G6R10L810 01 2:2×SPDT B1 B2 Model and connotation ON.)ry any B1 B2 B1 B2 LOAD 15 IPD4e0sifgonr nfruomntbepran■eMl /odIPe2l a0ntdeDcreomsingninnnou11am-t1a4blsetrio/nRated currentR1 16A R1 LOAD 15 11-14 11-14 2×SPDT: W240- 82g,A230 81g250VAC/24VDCry GRT8-M1 SPGDRTL(8ECL0R111G-10R4L18 )S /eri 2es R2 11R-2111R4-224 AC-1 Output: 1 x SPDT 21-24 G R L 8 0 1500mW,at=68℉) solid wire max.1×2.5GoRr T28×-M1.15/with sleeve max.1×2.5(AWG 12) x (ECLR02)R1 It is possible to connect load between SM-AG2oRdLu8leSweirdieths : 11-14 R2 R2 I(teis.gpcoosnstiabcletotor ,ccoonnnteroclt olof alidghbteotwr aeneyn oSt-hAe2r 17.5mm / Din rail mountingD 21-24 21-24 i mDenessiiognnsn(mummb) e (dee.gviccoen, twaicthtooru,tcdoisnturorbl oinfgligahctoorreacntyguonthcetiProanrt Number r Panel Diagram dooOeffNrvreie.cl)laeay,y(w(llooitaTahddoeiuiscst edheninsneetruirggcribizzaieneldgdpwawhachioirllereartethmhceetegssuwtwneiitctcrcthishEoinCiss LR01 Disposal of ElectricPaalnWelaDsiatgeram: tandards IEC/EN 61812-1,IEC/EN61010-12a×t=S6P8℉DT) solid wire max.1×2.5or 2×901×.51/8w×ith64slmeemve max.1×2.5(AWG 12) DiDmeenssciorniGsp(RmtLimo8D)Snimereienssions: All electrical wasteSusphploy iundlidcatbioen(green) red LEDWiring Diagram×SPDT Disposal of Electrical Waste CautionWiring Diagram Design numberEN 162×1×8SSP1P2DDTT::WW224400--6822gg,A,A223300-6-801gg AC/dDisCpEoCLsRe01d of in compliance with 1×SPDT:9W0×24108-×626g4,mAm230-60g 16A 1PECLR01 C/O 12 - 240V ON.) CP/aOne12l D- i2a4g0rVamAC/cDuCrrUen nt WER EE regulations. current 16FAunc/tioAnC-1 Output indication(red) All electrical waste should be The products must beDiisnpsotasallleodf bEyleqcturaiclai1×10 Panel Diagram:IP402IE×fCoS/rEPNDfrT6o:1Wn81t224p-01-a,I8nE2Ceg/,lEA/N236I0P1-0281100g-1terminals / GRELC8L-0R102 GRL8-02 2 level contorl mode c2hndcicuisarprleopnsteaWdr aoEmfEineEtcreoeGrmgR-s-u1L1p-l-8lai-at0ino1 cnes.with GRL8-02 Level C-o1n-tatrhoPnelyaRaeneplleaepylcrsotDrpiicraaiagl tcreaoPsnmaanfeencteAdcytuillislorsperDtneolaensisncateotdWdrgfiacoErtarfhaEdlienEwmsc.atrioe:smmgteuepsllarhiate0℃ to +55m℃1a×x(.12-400℉0mtos 131℉) Technical parameters GRL8 Series Panel DiagramaE5E1fl℉i8l℉iEnEw℉EnEw))l)calrceareoesoecscmgtmgtteteururppislislclaclahihiaataatoioilnolnouuW1McnWcnlEPlPedsedsaoCaa.w.bcswdbIsrMEhetiteutiCtetaehFNlh/eEnTNugwm6ei1od8bv1teh2er-:r11,cIE7oC.n5/EtmNa6cm11t1066/1/110818D-10intiMDrmTCataCTatehhuniheanhlseaelyeuyctemfuaiuraetpetpipiTonpliproleropieoupcomtncrncdtnirdotoioteuroturpniiprcicnncrcrt0aitsgaisasa.ll1t/mtcmece8oSoususnenstasanictnftmfeebeeb-cteectey1tyFStiir0iiosnuuosnatnpnstnnDsacpaVSSVIStsntstgnaleoouuaniapynolloppdelttuoysdlaatppnltfileeasgsgtlfleaiyyrvetedrtmitvhdrtiehrdyondareibl(ensmnbetsiagynal.ityegn.eptilceiausqmtqmtlrtsuoroueeldeesaaeirsrlsartlieaniefnfcililceeaeaeEd)yEdysDesDehlhlSeSeaac2c1l1lltltlr1Gcer1ci1iavco7cRo7d6eimj6imalu6LaAcs-np18C-ntop0a0sl/n8-bslDy0y0.lt0.eCoAw11Aiwr1m-2nlm1l4ialrm5lAita-laxt%2ha1xnh.oa4-.A;gn2dA+0neCVVe21dAd5A0(551%kV0Ω--A6-2100H0z2)kΩorRated16AECLR01952P 2 or 1 level contorl mode 95 11 12 14 GRL8-02 4 . 2U n R Un R UP DOWN 11 12 14 1toff 1toff 1 level contorl modeExample 1ton 1ton PUMP 4.2 Ex aamctpulaeSteinongfsitoli2ivgn0itheytoin4f0gthse6ys0set8ec0tmionwshRic1haanldloRw2s control Soloefnc2slaiigttii2hvo0ittny iinn4t0ethnes26irt0oyom. by from any 80 Level Control Relays 24 - 240V AC/DC ction 2 level contorl mode 2 or 1 level contorl mode58℉) ℃ to +75℃(-22℉ to 158℉)rminals http: / / www.geya.netVoltaCguerrernatningeprobe 5 100(kΩ) 5 100(kΩ) Double Delay Timer 12 - 240V AC/DC ply terminals A1-A2minals http: / / www.geya.netInpuTt ime response 46 nic a l pa r a m e t e--22r--s0 foDrinfrroanitl EpaNn/IeEl/CIP62007t1e5rminalsatge range AC/DC 2m4a-2x4.20VVA(50-60Hz) Dimensions(mm)max.1×2.5(AWG 12) SuppMMlaayxxv.. ccoaalpptaaaccgiitteyy loteofnplgertorhbaenccaeble GRL8-01 GRL8-02ax.1×2.5(AWG 12) P a ne l Dia gr a manyply voltage tolerance -15%;+10S%uppLlOyAinDdication(green) 1560g n 2 level contorl mode 2 or 1 level con-to2rl m-ode Wiring Diagram801gg sitivity ( input resistance) adjustable in range 5 kΩ -100 kΩ8110g-1 tvstieiryopnnarlo(mneptiangnlriegsonepceebautetlrtsoroeldeseirssatannccee) adjuAsCta/bDleCimAm-2nm14Caar5Aa-axxW%2<1xn..40-.A;g4i2A+0.re0C1VV12i05Am0n(55m%kgAV0Ωs-D6-10i0Ha0zg)krΩam Dimensions(mm)×C×SS/EP2P--.N1DD15--T6oTr:1:2W89W×102212×44.-01150/-,8-Iw×6E8i22tC6hgg/4,E,sAmAlNe22me633v10e00--m681a010xgg-.11×2.W5(WAirWiirnGing1g2D)DiaiaggraramWmirinI(doOteefgNi.srvgeD.ip)ccliaoeoays,ng(swtlriaobiatcalhmetdootiruos,t eccdonoisnentnrtugreroibczliteonldfoglawiagdhhcbiotleeorrtrtwehaceentegsynuwonSittch-ctAehior2ins Un WirWRinirgingDDiaiaggrraamm: Unpeeea..rpeauccgrddencaateeeeyrtppsalliiiaaanapnntuccyyosepriientt(aelrtyytestof)ictloncebeeogtfenrrep(ogpmrcdtooeiheebwcsnheeatcrnaiocbnalle) 480000nmF ((0ss.ee0nn5ss%iiatti/idv℃vijitut,yyasmAm2tt2=aC55aa1b2k±kxx×<l01ΩΩ..e0℃.A4S,)5)5.,,00C1(Ps2%010.Dm550.0mTTOT0T00A-Viii51ummmsmn%t0peeeFu211℉(ss(trsrse,iaaenennntdantggsiitcnseei=tagiisst6tviieev8oitttin℉ttytii(ynn1r)gge10d00)0kkΩΩ) )10-1 Wiring DiagramACA/DCC<02.14-m2A40V(50-60Hz) Example max. 400 ms (sensitivitPy a1g0e01koΩfEb)1yxaamctpulaetiEnougf reool-LipgnmaheatoHiiln:fogtsuhasseleeysss,e@tAecitmreipouonrwrosthpRWiac1chaoayman, ldLlpouoRwUtn2osenfnnr,cotoBsmn.ectdaorosnm,lyL/oloUfwc2leaigbt9ihosN0tRni.H2t1eiinn:tTethhentelts:pir0t:oy/1/o8w51m08swT.2wt 6.9e2ur4o4p0a/coFmaxpUU: Po0nn1e5n82ts6.c9o2DmO4W50N R EDS1180-002 (sensitivity 25kΩ), 200 m mmax.2VA800 22 24 LOAD -15%;+10%400 nF (sensitivity 25kΩ), 100 nF (sensitivity 100 kΩ) 1toff 1toff LOAD 15 R2 R1 R2 1ton 15 A1 S A2 1ton PUMP SensTitimiveityd1se( lianyp(ut)t resOisFtFance) adjaudsjutastbalbelei,n0r.a5 n-1g0es5 kΩ -100 kΩ B1 B2 Sensitivity 40 60 22 VoltaTgimeeindeelale3y0ca40tftre5o0rdp6e0o7sw08e0r on Sensitivity 40 60 1.m5 as x. ACU5 Vn LR GRL21 22 24 8-01 Un20 G80 RL8-02 R It is possible to connect load between S-A2 CurrAecUncutnriancypin2r0soebttieng (mecRha90nical) 5 100(kΩ) 20 80 I(teis.gpcoosnstibalcetotor ,ccoonnnteroclt olofalidghbteotwr aeneyn oSt-hAe2r ±A5C%<0.1 mA A1 S A2 11 12 14 UP R2 DOR1WN R2 21 (dee.gviccoen, twaictthooru,tcdoinsturorbl oinfgligahctoorr eacntyguonthcetiron 0.05%/℃,at=20℃(0.05%℉,at=68℉) B1 B2 GRM8-02 doefvrieclea,yw(liothaoduist deinseturgrbizinegd awchoilrerethcetgsuwnictctihonis 5 ~100(kΩ) oOf Nre.l)ay(load is energized while the switch is 1×mSPaDxT. 400 ms A1 A2 ON.) MTiamUxe.CTOnc1e1uru0mamer1str0ppsepmuapnetctr1oahrintat1yu0st1irlne0eehgcn1odg1ROe0tNdchientt1 46 1toff L 1toff 2L 8 Tt 1ton 1ton PUMP 0.1 10s MTiamxm1e.MS0mcwdina1ie1s.tphbclaahreicy13na00igh4t(ky0t1ivn)d1oo5g00lfdtca6pa0gOrpteoF7a10Fb8c0eitycDabCle 800 m ((sseennssi2iatt5iidvv01ijiV5tut0yAy0As0C2t2/ma/A552bWCk4klΩV1ΩeD,)),C,0S21.e500n00-s1imtni20v0Fi(stys(se4en0nssiti6itv0ivit8iy0ty110G21R1100M212208-k210442kΩΩ11UUtto)oPnfMnf )ax Min 2 2A1 S A2 A1 S A2 400 nF Sensitivity 40 60 R ~ DOWN 20 80 1toff PUMP B1 B2 1ton ATTeci mcmu1seOMERsrpa1ledueeecm2s1tceyrc03p0eh0atmliu4rtanat0i1t2tcuny010isia5mnhire0caledetal6tifiic0lfctO1neOlea0F7oigN(hf0FtreAi1e8(o9d0pmC10cn0o1eidew)c9nh0eatt r2n iocna l ) re1d×L1E0±D1. 22 1×10 Sensitivity 40 60 5 s 5 100(kΩ) 20 80 95 5 100(kΩ) GRL8-02 21 22 24 5 % GRL8-015 100(kΩ) Caution C4 D6 isposal of Electrical Waste 2 Al8l eTtlectrical waste should be 6 The products must be installed by qualified electricians. All and 4 11an1y2e1le4ctrical connections of the time1r1el1a2y s1h4all comply with Min Level0.1 dis10sposed of in compliance with the appropriate safety standards. 0.05%/℃m,aatx=.22000℃ms(0.05%℉,at=68℉) Maxcurrent WEEE regulations. 2 8 Tt MSCOwuiunritm1.tr1spsbcOSMPO0emu1hrtrnppo0oo1et1iseeut013srntah0raernr4agakagct012titte0in03itivi1nn5n0iog00ton4gghgen/01lgD6mtptdd0cO1e5aOIo0epF07NmaNdgs0Fge8pip6rerrt00OaeieaaOotF7iertNlc20Fnua8ir9t0tue0yr -20℃ to +55℃(-14×℉StoP1D31T℉) GRL8-02 http: / / www.geya.net e -35℃ to +75℃(-1202A℉/toA1C518℉) 12 C 0.1 10s UP D DC Din rail 2E5N0/IEVCAC60/72145VDC -2- D 2isposalleofvEelelctcriocanl Wtraostle Un IP40 for front panel/IP20 terminals Un All elec1tr4ical1w1 aste should be A1 A2 installed by disposed of in compliance with 1toff 11 current WEEE regulations. CTlhaeeuvtpieroonlduccots nmtursot ble qualified electricians. All an a n5y 0 0 m W 1tonany electrical connections of the time relay shall comply with red LED the appropriate safety standAa1rdsA.2 solid wire max.1×2.5or 2×1.5/with11s××lee11vGe00mRaxL.1×82-.50(A1WG 12) OutpOuvteirnvdoiltcaagteiocnathegory Sensitivity 4.2 Max Min Max Min 2h t t p : / / w w w. g e y a . n e 20 40 C60 Sensitivity 40 MoCtoornIStnrtdoaerl txGeersarand MechPaolnluictiaonl ldifeegree Min 1G820 RC LL8e--v20e-2l 12 C 20 Electrical life(AC1) Max Dimensions 61g 90×18×m64amxm.200m81sg 5 114001(1kΩ) 5 ReseWt etiigmhet -I2E0C℃/ENto62+05555-℃1,IE(C-/E4N℉61t0o110-311℉) 14 11 -35℃ to +75℃(-A212℉ Ato2 158℉) 1 5OSLtpOoerAraSDagtateinndtgearmtdespmepr erat ure 46 atur e15 Din rail EN/IEC 60715 2 2 level control Un 1 lev0e.1l control Mounting/DIN rail pacity length 800 m (sensitivity 25kΩ), 200 m (sensitivity 100 kΩ)Wiring Diagrament rating pacity of probe cable -410-0 nF (sensitivity 25kΩ), 100 nF (sensitivity 100 kΩ)ching voltage lay (t) adjustable, 0.5 -10 sbreaking capacity DC lay after power on 1.5 sput indicatiCounrrent rating: hanical lifeLED Indicators in setting (mechanical) ± 5 %trical life(APCa1rt) Number /16IdAea/lAfoCr-1m, OulpDtie-escIrtsoaticnsattrpigroniopilsgnostfigibltoilgee2snhmtwto5ocpiro0toaf1ecn1Vnrr5n6ehr0yee11laAa0i11o651cAnytd81tt0Ch×u×115g(l/oel86iccIorLmsatrL1/ooaAed1iO11d25OrnsEdrL8eWAtbePCOOPDWSN0p0-r4OivseDoDco2r.otiipvAct)tlemaoVse1wlee0oDilsntnuguee,rferiDednbvaehtwlnc+iriclaogntetogstitiCtrhiliinhnioStoztdo5taoogenn-sdonguA5dcpreosdte2o°wofagednCc(rnsrhigneesaeyiie1rt.llaeugteeio6choyr1etttcbehnh115(loioeglen86onarg1oatsda1d5rdwa8cyebitivtseocictrhewe,ne,eewrngitihSszooe-luAdidOAIE1t2PwdwEPNCphioi2srCaiet-l6e0reurLm1r1rIttb2CahtPa86ixMeenN041t.1lg1riesg023×noumwavf-2IgiodmtEe.1cir5nCuhltfo/br/aelrcEoa2eElo9mnN×sr0rNtn61×ppw/.2tMM6a15e0rS1Oi1e/UnaUt81t0ood5noP.2n2r1wfsMn×faieni05tauin24lvti5al0yCit-t/61yxhhxt1trI404uPp,6e0:sIDm1lO2E-182rt1elMu1ot6W0of0-asmfe01nNCeTi817tPn0tvR0y1U0/t:(eMkE-e.ΩP,-5)m12Nramma60xdx81i.n1m10j+Sa×ug1LD1lP502.ss.-et5DDe1&5a(°vsTiAbCnceW2lCreGrliGLupa1serit2RelrPvi)eomneaLnnslgoi8tCteuir-ovan10inttt1ioytinnrfDAdcog/g2uilisl:lIsrpPer1peol4oe6nsc0stAetaWdrfElicroEouaofEfrelionE-nEwpmtlcaareaoespcHimglt:taeourMsp1A1uinsla2a41claxshielaateeoMA1iCllnos,1i2nuW@cnAledsiare.pwbsuoetirterohtpWacaoyGm, LpRuotnoLenn,8tBs-.ec0dos2m,95 ature coecient 0.05%/℃,at=20℃(0.05%℉,at=68℉)et time ECDD2T 1×SPDTrating temperature Double Delay TmimaexR.2el0a0y ms GRL8-02 2 x-210P℃C/tOo +55℃(-4℉ to 131℉) rating 10A/AC1 -1- Wiring Diagramage temperature Wiring Diagram:nting/DIN rail -35℃ to +75℃(-22℉ to 158℉) 12 C Un 1 level control Un Din rail EN/IEC 60715 2 level control 14 11 ng voltage82 Sales: 01582 692245400VAC/24VDC Technical: 01582 692 444ection degree IP40 for front panel/IP20 terminals A1 A2 A1 A2 500mW aking capacity DC
Function FeatuVroeltasge range -0.1 sP- a1n0ACem2l3i0DnV.(i5a0-g60rHaz)m -Relay status is indica1s ted byOFF LED. nrcoetary--RVAsoeCwllmtaiataycxgh.1se2taVarAnat/u1dn.s3g-fW1iegin5sr:%eeeAi;nn+sC1Lde0Ei/%DtcDAtaiCnCtmge1adx2b.-1-yb122Vy-p4AMoL0/1OtEV.9eWDDn, tU.ciolLamEme,DpteItNre)r:rmainl ma12003l04so0 5.u0 60n7089t00ing. aeymsetargtuesncisyinredsicpairtaetdorb,oyrLpErDot.ection of el. controlled doors--0.in1 csa-s1e0omf fiinre. ).ECTON Power inpEuCt TOFF Supply terminalsSupply voltage tolera ODULE,DIN rail mounting. -Time range (adjustable b-yVorolttaagrye srawnitgceh: aAnCd/DfinCe12s-e2tt4in0gVb,yclpaomtepntteiormientaA1-A2d-eTlaiymOeN range (SaudpjpulysindtdaeilcabaylteOioFnbFy Time setting uTnimcteiorna2Fn0geea2t(u3ardeCjsusatatbalelobgy ruoteary---0VRPs.oe1wllataisatycng-hse1etaa0rlnatumdnDsgifnieiins.:aeAingsCderi/tcDtaainCtmge1d2b---yb1R2y-pe4MolL0aOtEVyeDDn,stU.tciaolLatmuEmse,EDptiesItNrei)Unr:rmdaiicnlaRmatlesod.unbtyinLgE.PD. AVVBooullrttdaaeggnee rraannggee AACC/AD0C.C72-13320V-VA2(4/D500CV-(6050.05H--6z1)0.7HWz)TerOmOc---sNaNeVR1xp.-Ao1eiAfMrC2oCllaVta/ArOaD0AtCyo.CD/g71D2r-1.se33e3,2U-o0VtW1-larVAa25rLa(4/t%yD5up0En0;CV+sr-Og,(6o10D5RTTOT0e0.iF0t5esiiH%euImme:--mdANpF6ztE1peeAeci)e0Cp.nCul7asdHetaiCtrmWieTtdenrzyoaaatvaO)ti/OtciinicxuDacnFlc.Frtga1uaeiFmFCoo2rtcsanVefo1coeAeyde2/uc1oli-.en.b92nfWtcyti4vnoL0ognEVl.ttarDo,g.lcelelaPdfamadi1lp×0uno.0rSotee5eP11Ur0%m1051lsDss0rnm%.(/mT212℃De0103h0-%-4m0,mpi1a-5i0in0hoesnta16=dtce0eO1aOe0F7h2tNd0Fgnc8rl9av000Rstga℃nairo.lieucsn(a0aemne.lms0esct5teaoey%tbrtfii℉nllifiStg,ygi2rua×heptp=St)il6.Pyn8Di℉gnTd),ication(green) -0.1 s - 10A1m-Ai2nTi.me ranges -1-MODUL0E.1,sD-1I0Ndayrsa,OilNm,OFoFunting. Un R ures A1-Ag2reen LCEuDrrent rating 1h 10h 10m 1d 0.1 s - 10 min. -1-MODULE,DIN rail mounting.C/DC 12-204.01Vs(-5100d-6a0yHsS,wzO)iNtc,hOinFgFvoltage 1m 10d 16A/AC1 Wiring Diagram 10s ON Un 25R0VAC/24VDC 1s OFF SEinCgTleOFFuFnction Timers Phase Failure RelaysPower input AC max.12VA/1.3W AC max.12VA/1.9WC 0.7-3VA/DpCo0te.5n-ti1o.n7MmWient.ebrreaking capacity DC Voltage range: AC/DC12-240V , clamp terminals.adjustable by rotary switch and fine setting by potentiometer):AC 2305V%(5-m0-e6c0hHazn)icOalustpeutttiningdication 40 50 60 70 30 80 Supply voltage tolerance -15%;+10%n.2VA/1.3W0.2%-set vAalCuMemesactaxhb.a1inl2iitcVyaAl/l1if.e9W 20 90 1h 10h 500mW Output indication(red) 10m 1d red LED 10 1m 10d 10s ON 1×10 1s OFF 40 50 60 70 30 80 Relay status is indicated by LED.Technical parameters Panel Diagramdelay OFFe: Single Function Delay0A.0C5-%1/D5/℃%C,;a+1t1=202%0-℃2(4E0.0l0eVc5t%ri℉c,a,cl lliaafet=m(A68Cp℉1))terminals. Timers 1220 - 2T4im0e VsettAingC/DC Phase Failure Relays 10 90 1×10 ssTd:eFe1NmpAijs-nueifMrCErodsaaecCtri/OticaDloDTatbDhmCrOteel,Ueeo1onlFadrrL2ubyFpEi-nsby2crOt,yoir4DnoFtaL0IgetNFEVa.clrDtiry,inpoa.csnicllawaamomisErtfocepeCauholtn.TmeaftcDrinvnomdoOegnilP.nttfFartinaogaeFellselPenr.sdfesaaetditluniolnrogeDersb(leiy-amDipnegoEcirtgeaarCensagnTteiocmDorymfOalefigiFtrmeheFrt)i).n: g, P a n e l D i a gWr iarmi nPgaDniealgDrameters Panel DiWaPgairrnianemlgDDiaiaggrraamm WPairninelgDDiaiaggrraammWiring Diagram Functions DiagramHO-imWSTTSBVSF6n1zFii0guouuuuad).mmF7HnlxpprpetdWee.aclpppz1aetglll)rs1i2yyyynaoeeVxOivtnntnerAtogDaFidrn/lemnPtF1igacsgD.iag9neTtAeWaAioCltCson/lD0e.Cr7a-1n32c-V1-egA25Ar4/%eD10e;-CVn+A(102L50.E05%-D-610.7HWz)AACC/D0.C7-13p20-Vo1-.gtA215eAr4/s%enD10-et1;-CiVn+oA0(n102mL5m0.E05i%n-DeSTO-61tiuue0m.p7trHpepWzulsy)teiitnntddiniiccgaattiioonn((grerede) n) STOiuumptpepulrytaiinnngddSRMMCOE0SOMeaSTTRTOT0m0W.EC0,45.ewlliiiHeuutuO%ieepuso0emmm-DeVno1s-msrAtpcip6tzetuc51Nt.rptreaDpeeeehpebc)e0Ceatrpn%.utb,ruta7haClrrarsdHtngeOtiytiiett℉acmitWinetenlterinizniiFamainnaniattrvgnga),gcttyalkFggtdcie2ied/xaualnitevDicia×nmti.iclrftgcnoe1sueetigIlaopa=NiSglm2r(fttccanetAe6aViPiprooacro8gCAaDaenepyn℉ei/1trcTla1ua))ic.ert9ieuntWyrteDC 1×0.-0S-325P50%℃50D℃.%/TD20℃tt-%o.iom1n,2pa+-s+5orest7-ag5=0tce151eir5Vh2tl5mr0℃e6ne℃Eav0A0d11eAtada℃niN(0aC××no(x/liLmyu/c/.n(A-L11I22sE0-ae2EmWEC400,40.lD2OCs0℉DeV01s℉t5NtemaD6et%tb,o0tCsrtOoii℉7nl1iF11tg3,yF55218a×℉℉t=S))6P8D℉T)True D-e1l-a-y1-OFF Timer 12 - 240V ACU/DnC-1U U-nn R R R Un Re0DC2EFw4×℉.0×5C5P5i1i00%s%r×℃05/SI-DDSFe℃-EMOMSCER1)NMOSPfSTTRSTVBFSMOT6%.P2/1PmoTD×20Ni℃.IteDnlwiii0ueDuoratIurt-%uuuuPo.ei-e.5ipuoe1immmESo-26m1xn3noTo,rf72opnmT24d×Hrsnl.×tpprpar+Cci1-pePst5a1ucr:+t5or:oe00r.ptrstdWitp×8eee7e℃-2/iSaacDhWSpppgbc9e5℃W=0zteaertnpnecEn1ic×1f51ueP2ielrurP0ato5tVThD2gttlNha5mr0lll)2r2ards℃ncg.uee2a6ttn1×iDieyyy℃DrtEtpav0Amon50etdi4t-acito141.eeoAin6tenatteTdte1fmra2℃ointTaniiN0(501aniC××0r+1inoaam(ivtxner/nna,:+n5lr:oi/naiat-or8vLmy-noI8gu7er/2c/a.ngc(WAtE9w5tW0-Lo1n1×I6aklen2g2sgd×t8E1d0-a51aepci2neiEime0dWu5/VriECCta4u00l0rm5ly,4a2120ltn℃2.iCLl6l1Dt×e/26DvOeh℃imcnCEspiAo0℉gnmt04-IgtD/eiV1041.i1nsAclrba℉fd4tEd1EPEEPgtaca,neo5N0s(501uCuN,×s×0tgemeweaiDA(gIxm6/,lAaetN/nali-28yte%DLmo-ICCpaae/Nig0t/g.mlb,Aonri0t2rEw-e1C21(×Is6ren2tmf208ORE6te-onSMPOteOPDOWS2EccgiiWa℉nr3e7itrCCAAe4300e.0TTlya41v0nl1tia1L-DAe/26rttohtiiFiepC0p1vp0o℉rog1roIeg0-taeIg/Votram0c1oeg033roOO℉,4sgEPlnCCeyl-eeFa,Eu52-5t,simlernnmCt12aer5D1A5ntmsee6.gpAuy7eNr5Nlaerron2tn8meeda×0id℉ai9v0ota0tNF2ah9t1/eC2nsDrttmgc%0tmc6℉eolai℃05xa-toltg3Dit7ttiguo3s0atv℃e1F11=1iinu.Siei)n)rtiil0m11nr1nec0cin).%o.te03dge6orea/.tt×P-xaC5ag2-gr5mmen12℃er1asi5/d7eun87ltg8anDmDt2Ds×0m℉at9ptte-%9℉sdote℉ye.-rx-Io1giTomPntiggbepo15,N.Sm)n32enp)c1sr)Dag(+Ee2D-ac×P0ae-e+iprV5rAogerrstTlatt1e7D-eeis2aesW.ChrgoC5=0tAUcei.2:etr1Tl5e511n1eGu5aAr215sVh2t1ng4mr5(/s0rtT℃%×e6nsAeuD1eo℃0av10A61200-W211reAr00t3aDd1e0a)℃y0;n-CSAiV(0CG××4n+o(Ax/00mliLmOP(u1c/.n1(50A-2m@L1215022E0-sae2)D1m0W.6EFC400m04005.ilD12%sTn0℉07-DeV0FA1s-m0℉s6t8519otem0aDC0Rle0t%i.Wdtbot7-CsrHtcfIwoutii1℉oWinl1nirznsiei1c0ttgr3/m),pfcItrIUyuti5oIA.oDDDooPia1-I1PA-ni110lOEs-2-nsxnns3n83L0c24a×oC℉.×t2Cs4seee51COp5tr0o1℉02f5iio×p℃t/S0oog0b3S00℃Allfs/El%l0=fi℃ns)50aalP2L4PgDroeDDe0oN℃cs)0.etODh6fDorftyy.%oi5iDrlt/r.bo65CnotDAfa2TlfooT℃i087arl+i1gtorryDe:+r:1oOOrpet-%c6o87hi2ir(℉matW-95W0no1ltlom×n11t5aa,ofoiia32p0t50t7lmFNn22no℃ar2y+Em2a-1×n0℃0)iSEp-cTTO+n4-V58(rorg4o.eFsdoay91lo0t1ga7-N0e(51oa0a0R.giiC(xu5=0,ntAnce/naio21u-8ca1nmm-Inrs/551.1e1nEwi-×I6Atternd22p8y5Vh-2ttt2lh4EPmr5t/esaeiTC℃40%×elly610ntPeopDeeeoi/26e℃ch0pECpanv10A℉sg0Ig0-/01a1tt℉4reAmEPtaemD,hCu1,sd10aem℃la;n-ACdlm6SiNrsACdV(0C×Norl×2ety6n+neo(Axg/o0tt2ae02/mslamrni10be6eoeLmOPp1/i(u3/7cv/31d1.n1(z5Ov11dii0eA1nr-2mL61t1I5e012tOi21nne0g80Ee0-eme0ct3saee12DbE1m0t-Ww.15-i5gsEFdmC4v0e101r0l1z554e0ddi7s5.i0lrD8m/i2e80,e%n℉a9CctsTn9e0℉wI-℉mwaDeV0iiF1exs-d-weg℉igPcc1g6t.h)n5neE1,1tti)e1mws2aD6tia×eaawelu0h20t%S103e.hlentDb1ooi20t1s7htt0Csti-rHtr0lt0.houmASiiet4hii1℉e715WsooottSnl10-2esz(0ttiuAi1dh1Annt1mneg13t(s-),2ei1Wye5s0505dw((2g1r12t.(0shGis2uggresi80m103wat0℉ret.c1h016cugrb℉3ihtt4d2or0iedciO1c=nb+0))nn7hOios0ig)e)F71nt6aniNda-5sO0g0Fant5c800ahl8ONats9cc)0o5℉U10No6t0.cr1o)d°r01os.nO1,rr102))OCres0,rmF712ceNd0030Ftc084fcIt90ut0o0nins5c0tptr16iomoo01lnsL07oms0Oof8i9b0Afl0RilgrDeehlttaooycr(looanEOOMIanPndyEPNepu4ioocCsattte0hedl6rPpoenrtaru0efF1auddro6Nlg20tet1beivir1z5:e25niu8ect1wwfde5SgTTOmre,woieiiwxuUu/dhmmtn1bin1itpsenlthS0SteEspeeeotphm-12PtuAN003hurl0p:tsr2eD4ypd0ta1e(asi6esT5iiwen70tnt.nnug1i1trtg6m.r/cddie00cba51nhe0o7iiiln1mCt0mniccg8sgu09/ts0a0uRaaOamcreIttrNtecPoiitro.oort)er2i/-,rnnnen02USDcD((gtt0igrnetnierernsdtgaedrocetlmre)rei1arn+in1spiiP&0ng)l5sthma:52iSoTTOOa03l1°so0iinsuC0u4vmmeu0pAetpneeprA5uAtl0srVCyita1nCe6o/miin0gt-nnD1ltg1t0ddi7Canme0ii8gccg90s1aa0ee1ttiit0ooti-nnn2((g4gre0redVe) n) Un 10s 1m 1s 1 40 50 60 30 20 10 P a n e l D i a g r a mWiring Diagram%DiRTlitiemypeeadteavciactuiorancy p0o.t1esn-t1io0nmmineter 50%.2-%m-esceht avanliucaelssteatbtinlitgy Time settiEPOE0CDrpOOPo6oevp0tleel7erurr1avatci5ototitlnnitiangodgpgeneogcsIrpdPaeitote4ieho0sengfgioDrtorieirnfoyreronanitl EN/IEC 60715 ls anIyP40 for front panel/IPE2CP0F0t3erminals Phase Lo1s0s / Sequence panel/IP20 termina 1s 10m 50 60 ECPF05 Adjustable Phase Loss / Sequence Under and any 40 70 any Over Voltage 30 80 Staircase Time Clocksn℉M,in2a×intu=Sm6P8Dp℉To)wer tim50%.e2-%m-esceht avanliucaelssteatbtiinlitgy 200ms2OPly00/IovPDW0l2eiemlm0uirgestvtehosnilrtosiodmiolwnitnniraseadlmgseaexg.1c×rae2.te5hormax.1×2. e go r syolid wire 5or 2×1.5/with sleeve ma20x.1×2. 5 ( AW G901 2 ) ECPF08 Over / Under Voltage Phase Failure LOAD 90×18×64mm 10 2×1.5/with sleeve max.1×2.5(AWG 1626)g Wi r i n g D i a g r a m Wiring DiagramCesTOteeutmrttipnpugetrature0c.0o5e%cie/℃nt,at=22000℃m(0s.05%℉0,.0a5t%=6/℃8℉,a)Stu=1p2×p0℃lSyP(in0Dd.T0ic5a%ti℉on,(garte=e6n8)℉)×D24t6h2i4℉Ssmm℉lteameentvdeotnoamsr1ad1xis3.oLC15×EPu1nDa82r℉rr.s℉eIt5nn(N)dAt)WiurcaImGaEttiCb1on2/ergE)sr9:N,01R×66e1A1l8a681yA6×2gCs6-t1-4a1,mItEu/mCsO/mEpDNaee6irnas1stct0aiorI1niiElnp0giC-edt1it/doEewnNmaifr6ptee1er8rm1ap2taou-w1xre,.eI1Er-×C2lo0/E2s+Ns.6a551c5o0r°o1rCs02s9-×1A011×.A512/8w×it6h4s1ml6eAme1v6Setam1i8racxa.1s×e T2.im5(eArW23G0V12A)C (50-60Hz) It is poss i b l e to connect control of light or any oth Ctaubrirleitnyt rating 1×SPDT 16A/ AC1WE2sg-1Ce,IEi6gC/0hEN7t 61105E1C0T-1DOFF UTnrue Delay OFFR1P1C×/OSPDT: W240- 60g,A230-59g function of relay(load3-isw 10s 1m Wiring DStar Delta Timer RelaysSwitching voltage 16A/ 2O50uVtpAuCt /i2n4dVicDatCion(red)l/IP20 terminals 2×S P D T : W 2 4 0 - 8 1 g , A 2 3 0 - 7 9 g 0M5%in℉.br,eakt=in6g8℉ca)pacity2D5C0VAC/A2C4V1 DC Tim5e0r0amnWge settingSytandardSstar StaWiricriansge sDwiaitgcrhaGmRT8- LSEDS1238-001TOutput indication red LED2.5(AWG 12) Delta Timer Relay1ss 1230-402530060V107m0A80C/IDECC / E L NO6A1D81 2- 1 , I E C / E N6 1010 -1 20 90 15 1Mechanical life 500mW Time1s×e1tt0ing10 Wiring Diagram Instruction ManualV0iE1t-h1Dl3esC1cle℉tervi)ce amlalxi.f1e×(A2.C5(1A)WG 12) red LED 1×10 ×oR61e45sm8em℉t t)ime -1-D70Og1p,5Ae2ra30ti-n5g9gtemperature 08C)SM1tg/etoEo,rAuNmr2an6i3g1tni00ena-1g7lts0e9/-Dgm1IpNer-ra2ai0tlu℃reto +5 It is possible to conne1ct×lo1a0d between S-A2 (e.g contactor , General control of light or anmy oatxh1e.62r 01d80evmicse, without disturbing a correct 1×10 function-2o0f℃relatoy(+lo5a5d℃is(en-e4r℉gizteod1w3h1il℉e t)he switch is ON.) ■Applications MoCtoornIStnrtdoarel txGeersarand max.200ms -35℃ to +75℃(-22℉ to 158℉) -It is used for halls or for d ■Function Feat 5℃(-4℉ to 131℉)Din rail ENEN/I6E06C696/0EN71615010 Example -Operating sy Wi r i n g D i a g r a m EDS1237-002Cm℉e0℉PPOOvm6ertopvo0tomsleoel7ta1urer11xva3tc.5i5o1t1otMIEOCOi×8iPl℉nPnNuotpu4o℉aar26gte0dnrrpd)1re.tgufa8u)nop5eNldt1taetir:2(nurogre2f-gamAwrc1sIortxgtiWiP/b-aendneiSr3ettEtgmPte4GheirNp:Dh5op:Aa0e6T1e℃ennC117r0e-af2.g51l1otD)0um/ot1-rroIim6e1PrnfA2y-.r+02Dro07tianen+5riDrm5tla℃5eiiEpln°sCmcaaN(rloisnpau/t-Iennio2EcIttlyinno/2CigIns℉Pt6pr2o0to0ols7Lost1O1efiIb55APlril8mgDe4℉hi0ttno)ofacorlosranfnrnyoenocttthlpoeaarMOTICPnaPEdiudpm4oTarene0edSrre1bretTulyfavn5reoC/NltaeitIirActnnuPrwwfggameroiet2det,ibn:net00eetwhgmr.p::5npi1t1a,tee76n5hSr.A,ea5ro1l-tmmAu0/uACmr,IteP21i-n125d/-02,(Dai20esti0elntt.srougD2mmra3+reiii0cnbnsl5Vcumao5irtnl°0isenopC.gsu/5ttian/Oo-atMcnui2ntt0icgpnoMouimrtri:nu,r1umextcesSstePtStiTng ON - o 0.5 minutes AUTO - OFF - o -Voltage rang - Relay statu - 1-MODULE -1-3P02-509tgermECiSnDaS2l3s0 ■Model and co GRT8 LS 12-230VsAfouCl/indDcCwtiiorenmoaf xr.e1l×ay2(.lo5aord2i×s 1e.n5e/rwgiitzhesdlewehveilemtahxe.1s×w2i.tc5h(AisWOGN1.2)) 63WD100ie-m17i0ge9s-hogn1ltsidEioCwSniDrseS4m00a 400V 90×18×64mm Standards x.1×2 . 5 o r 2×1.5/with sleeve max.1×2.5(AWG 1626)g Technical parame 90s×al1e8s×@6e4umrompa-plc.coImEC/EN 61 8t1e2c-h1n,IicEaCl@/EeNu6r1o0p1a0-p-1lc.com t e rs GRT8-8L3S
EUR PA 2023 Catalogue Miniature Relays Octal Relays 8 Pin Miniature Relay 10A AC-1 2PCO 8 Pin Octal Relay 10A AC-1 2PCO 10A Rated 2PCO / LED flag indicator and lockable test button Part Number Description R8S12D2PDT 8 Pin Miniature 2PCO 10A 12V DC R8S24A2PDT 8 Pin Miniature 2PCO 10A 24V AC R8S24D2PDT 8 Pin Miniature 2PCO 10A 24V DC R8S110A2PDT 8 Pin Miniature 2PCO 10A 110V AC R8S230A2PDT 8 Pin Miniature 2PCO 10A 230V AC RB8S 8 Pin Miniature Relay Base 11 Pin Miniature Relay 6A AC-1 3PCO 10A Rated 2PCO / LED flag indicator and lockable test button Part Number Description R8R12A2PDT 8 Pin Octal 2 PCO 10A 12V AC R8R12D2PDT 8 Pin Octal 2PCO 10A 12V DC R8R24A2PDT 8 Pin Octal 2PCO 10A 24V AC R8R24D2PDT 8 Pin Octal 2PCO 10A 24V DC R8R110A2PDT 8 Pin Octal 2PCO 10A 110V AC R8R230A2PDT 8 Pin Octal 2PCO 10A 230V AC 6A Rated 3PCO / LED flag indicator and lockable test button RB8R 8 Pin Octal Relay Base Part Number Description 11 Pin Octal Relay 10A AC-1 3PCO R11S12D3PDT 11 Pin Miniature 3PCO 6A 12V DC R11S24D3PDT 11 Pin Miniature 3PCO 6A 24V DC R11S24A3PDT 11 Pin Miniature 3PCO 6A 24V AC R11S110A3PDT 11 Pin Miniature 3PCO 6A 110V AC R11S230A3PDT 11 Pin Miniature 3PCO 6A 230V AC RB11S 11 Pin Miniature Relay Base 14 Pin Miniature Relay 6A AC-1 4PCO MoCtoornIStnrtdoaerl txGeersarand 6A Rated 4PCO / LED flag indicator and lockable test button 10A Rated 3PCO / LED flag indicator and lockable test button Part Number Description Part Number Description R14S12D4PDT 14 Pin Miniature 4PCO 6A 12V DC R11R12D3PDT 11 Pin Octal 3PCO 10A 12V DC R14S24A4PDT 14 Pin Miniature 4PCO 6A 24V AC R11R24A3PDT 11 Pin Octal 3PCO 10A 24V AC R14S24D4PDT 14 Pin Miniature 4PCO 6A 24V DC R11R24D3PDT 11 Pin Octal 3PCO 10A 24V DC R14S110A4PDT 14 Pin Miniature 4PCO 6A 110V AC R11R110A3PDT 11 Pin Octal 3PCO 10A 110V AC R14S230A4PDT 14 Pin Miniature 4PCO 6A 230V AC R11R230A3PDT 11 Pin Octal 3PCO 10A 230V AC RB14S 14 Pin Miniature Relay Base RB11R 11 Pin Octal Relay Base 84 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Stud Terminals GRPC Enclosed Stud Terminals (IP66) Metal Clad Enclosed Stud Terminals (IP65) Part Number Description Part Number Description STC504PME 4 Pole M8 50mm² (150A) STC504PGP 4 Pole M8 50mm² (150A) STC954PME 4 Pole M8 95mm² (232A) STC954PGP 4 Pole M8 95mm² (232A) STC1504PME 4 Pole M12 150mm² (309A) STC1504PGP 4 Pole M12 150mm² (309A) STC2404PME 4 Pole M12 240mm² (415A) STC2404PGP 4 Pole M12 240mm² (415A) STC505PME 5 Pole M8 50mm² (150A) STC505PGP 5 Pole M8 50mm² (150A) STC955PME 5 Pole M8 95mm² (232A) STC955PGP 5 Pole M8 95mm² (232A) STC1505PME 5 Pole M12 150mm² (309A) STC1505PGP 5 Pole M12 150mm² (309A) STC2405PME 5 Pole M12 240mm² (415A) STC2405PGP 5 Pole M12 240mm² (415A) EN60947-7-1 Black Stud Terminals Ideal for where a resilient mechanical connection is required / Typically used where environments are exposed to vibration / DIN rail mounted / Cover provides IP20 Protection / 2 Cable lugs can be mounted on each side of the stud terminal. Stud Terminal Section Bolt Tightening Current (A) Voltage (V) (mm²) Torque (Nm) 150 1000 232 1000 Part Number Description 50 M8 10 309 1000 ONKA-2344 50mm² M8 (150A) Black 95 M8 10 415 1000 ONKA-2384 95mm² M8 (232A) Black 150 M12 14 ONKA-2424 150mm² M12 (309A) Black 240 M12 14 ONKA-2464 240mm² M12 (415A) Black Grey Stud Terminals Brown Stud Terminals Part Number Description Part Number Description MoCtoornIStnrtdoarel txGeersarand ONKA-2342 50mm² M8 (150A) Grey ONKA-2346 50mm² M8 (150A) Brown ONKA-2382 95mm² M8 (232A) Grey ONKA-2386 95mm² M8 (232A) Brown ONKA-2422 150mm² M12 (309A) Grey ONKA-2426 150mm² M12 (309A) Brown ONKA-2462 240mm² M12 (415A) Grey ONKA-2466 240mm² M12 (415A) Brown Blue Stud Terminals Green / Yellow Stud Terminals Part Number Description Part Number Description ONKA-2345 50mm² M8 (150A) Blue ONKA-2358 50mm² M8 (150A) Green / Yellow - ONKA-2385 95mm² M8 (232A) Blue ONKA-2399 Without Covers ONKA-2425 150mm² M12 (309A) Blue ONKA-2439 ONKA-2465 240mm² M12 (415A) Blue ONKA-2479 95mm² M8 (232A) Green / Yellow - Without Covers sales@europa-plc.com 150mm² M12 (309A) Green / Yellow - Without Covers 240mm² M12 (415A) Green / Yellow - Without Covers technical@europa-plc.com 85
EUR PA 2023 Catalogue ONKA Series OPK Push-In DIN Rail Terminals Key Features Grey ONKA Series OPK Push-In Din Rail Terminals - No tool or screwdriver required for installation - Quick installation saving labour costs - Top cable entry means reduced cabinet space is required - Fully encapsulated terminals so no requirement for end plates - Symmetrical design so it can be fitted either way on the Din rail - Fits all types of 35mm Din Rail - Suitable for both solid and crimped conductors terminated with a ferrule OPK Jumper Bars For OPK Terminals Part Number Description Part Number Description ONKA-1502 OPK 2.5mm2 (24A) ONKA-1927 2.5mm2 4 way Orange ONKA-1512 OPK 4.0mm2 (32A) ONKA-1928 2.5mm2 10 way Orange ONKA-1522 OPK 6.0mm2 (41A) ONKA-1532 OPK 10.0mm2 (57A) ONKA-1932 4mm2 4 way Orange ONKA-1542 OPK 16.0mm2 (76A) ONKA-1933 4mm2 10 way Orange ONKA-2482 OPK 2.5mm2 Fused * ONKA-1947 6mm2 4 way Red ONKA-1948 6mm2 10 way Red *5 x 20mm Fuse not included, see page 98 ONKA-1952 10mm2 4 way Red Blue ONKA Series OPK Push-In Din Rail Terminals ONKA-1953 10mm2 10 way Red ONKA-1957 16mm2 4 way Red 16mm2 10 way Red ONKA-1958 ONKA Series OPK Push-In Din Rail Terminal Accessories Part Number Description Part Number Description ONKA-1505 OPK 2.5mm2 (24A) ONKA-0592 Terminal Block Separator Plate ONKA-1515 OPK 4.0mm2 (32A) ONKA-1202 Terminal Block Mini End Bracket ONKA-1525 OPK 6.0mm2 (41A) ONKA-1212 Terminal Block Big End Bracket ONKA-1535 OPK 10.0mm2 (57A) MoCtoornIStnrtdoaerl txGeersarand ONKA-1545 OPK 16.0mm2 (76A) OPK Blank Terminal Markers ONKA Series OPK Push-In Earth Din Rail Terminals Part Number Description Part Number Description ONKA-1199 OPK 4.0mm2 Earth terminal (32A) ONKA-4440 2.5mm2 ONKA-1200 OPK 10.0mm2 Earth terminal (57A) ONKA-4390 (72 markers per 1 set) ONKA-2630 4.0mm2 (64 markers per 1 set) 6-16mm2 (56 markers per 1 set) 86 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Din Rail Terminals Black Din Rail Terminals Also available in Red, Orange, Green and Yellow Grey Din Rail Terminals Top Hat & G-Rail Top Hat & G-Rail Description Part Number Part Number 6mm2 Black SCRW2.5UGY SCRW6UBK 10mm2 Black SCRW4UGY SCRW10UBK SCRW6UGY SCRW10UGY Description Brown Din Rail Terminals SCRW16UGY 2.5mm2 Grey SCRW25UGY Top Hat & G-Rail Description SCRW35UGY 4mm2 Grey 2.5mm2 Brown SCRW50UGY Part Number 4mm2 Brown 6mm2 Grey SCRW2.5UBN 6mm2 Brown 87 SCRW95UGY SCRW4UBN 10mm2 Brown 10mm2 Grey SCRW6UBN F4UGY SCRW10UBN DBL4UGY 16mm2 Grey KN4UGY (with Integrated End Plate) Beige Din Rail Terminals 25mm2 Grey 35mm2 Grey 50mm2 Grey (with Integrated End Plate) 95mm2 Grey (with Integrated End Plate) 4mm2 Fuse Term Grey (use 5 x 20mm fuse) 4mm2 Grey Double Decker Terminal 4mm2 Grey Knife Disconnect Terminal Blue Din Rail Terminals Top Hat & G-Rail Description 2.5mm2 Beige Part Number 4mm2 Beige SCRW2.5UBE SCRW4UBE Top Hat & G-Rail Earth Din Rail Terminals Part Number SCRW2.5UBU Description 4mm: Top Hat / 6mm - 35mm Top Hat & G-Rail MoCtoornIStnrtdoarel txGeersarand SCRW4UBU 2.5mm2 Blue SCRW6UBU 4mm2 Blue Part Number Description SCRW10UBU 6mm2 Blue G4YE/GN 4mm2 Earth Terminal 10mm2 Blue G6YE/GN 6mm2 Earth Terminal SCRW16UBU 16mm2 Blue (with Integrated End Plate) G10YE/GN 10mm2 Earth Terminal SCRW25UBU 25mm2 Blue G16YE/GN 16mm2 Earth Terminal SCRW35UBU 35mm2 Blue G35YE/GN 35mm2 Earth Terminal 50mm2 Blue SCRW50UBU (with Integrated End Plate) 95mm2 Blue SCRW95UBU (with Integrated End Plate) sales@europa-plc.com technical@europa-plc.com
EUR PA 2023 Catalogue Din Rail Terminal Technical Data Partition Plates Size: 2.5 4 6 10 16 25 35 50 95 GXXYE/GN 10 12 12 15 20.5 25 Terminal Block 5 6 8 Pitch (mm) 1.5 2.5 6 10 16 16 to to to to to to Connection 0.5 0.5 1.5 10 16 25 35 50 95 Via Stranded Wire to to to 1.5 2.5 6 10 16 16 (sq. mm) to to to to to to 2.5 4 6 16 25 35 50 70 120 800V 800V 800V 800V 1000V 1000V Connection 0.5 0.5 1.5 57A 76A 101A 125A 150A 232A NONE Via Solid Wire to to to Description 2.5 - 4mm2 Grey (sq. mm) 4 6 10 Part Number 6 - 10mm2 Grey PPSCRW2.5U/4UGY 25mm2 Grey Voltage Rating 800V 800V 800V PPSCRW6U/10UGY 35mm2 Grey PPSCRW25UGY Current Rating 24A 32A 41A PPSCRW35UGY Earth Terminal Technical Data G4YE/GN G6YE/GN G10YE/GN G16YE/GN G35YE/GN NB: Partition plates identify & segregate terminal block groups. These Terminal Block 6 8 10 12 16 can be used to electrically isolate adjacent cross connection sets. The Pitch (mm) partition plate also maintains the required creepage and clearance 0.5 2.5 10 Connection 0.5 1.5 to to to values in the assembly. Via Stranded to to 10 16 35 Wire 4 6 Blank Terminal Markers (sq. mm) 0.5 2.5 10 to to to Connection 0.5 1.5 16 25 50 Via Solid Wire to to 57A 76A 125A (sq. mm) 6 10 Current Rating 32A 41A Din Rail Terminal Accessories End Plates Numbered markers are available from stock End Plates are used to cover the live parts of the last terminal block Part Number Description making the assembly finger safe. Not required on SCRW16, 50 & 95 terminals. KM/2 4 - 35mm2 (1/2 Height) KM/5 2.5mm2 KM/6 4mm2 KM/8 6mm2 KM/9 8mm2 KM/10 10mm2 KM/12 16 & 25mm2 KM/15 35mm2 Part Number Description EPSCRW2.5U/4UGY 2.5 - 4mm2 Grey Jumper Bars (10 Way Insulated Shorting Links) EPF4UGY 4mm2 Fuse Terminal Grey EPDBL4UGY 4mm2 Double Decker Grey EPKN4UGY 4mm2 Grey Knife Disconnect End Plate EPSCRW6U/10UGY 6 - 10mm2 Grey EPSCRW25UGY 25mm2 Grey MoCtoornIStnrtdoaerl txGeersarand EPSCRW35UGY 35mm2 Grey EPSCRW2.5U/4UBU 2.5 - 4mm2 Blue N EPSCRW6U/10UBU 6 - 10mm2 Blue Part Number Description PASLN05/10 2.5mm2 10 Way Ins Shorting Link EPSCRW25UBU 25mm2 Blue PASLN06/10 4mm2 10 Way Ins Shorting Link PASLN08/10 6mm 210 Way Ins Shorting Link EPSCRW35UBU 35mm2 Blue PASLN10/10 10mm2 10 Way Ins Shorting Link PASLN12/10A 16mm2 10 Way Ins Shorting Link EPSCRW2.5U/4UBK 2.5 - 4mm2 Black PASLN12/10 25mm2 10 Way Ins Shorting Link PASLN15/10 35mm2 10 Way Ins Shorting Link EPSCRW6U/10UBK 6 - 10mm2 Black EPSCRW2.5U/4UBN 2.5 - 4mm2 Brown EPSCRW6U/10UBN 6 - 10mm2 Brown EPSCRW2.5U/4UBE 2.5 - 4mm2 Beige 88 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA 10 Way Insulated Comb Busbar Slotted Top Hat Din Rail 35 x 15mm Part Number Description Part Number Description CL6/10 for 4mm² Terminals STBDR2M15S CL8/10 for 6mm² Terminals 35mm Top Hat 2 Metre CL10/10 for 10mm² Terminals (Pack of 10) Din Rail Terminal Accessories Plain Top Hat Din Rail 35 x 7.5mm 64 38 1 5 27 Not required on SCRW16, 50 & 95 terminals. Part Number Description STBDR0.5MP Plain 35mm Top Hat 0.5 metre Part Number Description STBDR1MP Plain 35mm Top Hat 1 metre STBDR2MP Plain 35mm Top Hat Din Rail (Pack of 10) 1 ES1S Steel End Clamp for 35mm Din Rail 2 ES2N End Stop (keeps end plate in position) 3 SIDEPL1GY Holding Plate 4 COVER150 Protective Cover 150mm 5 F4UCL Copper Link for Fuse Terminal 6 MTGBKT18 Mounting Bracket 40° from Horizontal 7 KM/G1 Group Marker 8 GRPM7 Group Marker Holder + Label Slotted Top Hat Din Rail 35 x 7.5mm All technical datasheets can be downloaded for FREE from our website. MoCtoornIStnrtdoarel txGeersarand www.europa-plc.com Just visit the product page your looking for and click ‘datasheet’ Part Number Description STBDR0.5M 35mm Top Hat 0.5 metre STBDR1M 35mm Top Hat 1 metre 35mm Top Hat 2 metre STBDR2M (Pack of 10) sales@europa-plc.com technical@europa-plc.com 89
Europa Fuses Sourcing a fuse? Understanding General Fuse Terminology There are 1000s of different fuses from many manufacturers Miniature Fuses: worldwide. When trying to source a fuse the following • FF - Ultra rapid information will be very useful. • F or QA or QB - Fast blow • M or MD - Medium blow • Manufacturer • T or SB - Slow Blow / Time delay / Anti surge • Part Number • TT - Ultra slow • Dimensions (Length of fuse body, diameter, overall length, Bottle Fuses: width) • DIAZED 500V Bottle fuses DI (E16), DII (E27), DIII (E33) • Current rating in amps • NEOZED 380V Bottle fuses D01 (E14), D02 (E18) • SILAZED Ultra Rapid Bottle fuses DII (E27), DIII (E33) If the above information is unavailable, these following questions will help identify the correct fuse: Industrial Fuses: • aR or gR or uR - Ultra rapid • Voltage (AC or DC)? • gL/gG - General line • Characteristic (eg: gL,aM,gR)? • aM - Motor rated • Are approvals required (eg: UL, IEC)? • gF/gTF - Transformer / Cable protection • Fixing centres (how far apart - if relevant)? • gB - Mining fuses • How is the fuse mounted (If relevant)? • What is the fuse protecting? • Does the fuse have an indicator? • Does the fuse have a striker to operate a microswitch? BS88 Industrial Fuse Comparison Chart with Fixing Centres Fixing Centres Rating Amps BS88 Europa GE Power Lawson Cooper MEM Brush Ref Order Code (GEC) Bussmann FO6 Off Set Tags D04 F21 44.5mm 2-32A F1 BN55VXX NS NS NSD SN2 HO7 KO7 44.5mm 2-20A - SS SS SS SSN SS L14 M14 44.5mm 2-32A A1 BNIT55VXX NIT NIT NITD SA2 KO8 73mm 2-32A A2 BTIA55VXX TIA TIA AAO SB3 - 73mm 32-63A A3 BTISXX TIS TIS BAO SB4 LO9 MO9 94mm 63-100A A4 BTCP42VXX TCP TCP CEO SD5 NO9 N11 94mm 125-200A - BTFP42VXX TFP TFP DEO SD6 PO9 P11 Central Tags R11 S11 97mm 2-63A - TB TB TB BC SE4 TBC TBC AD/BD SF5 111mm 6-63A B1 BTBC42VXX TC TC SF5 TF TF CD SF6 111mm 80-100A B1 BTC42VXX TKF TKF DD SF7 TKM TKM ED SG7 111mm 125-200A B2 BTF42VXX TMF TMF EFS SF8 TM TM ED SH8 111mm 250-315A B3 BTKF42VXX TTM TTM EF SH9 TLM TLM FF SH10 133mm 250-315A C1 BTKM42VXX GF 111mm 355-400A B4 BTMF42VXX 133 / 184mm 355-400A C1 BTM42VXX 134 / 184mm 450-630A C2 BTTM42VXX 133 / 184mm 670-800A C3 BTLM42VXX BS88 J Type Fuse Cross Reference Chart Lawson GE Power (GE) Brush Bussmann MEM JHDS JW6 / JWS6 JHU 96TY MJ29 JPDS / JOPCS / J1PCS / J2PCS JX6 / JX7 / JX8 / JXS6 / JXS7 / JXS8 JSDS / JOSCS / J1SCS / J2SCS / J3SCS JY7 / JY8 / JY10 / JYS7 / JYS8 / JYS10 JPU 95TY / 95TJ / 171TN MJ27 / MJ30 / PJ30 JSU 385TJ / 386TN / 387TW MJ31 / PJ31 / SJ31 90 Sales: 01582 692 440 Technical: 01582 692 444
20232 Catalogue EUR PA Industrial BS88 Fuses TIS BAO SB4 - Size A3C Box Qty 10 Can’t see the fuse you are looking for? We have a BS88 Fuses wider selection available on request. 01582 692 440 NIT NITD SA2 - Size A1 Box Qty 10 Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 73mm / Diameter: 17.1mm ASTA 20 Certified / 690V versions available on request Part Number Description BTIS69V36 35A BTIS42V40 40A BTIS42V50 50A BTIS42V63 63A Rated at 550Vac 80kA / 250Vdc 40kA NB: Also available in a motor rated version Fixing centres: 44.5mm / Diameter: 13.5mm ASTA 20 Certified / 415V 36A to 63A versions available on request Part Number Description NS NSD SN2 - Size F1 Box Qty 10 BNIT55V2 2A BNIT55V4 4A BNIT55V6 6A BNIT55V10 10A BNIT55V16 16A BNIT55V20 20A BNIT55V25 25A BNIT55V32 32A NB: Also available in a motor rated version Rated at 550Vac 80kA / 250Vdc 40kA Overall length: 61mm / Diameter: 13.5mm TIA AAO SB3 - Size A2C Box Qty 10 Part Number Description BNS55V2 2A BNS55V4 4A BNS55V6 6A BNS55V10 10A BNS55V16 16A BNS55V20 20A BNS55V25 25A BNS55V32 32A Rated at 550Vac 80kA / 250Vdc 40kA NB: Also available in a motor rated version Fixing centres: 73mm / Diameter: 13.5mm ASTA 20 Certified / 690V versions available on request Part Number Description Get improved pricing with our 100+ mixed fuse rate BTIA55V2 2A BTIA55V4 4A Offer Example BTIA55V6 6A Part Number Description Quantity BNIT55V16 16A NIT 20 BTIA55V10 10A BTIA55V16 16A BTIA55V32 32A TIA 30 BTIA55V20 20A BTIS42V63 63A TIS 10 BNS55V6 6A NS 10 BTIA55V25 25A BTIA55V32 32A BNS55V16 16A NS 30 NB: Also available in a motor rated version sales@europa-plc.com technical@europa-plc.com 91
EUR PA 2023 Catalogue TIS BAO OS OSD SB4 Box Qty 10 MES ES ESD SP Box Qty 10 BS88 Fuses Rated at 415V 80kA / 69 x 17.5mm Rated at 415Vac 80kA / 240Vdc 40kA Part Number Description Fixing centres: 73mm / Diameter 21mm MES10 10A MES16 16A Part Number Description MES20 20A TIS80A 80A MES32 32A MES40 40A TIS100A 100A MES50 50A MES63 63A TIS125A 125A TCP CEO SD5 Box Qty 10 TC CD SF5 - Size B1 Box Qty 10 Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415V 80kA / 240Vdc 40kA Fixing centres: 94mm / Diameter: 21mm Fixing centres: 111mm / Diameter: 26.9mm ASTA 20 Certified / 415V 125A and 160A versions available on request ASTA 20 Certified / 690V versions available on request Part Number Description Part Number Description BTCP42V63 63A BTC42V80 80A BTCP42V80 80A BTC42V100 100A BTCP42V100 100A NB: Also available in a motor rated version TFP DEO SD6 Box Qty 5 TB AC SE4 - Size B1 Box Qty 10 Rated at 415Vac 80kA / 250Vdc 40kA Manufactured by Lawson Fixing centres: 94mm / Diameter: 31mm Rated at 415Vac 80kA / 250Vdc 40kA ASTA 20 Certified Fixing centres: 97mm / Diameter: 22mm / ASTA 20 Certified Part Number Description TB20 20A Part Number Description TB32 32A BTFP42V125 125A TB40 40A TB50 50A BTFP42V160 160A BTFP42V200 200A TB63 63A NB: Also available in a motor rated version NB: Also available in a motor rated version We also offer the Lawson CTFP compact range with 30mm diameter SS SSD Box Qty 10 TBC AD SF4 - Size B1 Box Qty 10 Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 111mm / Lawson Dia: 22mm / Mersen Dia: 26.9mm Rated at 240V 20kA / 12.7 x 51mm Part Number Description TBC16 16A (Lawson) Part Number Description SS2 2A TBC20 20A (Lawson) SS4 4A SS6 6A TBC25 25A (Lawson) SS10 10A SS16 16A BTBC42V32 32A (Mersen) SS20 20A SS25 25A BTBC42V40 40A (Mersen) SS32 32A BTBC42V50 50A (Mersen) BTBC42V63 63A (Mersen) NB: Also available in a motor rated version 92 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA TF DD SF6 - Size B2 Box Qty 5 TM EF SH8 - Size C1 Box Qty 1 BS88 Fuses Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 111mm / Diameter: 40mm (Size B2) Fixing centres: 133mm inner holes / 184mm outer holes ASTA 20 Certified Diameter: 59.1mm (Size C1) ASTA 20 Certified Part Number Description BTF42V125 125A Part Number Description BTM42V355 355A BTF42V160 160A BTF42V200 200A BTM42V400 400A NB: Also available in a motor rated version TKF ED SF7 - Size B3 Box Qty 3 TTM FF SH9 - Size C2 Box Qty 1 Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 111mm / Diameter: 59.1mm Fixing centres: 133mm inner holes / 184mm outer holes ASTA 20 Certified / 690V versions available on request Diameter: 74.4mm ASTA 20 Certified / 690V versions available on request Part Number Description Part Number Description BTTM42V500 500A BTKF42V250 250A BTTM42V560 560A BTKF42V315 315A BTTM42V630 630A NB: Also available in a motor rated version TMF ED SF8 - Size B4 Box Qty 1 TLM GF SH10 - Size C3 Box Qty 1 Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 111mm / Diameter: 59.1mm (Size B4) Fixing centres: 133mm inner holes / 184mm outer holes ASTA 20 Certified Diameter: 82.4mm / 690V versions available on request ASTA 20 Certified Part Number Description Part Number Description BTMF42V355 355A BTLM42V710 710A BTMF42V400 400A BTLM42V800 800A TKM SG7 - Size C1 Box Qty 1 JPU JP JCS MJ30 Box Qty 1 Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415Vac 80kA / ASTA 20 Certified / Fixing centres: 82mm 415V Fixing centres: 133mm / Diameter: 41mm (Size C1) ASTA 20 Certified Part Number Description BJU42V063PA 63A Part Number Description BJU42V080PA 80A BJU42V100PA 100A TKM200 200A (Lawson) BJU42V125PA 125A BTKM42V250 250A (Mersen) BTKM42V315 315A (Mersen) BJU42V160PA 160A BJU42V200PA 200A BJU42V250PB 250A BJU42V315PB 315A BJU42V355PB 355A BJU42V400PB 400A NB: The JHU range with 72mm fixing is also available on request sales@europa-plc.com technical@europa-plc.com 93
EUR PA 2023 Catalogue JSU JS JCS MJ31 Box Qty 1 Motor Rated BS88 Fuses BS88 Fuses NIT NITD SA2 aM Box Qty 10 Rated at 415Vac 80kA / ASTA 20 Certified / Fixing centres: 92mm 415V Part Number Description Rated at 415Vac 80kA / 250Vdc 40kA BJU42V020SA 20A Fixing centres: 44.5mm / Diameter: 13.5mm (16mm 32M40-M63A) BJU42V032SA 32A BJU42V040SA 40A Part Number Description BJU42V050SA 50A BNIT55V20M25 20M25A BJU42V063SA 63A BNIT55V20M32 20M32A BJU42V080SA 80A NIT32M40 32M40A BJU42V100SA 100A NIT32M50 32M50A BJU42V125SA 125A NIT32M63 32M63A BJU42V160SA 160A BJU42V200SA 200A TIA AAO SB2 aM Box Qty 10 BJU42V250SB 250A BJU42V315SB 315A BJU42V355SB 355A BJU42V400SB 400A BJU42V500SC 500A NB: See page 88 for a cross reference / selection chart for J type fuses LST STD LS Box Qty 10 Rated at 415Vac 80kA / 240Vdc 40kA 690V versions available on request / Fixing centres: 73mm / Diameter: 21mm Part Number Description BTIA42V32M40 32M40A BTIA42V32M50 32M50A BTIA42V32M63 32M63A NB: Other values available on request Rated at 240Vac / Fixing centres: 38.5mm / 48 x 12.7mm TIS BAO SB4 aM Box Qty 10 Comply with UK Electricity Supply Industry Standards and BS 7654 Part Number Description LST2 2A LST4 4A LST6 6A LST10 10A LST16 16A Rated at 415Vac 80kA / 240Vdc 40kA 690V versions available on request / Fixing centres: 73mm / Diameter: 26.9mm LST20 20A LST25 25A Part Number Description BTIS42V63M80 63M80A LST32 32A BTIS42V63M100 63M100A MD SMD Box Qty 10 TIS OS OSD aM Box Qty 10 Rated at 415Vac 80kA / 250Vdc 40kA 29 x 12.7mm / ASTA 20 Certified Part Number Description Rated at 415Vac 80kA / 240Vdc 40Ka MD2 2A Fixing centres: 73mm / Diameter: 24mm MD4 4A MD6 6A Part Number Description MD8 8A MD10 10A TIS100M125 100M125A MD16 16A MD20 20A MD25 25A MD32 32A 94 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA TCP CEO SD5 aM Box Qty 10 TKF ED SF7 aM Box Qty 1 BS88 Fuses Rated at 415Vac 80kA / 240Vdc 40kA Rated at 415Vac 80kA / 240Vdc 40kA Fixing centres: 94mm Fixing Centres: 111mm / Diameter: 41.9mm Part Number Description Part Number Description BTCP42V100M125 100M125A BTKF42V315M400 315M400A BTCP42V100M160 100M160A Solid / Neutral Links For BS88 Fuses BTCP42V100M200 100M200A NS NSD SN2 aM Box Qty 10 BS88 Compact Dimension Type Box Qty 10 Mersen Fuses Rated at 550Vac 80kA / 250Vdc 40kA Lawson Fuses Rated at 415Vac 80kA / 240Vdc 40kA Overall Length: 62mm / Diameter: 14.3mm (17.5mm 32M40-M63) Part Number Description Part Number Description BNS55V20M25 20M25A SLE120 Solid Link E1 (SS fuse) Rated 20A SLF132 Solid Link F1 (NS fuse) Rated 32A BNS55V20M32 20M32A BNEUTRALF2 Solid Link F2 (MES fuse) Rated 63A NS32M40 32M40A NS32M50 32M50A BS88 Bolted Type NS32M63 32M63A From the NS32M40 upwards the MES holder is required as the fuses will not fit the NS holder. TC CD SF5 aM Box Qty 10 Rated at 415Vac 80kA / 240Vdc 40kA * Box Qty 10: SLA120 / 232 / 363 Fixing centres: 111mm / Diameter: 26.9mm * Box Qty 5: SLA4100 / SLB2200 * Box Qty 3: SLB3315 / 4400 Part Number Description BTC42V100M125 100M125A Part Number Description SLA120 Solid Link A1 (NIT fuse) Rated 20A BTC42V100M160 100M160A TF DD SF aM Box Qty 1 SLA232 Solid Link A2 (TIA fuse) Rated 32A BNEUTRALA3 Solid Link A3 (TIS fuse) Rated 63A BNEUTRALA4 Solid Link A4 (TCP fuse) Rated 100A SLA4200 Solid Link A4 (TFP fuse) Rated 200A SLB2200 Solid Link B2 (TF fuse) Rated 200A SLB3315 Solid Link B3 (TKF fuse) Rated 315A SLB4400 Solid Link B4 (TMF fuse) Rated 400A Rated at 415Vac 80kA / 240Vdc 40kA BS88 Semi Conductor Fuses Fixing centres: 111mm / Diameter: 26.9mm (such as LET, ET, EET etc) Part Number Description available on request. To discuss your requirements call our technical line. BTF42V200M250 200M250A 01582 692 444 BTF42V200M315 200M315A sales@europa-plc.com technical@europa-plc.com 95
EUR PA 2023 Catalogue Fuse Holders For BS88 Fuses TCP Fuses (Bolt In) Box Qty 1 BS88 Fuses NIT Fuses (Bolt In) Box Qty 6 Bolt in 660/690V / Comply with BS88: Part 2 ASTA Certified Bolt in 660/690V / Comply with BS88: Part 2 ASTA Certified Part Number Description BBB125A4 Back Connected Part Number Description BFB125A4 Front / Back Connected BFB32A1 Front / Back Connected BFF125A4 Front Connected BFF32A1 Front Connected SS Fuses (Clip Fit) Box Qty 10 TIA / GTIA Fuses (Bolt In) Box Qty 6 Bolt in 660/690V / Comply with BS88: Part 2 ASTA Certified Clipfit 240/415V / ASTA Certified Part Number Description Part Number Description BBB32A2 Back Connected LCF20FC/FCBK Front Connected BFB32A2 Front / Back Connected NS Fuses (Clip Fit) Box Qty 10 BFF32A2 Front Connected TIS Fuses (Bolt In) Box Qty 6 Clipfit 240/415V / ASTA Certified Part Number Description BBB32F1 Back Connected Bolt in 660/690V / Comply with BS88: Part 2 ASTA Certified BFB32F1 Front / Back Connected Part Number Description BFF32F1 Front Connected BFB63A3 Front / Back Connected BFF63A3 Front Connected MES Fuses (Clip Fit) Box Qty 10 TF Fuses (Bolt In) Box Qty 2 Clip fit 240/415V / ASTA Certified Bolt in 660/690V / Comply with BS88: Part 2 ASTA Certified Part Number Description Part Number Description BFB63F2 Front / Back Connected LBI200FC/FCBK Front Connected BFF63F2 Front Connected 96 Sales: 01582 692 440 Technical: 01582 692 444
2023 Catalogue EUR PA Plug Top Fuses LD C30 (BS1361) Box Qty 10 Plug Top (BS1362) TDC180 Box Qty 10 BS88 Fuses Part Number Description 12.7 x 29mm / 240V SP1 1A SP2 2A Part Number Description LD6 6A SP3 3A SP5 5A LD10 10A SP7 7A LD16 16A SP10 10A LD20 20A LD25 25A SP13 13A Consumer Unit Fuses LD30 30A House Service Cut Out Fuses LA D55 C55 (BS1361 / BS88-3) Box Qty 10 ME RHF KR85 Box Qty 10 6.35 x 23mm / 240V Description 22.23 x 57mm / 415V / ASTA 20 Certified 3A Part Number 5A Part Number Description LA3 BME42V05 5A LA5 LC D15 C15 (BS1361) Box Qty 10 BME42V10 10A BME42V15 15A BME42V20 20A BME42V30 30A BME42V40 40A BME42V45 45A BME42V50 50A BME42V60 60A 10.32 x 26mm / 240V BME42V80 80A Part Number Description ME100 100A LC5 5A LC10 10A MF RHLF LR85 Box Qty 6 LC15 15A LC20 20A LK C45 LCS (BS1361) Box Qty 10 30.16 x 57mm / 415V / ASTA 20 Certified Part Number Description 16.67 x 35mm / 240V BMF42V50 50A Part Number Description BMF42V60 60A LK35 35A LK45 45A BMF42V80 80A BMF42V100 100A sales@europa-plc.com technical@europa-plc.com 97
EUR PA 2023 Catalogue Miniature Fuses Fuse Kits Miniature Fuses 5 x 20mm & Plug Top Fuse Kits 6 x 32mm Glass Fuse Kits Fuse kit containing 180 fuses in a segmented flip-lid box. Fuse kit containing 180 fuses in a segmented flip-lid box Fuse replacement references on the inside lid for easy re-ordering Fuse replacement references on the inside lid for easy re-ordering 30 x Standard 13A plugs: 90 x fast acting 6 x 32mm glass fuses: 3A, 5A & 13A 500mA, 1A, 1.6A, 2.5A, 3A, 5A, 6.3A, 10A & 16A 60 x fast acting 5 x 20mm glass fuses: 90 x slow acting 6 x 32mm glass fuses: 500mA, 1A, 2A, 2.5A, 3.15A, & 5A 1A, 1.6A, 2A, 3.15A, 5A, 6.3A, 10A, 16A & 20A 90 x slow acting 5 x 20mm glass fuses: 1A, 1.25A, 1.6A, 2A, 2.5A, 3.15A, 5A, 6.3A & 10A Part Number Description EFK180/4 Part Number Description 180pcs Mixed EFK180/1 6 x 32mm Glass Fuses 180pcs Mixed 5 x 20mm & Plug Top Fuses 5 x 20mm Ceramic Fuse Kits 6 x 32mm Ceramic Fuse Kits Fuse kit containing 180 fuses in a segmented flip-lid box Fuse kit containing 180 fuses in a segmented flip-lid box Fuse replacement references on the inside lid for easy re-ordering Fuse replacement references on the inside lid for easy re-ordering 90 x fast acting 5 x 20mm ceramic fuses: 90 x fast acting 6 x 32mm ceramic fuses: 250mA,500mA, 1A, 1.6A, 2A, 3.15A, 5A, 6.3A, & 10A 1A, 2A, 3A, 5A, 6.3A, 10A, 12.5A, 16A & 20A 90 x slow acting 5 x 20mm ceramic fuses: 90 x slow acting 6 x 32mm ceramic fuses: 500mA, 1A, 2A, 3.15A, 4A, 5A, 6.3A, 10A & 16A 500mA, 1A, 1.6A, 2A, 5A, 6.3A, 10A, 16A & 25A Part Number Description Part Number Description EFK180/2 EFK180/5 180pcs Mixed 180pcs Mixed 5 x 20mm Ceramic Fuses 6 x 32mm Ceramic Fuses 5 x 20mm Glass Fuse Kits Fire Panel Fuse Kit Fuse kit containing 180 fuses in a segmented flip-lid box Fuse kit containing: 180 fuses in a segmented flip-lid box Fuse replacement references on the inside lid for easy re-ordering Fuse replacement references on the inside lid for easy re-ordering. 90 x fast acting 5 x 20mm glass fuses: 5 x 20mm Fast Blow Glass Fuses: 250mA, 500mA,1A, 1.6A, 2A, 3.15A, 5A, 6.3A, & 10A 0.5A, 1A, 1.6A, 2A, 2.5A, 3.15A, 4A, 5A , 6.3A & 10A 90 x slow acting 5 x 20mm glass fuses: 500mA, 1A,1.6A, 2A, 3.15A, 5A, 6.3A, 10A & 16A 5 x 20mm Slow Blow Glass Fuses: 1A, 2A, 3.15A & 5A Part Number Description EFK180/3 6 x 32mm Slow Blow Glass Fuses: 180pcs Mixed 1A, 2A, 5A & 10A 5 x 20mm Glass Fuses Part Number Description EFK180/FP 180pcs Mixed Fire Alarm Panel Fuses 98 Sales: 01582 692 440 Technical: 01582 692 444
Search
Read the Text Version
- 1
- 2
- 3
- 4
- 5
- 6
- 7
- 8
- 9
- 10
- 11
- 12
- 13
- 14
- 15
- 16
- 17
- 18
- 19
- 20
- 21
- 22
- 23
- 24
- 25
- 26
- 27
- 28
- 29
- 30
- 31
- 32
- 33
- 34
- 35
- 36
- 37
- 38
- 39
- 40
- 41
- 42
- 43
- 44
- 45
- 46
- 47
- 48
- 49
- 50
- 51
- 52
- 53
- 54
- 55
- 56
- 57
- 58
- 59
- 60
- 61
- 62
- 63
- 64
- 65
- 66
- 67
- 68
- 69
- 70
- 71
- 72
- 73
- 74
- 75
- 76
- 77
- 78
- 79
- 80
- 81
- 82
- 83
- 84
- 85
- 86
- 87
- 88
- 89
- 90
- 91
- 92
- 93
- 94
- 95
- 96
- 97
- 98
- 99
- 100
- 101
- 102
- 103
- 104
- 105
- 106
- 107
- 108
- 109
- 110
- 111
- 112
- 113
- 114
- 115
- 116
- 117
- 118
- 119
- 120
- 121
- 122
- 123
- 124
- 125
- 126
- 127
- 128
- 129
- 130
- 131
- 132
- 133
- 134
- 135
- 136
- 137
- 138
- 139
- 140