B2113 Summer School 2016 Catalog HR

NTitEleWs!

Table of ContentsTable of Contents Award-winning, flexible resources to meet your intervention needs Retaining what is learned during the school year is vitally important during breaks from school as it contributes to a student’s overall academic success. Equally important is intervention to catch students before they fall behind. To support these crucial elements of learning, Teacher Created Materials presents an exciting lineup of new and popular resources to meet important intervention needs. Intervention Focused Reading Intervention......................4–7 Focused Mathematics Intervention............8–11 Literacy Support Nonfiction Readers....................................12–13 Fiction Readers..........................................14–15 Teaching through Text Sets NEW TITLES ....... 16 School and Home Connection Kids Learn!...................................................... 17 Take-Home Backpacks NEW TITLES ..........18–19 English Language Learners Language Power........................................20–21 Interactive Learning Explor-eBook NEW EDITION .....................22–23 See back cover for ordering information. 2 To order, call 800-858-7339

NEW Supporting Text 1—Second Reading: Teacher-Guided Adaptation Unit 12B..DqEewauixlfsiopelcoluslupartdsiileonsaaynttnRhostdehfesrwemtoauaimladdulietnditannhiilotdekgserapteabhrceooaovtufridttothhiuwneesghytlaeewstxstrisytla,oloiahngule.ohaantWrregtrthihtwtrheeoiitunsthetgkuxsihndtt.ugerSednaeaetscdsnoy’taqonslu’uodienu,rsiyedttoaiiaotduwlnowiscbioelsl.nerrFetviharadsetti,btohyonoeasurtadenx. d.t Standards 12D..3DsRu•.t•ie•u•sRDrshTattdAebeiThorahedneciveh“tptebetnettihgepebiuwhtrptoeeiwewosteohnoreRxntfrato.o-tthoaMieerhnetrDiltmxdgosgleeagoaitggoarsnwmqewtadnceoraouafludideaoeiatspetsentarlmushasseohernwdgtinesrnpsnisoodoftagonganrtonr.oorsabsdtestssemtoabh”iuttcabduihiearoslspl.asdcarenaocoelotedaaswfmnwbapnrigttdfeoesreifsumriedwr.hnwerpcieePegeetlow.lralesspoasrndTroi.syfsnith.etfssmttiFpwhaenilseeesnokaeatrtuaaoiceilmudnslnhroo.ddaeutt.iekhhodpriealsarlattiebsnbadcsongooeeadusrssrd.ctedtrihatInihiwbanggeteortstsafhnhtossredeslaoleoBibmngrweeahwefdtiotntuhshrtgr.eahiantIprlRogwisoesupiotanghrdnitahnidsntg:eagcssrainf 12A.3.Dtsa.A◆foqhicHttsluesclhCteWowaeteurehuvirwstraabeadtEairsuiRnltstmeo sliretsemntneeseelunWymtcsnecsdag.otq.oaaeeifrdDautopTldnlealeioirietsgreQnblstscdlrTsPiatouougotnls.auionrhetvfssugsodufdtssetekptghedet ns-iaasFhonverlete.nnoeueeintnwdtsvRrsssdetTcwaweesesteexiecnodlmeeCxnttthcl,hertrictheivs-eriaaanonDre.aeisstetfdlgfrcelryestgoanokphspqrsbaremt:erehoutuioinrDnnhyneesdrtdgufeeasswheoteterrttoeennrieieison(lmxtdtlprtaangspeedQaasssssxtliSgtiuiosetatcntitcehoe.oaiecsctusenr1puelltdcysyai7pfhsoe22srt)rpnmos0ot,.edh.ols0mfiatoeesr2ahttntractqeeewtshtnnuhatitihvrsenceefaeiexosditttrneyttertisrxoahstseouthtshneslnuaeupesttddnheteoboieedetxonnrrnot(nbstsptthetatsashoaadsesteagnichabassedaanakycficst2soitntntiw3trvgighv)ietietryyon • Reading: Ask and answer questions tuonddeemrstoannsdtriantgeof a text, referring etexxptliacsitltyhetobtahseis for the answers. Teaching through Text Sets • Writing: Recall ieinnxffpoorermrmieaantticiooennsfofrroromgmatherNEW page 16 psnaoroniuntdretcssaeonosr;ndtteasdovkigieudirtbecanrelicseef into categories.TITLES • Content: Understand teiahcnoanhaprnvwgtaldiarrawaoacnryhceensits’pemsetmnrhproeiashtsdnhttsytuieaucsccfisrchef,vea,asicvlontemgees ontehwerlsomcaotivoentso, yet others move into tehnevtirroannmsfoernmt,eadnd some die. • Language: Cinofmormmuantiiocna,teideas, and concepts nathecaceedasersmeaariycosffouSrcccieensscein. © Teacher Created Materials 23296—Teaching through Text Sets: Adaptation 22NEW Take-Home BackpacksTITLES pages 18-19 Tornadoes and Next Stop: Eagles Craft It: Hand-Blown CHyuArmriocuarnes! GTihnegeCr aMrcrDibonenaenll Christopher Blazeman Glass Madison Spielman INK PAD INK PAD INK PAD INK PAD Explor-eBook CShpraisctieneEDxupglaonration JTehnenifDerigPerisotrive System DHoitnaItH! HeriwsetockryRiocfe Tools DASotnnaaantHgomeerbwyeuctkTRriucee: Gross New Products INK PAD INK PAD INK PAD INK PAD pages 22–23NEW adult frogEDITION The Life Cycle DFPaohniylausHriceeasrwl FecekaRtsice& TDimemotohynJs. oBfratdhleeyDeep BAAlanllnimicnaaaAtpoDoradayc’sa.W.. ork: TBTerhceehaCnkouthltotrgionyuggEhdsgine: of Change INK PAD INK PAD INK PAD INK PAD ftrhoegMirs.oliTsvtheose.fyuBbsuekgt nihnoawavseaeybgooguus ttahtnhodeutglhihfetenacbcyhocaluentsgtoehfeabnliudftetgecrryofclwileestohafrnoadughout froglet eggs human being? Life Cycle Njueswt bbeogrninbnainbgietsheairre of a Frog life cycles. tadpole 4 adult stinkbug with hatchlings and eggs 5For correlations, research, samples, and online ordering: www.tcmpub.com 3

Intervention Focused Reading Intervention Levels K–8 Bridge the gap between struggling and proficient readers with this rigorous and focused program aligned to all national and state standards. ◗◗ Teach literacy skills with lessons that focus on foundational and key reading skills.Each kit includes: ◗◗ Reinforce reading comprehension skills needed for literary and informational texts, text evidence, complex texts, fluency, academic◗◗ Teacher's Guide with 30 standards‑based vocabulary, and writing. lessons ◗◗ Lessons include differentiation tips and language support for◗◗ One full-color Student Guided Practice English language learners and can be adapted to all RTI levels. Book (Each kit includes a single copy; additional copies can be ordered, Key English Language Arts objectives Teacher's Guide see page 5.) are highlighted.◗◗ 6 interactive, standards-based Literacy Understanding Characters Lesson Games in print and digital formats 15◗◗ Assessment Guide with formative and summative assessments and Learning Objectives Materials Literature progress‑monitoring opportunities for each lesson Phonics and Word Recognition: Ensure subject-verb and • Student Guided pronoun-antecedent agreement. Practice Book◗◗ Digital resources including student Vocabulary: Acquire and use accurately grade-appropriate (pages 6-–11) reproducibles and electronic assessment conversational, general academic, and domain-specific words options and phrases, including those that signal spatial and temporal • Teacher Resources relationships (e.g. After dinner that night, we went looking for • Literacy Game BoardsSee page 7 for complete kit pricing them). • Digital Literacy Gamesand ordering information. Reading Literature: Describe characters in a story (e.g., • construction paper their traits, motivations, or feelings) and explain how their • crayons or markers actions contribute to the sequence of events. Writing: Write an argument in favor of or against becoming an inanimate object. Progress Monitoring Skill Overview: Understanding The Student Guided Practice Book pages below will be used Characters by students throughout the lesson. Analyzing characters allows readersPreviews of Student Al’s Choice Name: ___________________________ Date: _______________________ Lesson 15Lesson Name: ___________________________ Date: _______________________ to understand how a character’sGuided Practice choices, motivations, and characterBook pages assist bHMkfofyienerocHyohipteItkesHbLousoitptvetshnotaawe-yHe.rcalhiweslandOofiirbrtapqcqiiffkHsayoaovmHDrweftaote-uwb.uesbvlerokoIVnnahooreeiHHeeeesnirorn-IoattwQnc-.Adkfdtulshcysic’hefEolishoosqyeedmntfokbtnaitseuHechktygitaomioosbcu-meoooshgmhljoaataospcDaouutvrupuoaihoqnorrdpmotures’oileeosttresaoroto,neikuk,HevarahedsotktpnsgokurisHvl..Hevaentch.kecyeewosaernheiogellfehntyesieasiaHoWiwbeusrHedhnbeefhstra.thtmtrativwfcheyeocn.uroeseohe.nr.ewba.etHhtShtgeetdnf.erosoeowboonhldoeaciwHeliArdkaroeirsetwretodbeenionhneayis’aecsknscistdnrcbcrkeessstsnhtpah?lthoasdesggmsokononoithstcosreei.kmedaeeonrtaskkyheeuiln,ersdRkrnselibiieagtsontlns.btddyoidthhivhabgo,efceeteraglselbdaotsvatoret.thsetnslyrhahodlsae.aHnooit.uwesnsmiUpownsgihtaeot,anatuarhn.hnlewcahsltwvtleyspdihttsdonlttcieansTitnffheaioantwnehudhhllwtwrfhnterasewherhgHarydoghorho.hnb’nxiecdgieseiihstjlonoeieartel’stoteuirdhAtseHlobsibwhnslnketbeaetoohsiHhnriawbwnoFobrdbsdgl.dtlokeenhdehweealioddl,rbsaoooo.stcgHfieadipBrlta.hwilohsnwsyfbektruyhoyoneesrloueaek,edad,aswbhvHetilacnegbra.radvisttalcaeiiietidcoeffirhrH.gnttneemeeesgHr.fcayIaeti,tleheydrddncoagailndHrareotaHvoPeterlfgtwleladgcnlo.shbgheeisficdeoatnbbaotne.aomreteiaathocttcjAmfowycodcorcdupthlotHewhrdoaatteodrnkobsep,roerfenhe’hroosb.tredeyehyrvdabikniocafvssHeeraoesdtoerboiceodke.ergeiryksrthwe.so.sinth Word Work 15 traits influence the plot orin preparation and sequence of events. Readers areinstruction. Part 1: Prefixes Ask It!_____3_______w__t__Wh2__o_T__a___re___thpk___l“___Albeo_oI__1,__T_sdSo_c_u_td__f_Dhkoyt_r_h_ogci__j_atiedoE_uo__reoghwh_r_i_Tt__sr_utuheve_b._b_tnat”h_e__eyl-tiag__a_unedraP__co_orcd_th__yatsny_t_hcuh_Arue___rtifo’_a_ho_ir.detow-_g_l_onm_P__avdqt_ns_ch_regt_ri__por,o_u_o_cbse.tdh___oekAu_-k:_e_kii_s_P_nAnvtem_sil_R_leo_dn_t_teodrt__l_hehie_..__dgook_e_h_teeas___tenv_a_IiH_uoadymhQ__n_lro___rmnlwde__n_heged_oku__tgo__i_aeahm_n__itstena__d_cnhhhhe__eQ_os’o_h__ibteg_oy__trfosbv__u_io_keu__pnmyioio_hQ__etyenc__l_aeeyn_d_e_os_oo_o_sutha_a__:tousw_nw_n_hseaiid_a__fsn_o_e__aagsgb__t_tw_ty_a_v_asnathhe_ae__.is_eg__i_he:hdeo_d_n_b_e____haobl__n_,m5_e_y__t_tefl_e__ah:l_d_r___hWoaoe_n__rae__i____svawne_n_d_n_____s_ipms_A_g_,te__m__t__api(___h.alco__bw___n_e__o_raadn____a__Hdnth__r_lp_ie_ce___l_edeo___ypwik_yd_____sd,_,__.ic___t__r_ltw._af_m_aay_i_e___Lo_nt__,lr_h_aI___ek_r_oead__t_ar___i__h_tpfst_a_sn_th_u_m_h_t__,e.u___g_te_l__e__nwrt_.h__a_r_e__t__i_iy_hC_oog__Bt___t_wb___uehr__l___r_tu_uue_n_gath_i_____gt,__bs_,hs_e_h_,___tht__w_.t_ee__em_h__-tt___n_dh_’p_i__e_d__ci_a_o_e__rn_y_k_h_y_o_ru_____eb_h_i_etv___g_m__ht_e_,a_o__h__ __i_dtw__ks___.a__t__ioh_k_c__n_N_oy_e___gd__)ru_o__o.._qn_,__ut_th_h_ee_eedstion required to understand all aspects Directions: Divide the words below into prefixes and base words. of a character. Then, they are able to understand a character and how Word Prefix Base Word Word Means their decisions influence a story. 1 impossible In The Boy Who Loved Books 2 unlikey Hector Quarto’s character is both 3 recount explicitly stated (he loved books) 4 unfinished and implicitly stated through the 5 impatient types of books he enjoys (his love of mysteries indicatees that Part 2: Academic Vocabulary he is a problem solver) and his reading Directions: Complete each sentence below with the correct word from the behaviors. Word Bank. begged Word Bank sulking frantically 1 Joey spent the day _____________ in his room when the TV was taken away. 2 Gianna _____________ to stay up late to watch a movie. 3 We _____________ searched for the missing snake. Challenge: Choose two or more words from above that have prefixes and write a new sentence using them.Intervention image credits: tim bradley, shutterstock ________________________________________________________________ IMAGES CREDITS: XXX ________________________________________________________________ © Teacher Created Materials #12173—Targeted Reading Intervention, Level 3 B A #12173—Targeted Reading Intervention, Level 3 © Teacher Created Materials Lesson Lesson Name: ___________________________ Date: _______________________ 15Name: ___________________________ Date: _______________________ Answer It!DinSeiyhtrEorc1oshA_aer_,opu_vep_ac_l_hm_ee_n_2pt_ahHt_i_n_r_ie__dsber_u_y_o__d__exo__ns__im__nn__nWt_w_dw__.__sfs__g__”s_e_aooo__eue____:__hd__nwmrmch__e__c___R_a__id__hik__noms___tse___e__hi__ue__wt__aoc__hao__oa_h_il___h_ng__dhden__gdf__e____oh?__aao__e__iyyt___b_itdt__byo__h__co___h_e__ooyd__ee__uay____ea__onr____se__dpd_ssn___ud____to__th__oa__te__hr__snaa__ose__e__esc__e__gls.___sc_r__rcdra____a__rei_m_oe__AYg__omi__i__a_n_sub__eo__l__od__th__,p__neu__ah__vb__y__iai__tr__is__aAne__de_ne_t__k__v__elgp__d_e.l_d_n_oe__’__ds__as__,__aow__tH__er__t_r_hnh__fw__ot__re__o__i.ae__dav__.__sl__r_m_np__ae____mHs__m__dttp____a__atih______ioeohv__ok__al__e____nnyi__ietn__c__ns_,_h__Ces__?__os__g_t_h_t_eyw____uhl__r_._ir__uWf__i__lpee___o_p_d_bt__L__rr___r_r.__hw.__e__hu__at____wy____hiTs__esw__t____t__etedoh_a_____ea__en__rog____qsd__h__k__iee__h__g_u_e_i_s__tsh__s_i_h__.ehn__s____ih__m__tsme_o___Hm__,t_e___r_u___i_o_t__o__eo__hstg__w_t___on__t’t__hhe__d__re_h_____ye.__udu__’__e__bl__r__gos__hl__Nr__?e__i__g’__ma_n_st__e___o_l__hd__ge__vn__a_,___e__o___c_kew_h___r__i__ore__v__uec__i__i__ui__t__egn__id__hc__tn__,h__n___eo_____t__tt__in_u_“e__hn____t__A__cdl__ih__g__d__se__l____i__t,n___n___h____’____gt__e________.__i_____r______________________ 15 Written Response Name: ___________________________ Date: _______________________ Directions: Write a concluding section for Al’s Choice. Be sure to AskPraongdreAsnsswMeorniQtoureisntgions2. Lesson show what choice Al makes and the consequences of his choice. ________________________________________________________ 15 ________________________________________________________ ________________________________________________________ Which words below contain a prefix? 2.AaTuothsforharoncwthicouaorlglsyeenfcoyr,twhehigchrewatoersdt ________________________________________________________ A image ________________________________________________________ ________________________________________________________ B remake might an ________________________________________________________ effect? ________________________________________________________ C careful ________________________________________________________ B quickly ________________________________________________________ D undo ________________________________________________________ C slowly ________________________________________________________ ________________________________________________________ D easily ________________________________________________________ 3swFhTdTeor.heBihrueleAeaieWlnycdticldhhmoamlWhsaicesuWceuorotoyhhsinfsoh.?cfadyteokyhtitoDnyifhhYoeid?sgtaeescfihioddv?totqehLr,enlu?Deahsi’ebtbateebseevrhntaaewiitecdokernhaneyndbsi?dcpaesboeekasacsnelelkieorlcbeytvoihreoeaks5eluaioi0stelswoi¢ensb.geaaaeastwNctkoaaosanyutosftlenrheoeaehmsewpt 4lahohasnaitsed.eg.gBoAscaoWioDonatlohghldaWkioaWvctaiuniohehldigdmlalboshstDiftuottnd-hataysphciartdvreeaetoiadDdvchslllooaoeeeanokvonathifiettkndeialtittgynheh.bdceqaelcIebiukmtoltsaateesllks?sebotatesteoticcdo5lktooonh0etwoo?he¢dkke.aiiemesW?,k?shat ____________________________________________ C C ____________________________________________ D What recipe did David use? D What is important to David? ____________________________________________ cHooowkielosn?g did it take to bake lHiborawrymnuecehdm? oney does the the #12173—Targeted Reading Intervention, Level 3 B A #12173—Targeted Reading Intervention, Level 3 © Teacher Created Materials © Teacher Created Materials © Teacher Created Materials #12173—Targeted Reading Intervention, Level 3 B © Teacher Created Materials #12173—Focused Reading Intervention B Comprehension strategies reinforce skills needed for literary and informational texts.4 To order, call 800-858-7339

Lesson Plans and Student Guided Practice Each lesson is accompanied by a full-color student page. Lessons focus on strategies for strengthening student comprehension of informational text and literature. Teachers may use these strategies before, during, and/or after reading. Teachers choose which lessons make sense for the needs of their students. Text Passage Students will read and reread increasingly complex texts to practice fluency. Professional recordings of each text are also available and can be used for prereading, reinforcement, or independent practice.Language and Vocabulary Word Work Lessons teach key Student activities focus on foundational and academic vocabulary to key reading skills to build conceptual help readers become proficient. understanding of words. To order Writing complete kits, Students use text see page 7. evidence to recall key details for the writing activity.Student Guided Practice BooksEach complete kit includes a single copy; additional copies can be ordered. See page 7 for pricing and ordering. Level K Level 1 Level 2 Level 3 Level 4 Level 5 Level 6 Level 7 Level 8 InterventionEnglish SSC21174 SSC21175 SSC21176 SSC21177 SSC21178 SSC21179 SSC21180 SSC21181 SSC21182Spanish SSC21421 SSC21426 SSC21431 SSC23200 SSC23210For correlations, research, samples, and online ordering: www.tcmpub.com 5

Focused Reading Intervention (cont.) Assessments Easy-to-use Assessments in Print and Digital Formats ◗◗ Pretest ◗◗ Oral Reading Record ◗◗ Progress Monitoring Quick Check ◗◗ Summative Posttest ◗◗ Performance Tasks Name:__________________________________ Date: _________________ Literature Asking and Answering By Sharon Coan PosttestName:__________________________________ Date: _________________ Questions Pretest 1Q“SSgSHpuSh“h“aShPrgBhcBeaeraHoooa““rula“waysSewueWmCaowvAg,wztichnayetsnniezDna1baionnahr’D,lssdcnu’s.tewhsneaahter uoacdsd aoatddwdisn miedolAptaedu,dsuAa!ahmepBd1yd”rt,SCynnesbtddt”eola–aeohonhStd’apocattcuihSl7u uooarytaaheduld ySeob ’adSehnu:rmwm,drSaw’todbsdhs”fieotehsadtRwnahbrnphaeahuateetucfwrhabeigeaaaeesawlnlcodnlorgwifarlpaaiknnedkwcagiasusonrshnydcnseiaeyecdnd,.litlgnzdtpihkl.nweniotllo“nyowzzheocbbat“rw_onWu,oliaagehwaoWawtdtriana_tuitda?nkfhrniehntwlnhhb_tuthtgen”eelgetehoehegehte_eashpdloystrassdladoeniss_tgtituytakfotsdtnthehk,f.hett,ahsilftogyoedoetSnsibeidnseroi“efas“cotitraatIr,euc,elphIhIrhbkyugpefgffr“sdlda’tatileaeoemiaaeehnueIaoPrang.t.cStalnua.si.cwacpyshlepedanahntd?.h“vetgp.netarTditonaLtee.yeoenoesra“hrmwhParop’nikesHmnrtyss“niie.uteoantnn,ttYid”Petg’ontaiaitsgtooSsnncaewevyo,tteguldtehesttoacaeaidohteesamenoahnthypidlPounetssvatoletuloweuxreaevu2rPtmrtgudpoyrtetcehad.eea ftenoot rltebittfh r.asoocn ro’meoW”aAtta.Bntgynio.hlCgtsisDpeleaihninhHkoeehngvlrege awa.oeae ghtIqig Rttybvs hgdtPn.gmtdbHuaC”dte,lreouabdtaraheaecsoiretoasrialianaslstarslhseknea.klmgeahassdot”gnesgeetdikwogeraeuteoyipnentwsenrwna.narirgwener.tdteriogtfoIohdohbsndeewao?uu.pm,waamgyorwwPosmlhlo?eIdi.lgatiaeeil”i.fassphtalanltnenvhmlydeeerSdtsteooaoee.c.shwrig””tgun.dpiayiaavthecnoulowraeteaeutaoinhntebsyg?ttde.toyoehe”lhloeuYe?Ppceua”oeltresduwtsnoaeuao?lnyvll.Le,”aesson V = visual Questions 1–7: Read the passage. Then, answer the questions. Oral Reading Record Cues Used hTtP“ih“i“mnhNJssaWrJBebuoBlaitusebuorgernrstlhrseditehytmedlyctwh!yyaddtt”akh?lbai.hna.o.snnehnlsheioTegtx’WeNdonodiekd.hptppxsioghBhgetnJfaheplworoaiurgcarnoreoeettystntue’dwtomdlstaycweydt,unlhseoenooawbothhdaudvhosuftithietssoekhsnhntpwaroariebeaeehnterftaphreyweodcgwBsvbedpii,soiarwte”hass.inhyullndbeByasvdaeaso.ilsonarolgrobwywtyina“owwochhaNldaiieu,orldnnan”tyentodwadgbPaBawaytnoetedntha.nrhw’ohnyttysewderiwtawdnfSiaewlncugteodonaonkriclr?onsdnlo.aehotaktdounhdisiewHemfdonaedducw,wede.—uwsDtna!?euwrt“iet”athhnrWNtraltnPaihydyghsso.tiheaoyeniaw.ttwnagsrhnctl.iHhllenectaouoekdo“erwccH’ey!kfdka”seias;nleyancfikPoyipgteene,huapxldaihetitetdltrir’lasdttsiyolcosresibqkebnnhhrpbuegoweoioris?wetaaosr”hbtbsaittlnehPetlyhsergedtau.aoirt.tolpduroluuiItacbusttsokieslwnfeeeganetsph.e E SC Name: ______________________________ Date: _________________ Assessor: ___________________________________________________ Total Word Count E = errors SC = self-corrections Codes S = structure 130 M = meaning E SC Cumulative Text Word Count Al stopped in his tracks. The movie he wanted 1. Which sentence to see was finally out. And he even had money Bryan’s problem to buy a ticket. Well, the money was supposed to be for the baseball trip. That’s where he was headed—to sign up for the trip. The money was right there in his pocket. As soon as he heard about the trip, Al had tells you what 2. idbwdeTorxeahoeaanetschtotetalefhydurti—tswhuhithsosheiarnilsstltgwouBarhrnsriyitnyas?eaobssnyo,leiu“hndTtag.h”tdlhaniteWt’ttlwmehaaastin begged to go. But his mom said they couldn’t is? afford it. Al was so disappointed. He had BA s““tHNilleoawwslaweseepinc.”alnucuks;ePtahtericsklewd!a”s spent the next couple of days sulking around the C haB“niTsrnyhsoaalenytidnwh.”gaadslinett’xtlaewcbtalrnyotwtehdhe—artuhsising house. “I see how unhappy you are,” Al’s mom BA sPtBlheareetyrpasicelnekrd.disoweaistnvhe’tPrywatalringicthktt.o share had finally said. “Let’s figure out a way to get the money.” So his mom scrimped and saved for weeks, and to do his part, Al spent his spare time helping neighbors. D Ssahyasuhneawlwilalydsod.oes what he D cs“llBoowrcyklaynnaeonxptdetlonoeohdkisehdbiseadet.yt”ehse C Bryan and Patrick dislike 18 © Teacher Created Materials snow. Go On TOTALS D Patrick took Bryan’s sled. 28 © Teacher Created Materials Error Self-Correction Accuracy Time: Go On Rate: Rate: Percentage: 38 21461—Focused Reading—Assessment Guide © Teacher Created Materials Reporting tools for student and class results Pretest Performance Task Summative Posttest Games Motivate struggling readers and reinforce reading skills through the use of games. 3 Literacy Game Sets 3 Digital Literacy Games Includes everything needed to play the engaging games. Fully engage students with skill-based games that can be played on a variety of devices. diarnekscewtyioenrs walk: soak: open: paint: • walked • soaker • opened • painted • walker • soaked • opener • painter • walking • soaking • opening • painting • resoak • reopen • repaint directions condition: • unopen • conditioned curl: comfort: • conditioner • curled gain: • comforted • conditioning • curler • gained • comforter • recondition • curling • gaining • comforting • uncurl • regain • discomfortIntervention HoBwe thteoplWayienr !with the most bee markers at the end of the game! build: + 5184–3720+22=8G1 =a+m7e872B–17o24+a12r=1d9 = + 8214–7455+04=79 =i10234 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards • builder coil: help: stitch: • building • coiled • helped • stitched • coiling • helper • stitching Set❏❏❏21t3..i.nPgPcSbogTraaolhonomarfhuadtcUteteerfeshhcfdtlempett.aehtlf!galheStoearh3ehuksgmeutreHae“fprmhfiAsllvbiaeev”eoyebtceagshaorr.aedramgdT.r“odseBheaei”bsnnnofcd,itaarhprrpsdedltlaasamycnaemidndtdodchvhlpeeeomlsaooctfsfeoeaasctltlhheapdeeslmoealweytffenotar.fcsaeg. sdatmoawceknmoinnartakhneeorstghaaemnrdeswrto•e•••a••a•n p c s ewwwkrrrhoreeeeaaar:pppbsssthohoho:urrireeinttltrddieegnrdg • uncoil • helping • unstitch • recoil • restitch trust: 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards i10234 i10234 camp: • trusted i10234 • camped • trusting 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards 2 i10234 3G9 a12m3.4.56...e.1FaNs2mIlIuoh1IoTTfNfet5frufiuhtxvhfyiysoheidteeomexto,aet.utmeuadcwfoewigh:rhriho!rattosIa6tseahhwtfrvutveedptetremaihntlmgmcahnec,arryaeaooradeertkrkutarorrdeteatupcohterwsrn.ftosedersswowacaeraomotooniceunrlorsaldedtseettrhadc,bawtolethuenfrowe1sfr“eroeooAt0adghrmrli”aemedtawms,naita“tnohtdeaBrparekc.a”dkltkeah“e,scryBeeapsaeannr”lprwadmdtsreygitenttaneamorfrstcciyksxekcotethr1.ovoaree0ernaacsgsmdtnouetamdoramfaefrptbikaexhwlide.anecorcertsrlehee,dtsaefth.thtie.retAeoopaloplnrtrlepaeywflyaoiaxoely•urrweo rdwrrroseirwtdha. sh • camper • distrust • camping 1 fill: read: • filled • reader • filler • reading • filling • refill 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards + 316 + 500 = +48 ÷ 640=9 + 527 = +24 ÷ 364=4 + 203 =i10234 11 10 i10234 30 9÷760 =– 70 = 806 – 272 = 499 – 104 =4 37 5 © Teacher Created Materials 38 +56 ÷ 83=90 + 77 = +16 ÷ 49=38 + 42 = +15 ÷ 362=0 + 110 =i10234 14 Directions and Answer Key © Teacher Created Materials 13 i10234 8555 – 340 =42 9 © Teacher Created Materials 586 – 82 =40 7219 – 107 =41 18 12 ÷ 4 = 16 63 ÷ 9 = 17 25 ÷ 5 = © Teacher Created Materials 45 44 43 6 To order, call 800-858-7339

Progress MonitoringProgress-monitoring assessments help teachers identify specific strengths and weaknesses to informinstruction and maximize class time. Methods include informal observations, classroom participation,activity sheets, and student responses.Differentiated Instruction and Language Support Lessons include differentiation tips and language support for English language learners and can be adapted to all RTI levels. The Extended Learning suggestions offer extra practice for all students, especially those performing on or above level.FOCUSED READING INTERVENTION SpanishLevel English Spanish Price Each Level English Price EachComplete Kits Student Guided Practice Books Intervention Complete kit includes a single copy; additional copies can be ordered.Level K SSC21137 $499.99 Level K SSC21174Level 1 SSC21138 $499.99Level 2 SSC21139 SSC21418 $499.99 Level 1 SSC21175 SSC21421 1–9Level 3 SSC21140 SSC21423 $499.99 Level 2 SSC21176 SSC21426 copiesLevel 4 SSC21141 SSC21428 $499.99 Level 3 SSC21177 SSC21431 $14.99Level 5 SSC21142 SSC23197 $499.99 Level 4 SSC21178 SSC23200Level 6 SSC21143 SSC23207 $499.99 Level 5 SSC21179 SSC23210 10+Level 7 SSC21144 $499.99 Level 6 SSC21180 copiesLevel 8 SSC21145 $499.99 Level 7 SSC21181 $9.99 Level 8 SSC21182For correlations, research, samples, and online ordering: www.tcmpub.com 7

Intervention Focused Mathematics Intervention Levels K–8 Reinforce key mathematical concepts and build mathematical fluency with this engaging, standards-based, easy-to-use intervention program. Each kit includes: ◗◗ Build conceptual understanding and procedural knowledge for struggling mathematics learners. ◗◗ Teacher's Guide with 30 standards‑based lessons ◗◗ Improve test scores with diagnostic assessments, concept tasks, and performance tasks that mirror new state and ◗◗ One full-color Student Guided Practice national standards. Book (Each kit includes a single copy; additional copies can be ordered, ◗◗ Improve real-world problem-solving skills promoting see page 9.) college and career readiness with Math in the Real World concept tasks. ◗◗ 6 interactive, standards-based Math Fluency Games in print and digital ◗◗ Differentiate instruction through Refocus Mini Lessons formats that include independent practice and activities. ◗◗ Assessment Guide with formative and ◗◗ Engage students and guide them toward independent skill summative assessments and application with interactive math fluency games. progress‑monitoring opportunities for each lesson ◗◗ Digital Resources including electronic assessment options, student reproducibles, and 30 Refocus digital lessons See page 11 for complete kit pricing and ordering information. Refocus Mini Lessons are provided Lessons feature key in PDF and PowerPoint® formats to math content process edit and annotate on interactive and practice whiteboards, computers, or tablets. objectives.Intervention We can use base ten blocks using tahnedexwpraitnednedumfobremrsstrategy. To order, call 800-858-7339 64 23 tens ones Previews of Student Guided Practice Book pages assist in teacher planning. 8

Lesson PlansStudents will learn how to be active math learners through explicit instruction of mathematical strategies. Each lessonsupports and ensures the successful transfer of key mathematical concepts and procedures from guided practice toindependent application.Teacher Think Aloud Guided InstructionThe teacher guides The teacher guidesstudents with Think students in discussionsAlouds, establishing and working oninvestigative questions, mathematical tasksand modeling together.mathematical examplesand tasks.Collaborative/Independent Progress MonitoringStudents progress The Student Guided Practicethrough the problem- Book includes a Quick Checksolving process, asking and Math in the Real Worldquestions, conducting concept task that can be usedself-talk, and clarifying for ongoing progresstheir understanding in monitoring.writing. To order complete kits, see page 11.Student Guided Practice BooksEach complete kit includes a single copy; additional copies can be ordered. See page 11 for pricing and ordering. Level K Level 1 Level 2 Level 3 Level 4 Level 5 Level 6 Level 7 Level 8 InterventionEnglish SSC21201 SSC21202 SSC21203 SSC21204 SSC21205 SSC21206 SSC21207 SSC21208 SSC21209Spanish SSC21436 SSC21440 SSC21444 SSC21448 SSC23238 SSC23246For correlations, research, samples, and online ordering: www.tcmpub.com 9

Focused Mathematics Intervention (cont.) Level 3 Level 3 Assessments Assessment Guide Easy-to-use Assessments in Print and Digital Formats ◗◗ Pretest ◗◗ Summative Posttest ◗◗ Progress Monitoring Quick Check ◗◗ Performance Tasks TCM 22201 Pretest Performance Task Summative Posttest Reporting tools for student and class results Games Games motivate students and support math fluency goals. 3 Math Game Sets 3 Digital Math Fluency Games Includes everything needed to play the games. Fully engage students with skill-based games. diarnekscewtyioenrs 1. 718 16. 504 31. 81 2. 436 17. 112 32. 27 3. 953 18. 215 33. 7 4. 816 19. 726 34. 5 5. 936 20. 576 35. 8 6. 847 21. 838 36. 6 directions 7. 467 22. 40 37. 5 8. 980 23. 32 38. 8 9. 730 24. 70 39. 8Intervention Game Board How to Win and multiply your way around the park to Finish! 10. 316 25. 72 40. 7 Add, subtract, 11. 546 26. 18 41. 4 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards divide, 12. 271 27. 12 42. 5 Setting Up game board number cube and pencils 13. 900 28. 36 43. 3 Parkapalooza scratch paper 14. 534 29. 10 44. 7 pawns Answer Key 15. 395 30. 36 45. 5 + 5184–3720+22=81 = + 7872–1724+12=19 = + 8214–7455+04=79 =i1023423075 (i10234)—Focused Mathematics—Parkapalooza Game Cardsi10234 i10234 213...caPsDTErctnladarhiaukvacsecmeitendhctbthesuphehtprlerhauna3ygsefspetfaaelrcrmeorarctlraeaslhdin,nnobsdadgooninspaatderthlaopsdpecealsienannepyucpetaimacahlwcoretbahnnoetmtesawritnnisacodudtcurdaekkbpclseekflotaa.souoccfftTeetoatshdhrhleoileeetwplapoemlcnanlfhatyao.ySetmnehtrrasaipr.twttsrh.GohgsboTaiyvlmhemreomeebelnlsabos.pclothlh(aa+reypd,elha–rsiys,pgexahr,ce÷es.t). i10234 3G9 a12m.3.Nt.he1Fsoa2eIntpTnr1otffmhTu5aeeordhyemcar:ioeeiecsmAfmuaboPshfync.ielleseorvohasrossrIeuwct6lefot.FevueprfyeciuOrrulonshancnpsKuiray,eosaneoehildrrcfarcouyr,eneyceltttsilodaochsfotyrtuenthfrlodooyeeelnpcsu,aaewalsinncaadrrntihduyodane+eaylmsd.Fol,res.don–bi)decnnu,elp.aiorxrsyai,ssThnocrpeoahuugswarterbtceti÷nhetensospessiatw!taayFng’scicmtdaIieknhtfmb.hmiatsioeeinIshmol.fs,nyvwtnedeoersoixurunfattrco,spwuptr.milnlwoaaaPsynoay.clvosreaa,edurSyrf’sthdbotthbhutalfluaeecforftrkofwlngowmema.rtaaemaht(nrnheCaedxdymnaxhxattxyrexh.geos(caeitunxkaixsnxecxe)k—Focused Math—Parkapalooza Game Set 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards 2 i10234 9 © Teacher Created Materials 1 23075 (i10234)—Focused Mathematics—Parkapalooza Game Cards + 316 + 500 = +48 ÷ 640=9 + 527 = +24 ÷ 364=4 + 203 =i10234 11 10 i10234 30 9÷760 =– 70 = 806 – 272 = 499 – 104 =37 © Teacher Created Materials 5 4 © Teacher Created Materials 38 +56 ÷ 83=90 + 77 = +16 ÷ 49=38 + 42 = +15 ÷ 362=0 + 110 = ADnirsewcteior nKseyandi10234 14 © Teacher Created Materials 13 i10234 586 – 82 =40 7219 – 107 =41 555 – 340 =8 42 xxxxx (ixxxx)—Focused Math—Parkapalooza Game Set © Teacher Created Materials 18 12 ÷ 4 = 16 63 ÷ 9 = 17 25 ÷ 5 = © Teacher Created Materials 45 44 43 10 To order, call 800-858-7339

Differentiated Instruction ◗◗ Support English language development and build oral and academic language proficiencies, with high-interest, rigorous vocabulary activities. ◗◗ Incorporate the Refocus Mini Lessons highlighting the math concept being covered, along with independent practice and an extension lesson. Roll a number cube and write the numbers to create each addend. Then, add. hundreds tens ones (Student Guided Practice Book, page 9)Math in the Real WorldMath in the Real World concept tasks allowstudents to:◗◗ Practice each step of the problem-solving model in real-world contexts.◗◗ Strategically select and use appropriate problem‑solving tools and strategies.◗◗ Explain their thinking, share their reasoning, and analyze relationships between concepts.◗◗ Become college and career ready.FOCUSED MATHEMATICS INTERVENTIONLevel English Spanish Price Each Level English Spanish Price EachComplete Kits Student Guided Practice Books Intervention Complete kit includes a single copy; additional copies can be ordered.Level K SSC21146 SSC21433 $499.99 Level K SSC21201 SSC21436Level 1 SSC21147 SSC21437 $499.99Level 2 SSC21148 SSC21441 $499.99 Level 1 SSC21202 SSC21440 1–9Level 3 SSC21149 SSC21445 $499.99 Level 2 SSC21203 SSC21444 copiesLevel 4 SSC21150 SSC23235 $499.99 Level 3 SSC21204 SSC21448 $14.99Level 5 SSC21151 SSC23243 $499.99 Level 4 SSC21205 SSC23238Level 6 SSC21152 $499.99 Level 5 SSC21206 SSC23246 10+Level 7 SSC21153 $499.99 Level 6 SSC21207 copiesLevel 8 SSC21154 $499.99 Level 7 SSC21208 $9.99 Level 8 SSC21209For correlations, research, samples, and online ordering: www.tcmpub.com 11

Literacy Support TIME FOR KIDS® Nonfiction Readers Reading Levels BR–5.9 • Lexile BR–930L • GR A–V • Interest Levels K–8 Supplement your reading program or classroom library while meeting your students’ needs for high-interest informational text with readers that feature a variety of text structures, academic- and domain-specific vocabulary, and complex text aligned to the content areas. Each kit includes: Lesson 13: Craft It: Hand-Blown Glass ◗◗ Books—15 titles, 6 copies each, Spanish Focus Objectives G l a s sHaCnrda-fBtlotw: n Craft It: Hand–Blown Glass G l a s sHaCnrda-fBtlotw: n 12–64 pages per book in print Available! and digital formats Stu••douaefnsnskdtismeawnrpsditllealrnbeedsexpptaohobnesleditmottoaory:inqinuidfeoesratmioaanntsdi.osnu.pporting detailssgytgblieaalElleaasvgpersselssrbnar!ablspcohlEsotrwebxiawcaplicoenriltnodwgoicgrfeteiaonarfn.otdghgdrGateaohyha.hvoeeeiwesarrtr?ro4isttT,rho0iyhsa0faov0tfe’s Madison Spielman ◗◗ Teacher’s Guide with lesson plans TESOL Objective Spielman for each book cSotundsternutcst wanildl uaspepalyppacroapdreimateiclkenaronwinlegdsgtera. tegies toLDGeERRWxuaLeAirieloadlevyLdre®edeIid6nlnvC25tgReeo.0le4LruL2aven4devtine:ntl4giCo5Lo3nerLrveeelvlaeKtilo2n0s: TCM 14619 ◗◗ Assessment Guide including placement Word Work tests, formative and summative • –WrHoeowaigdrndh, ma-SFnatrdueddq–eoyum:eWnecoyrdWcohrudnsk: assessments in print and digital formats Glassblowing Today • very, because, Writing patterns tUoswe rhitigehw-forerdqsu, epnhcraysaensd, ovrosceanbtuenlacreysw. ords ◗◗ School-Home Connections amsahk,Tephogetlaamsshsa,ianarenthdsianvngedrs,ynlhiemiegdeh,esdhoetdaoatA.•c••••akggfibdaulanltreofhnfwmeearrpcsieipceVocabulary B•u•C•(“irrp•RAwleRo•adelgpGeilssgvtaVliepAahoseiendsaiedb-obsua1tigccuioneegua4niufaudgrld2aFigacltars)irtlopArtHrerhuatheiharssaecleretduystgCnaehsuPonip:toBdlp:nahiaoSlpoScm-vorgaeaseBteotneyousdmusmlserrsokdbed.dtthiw:C;:enioceimcprcpntotnnaehahootetnltpotGssesolasieornoultkaaaavrhrnunneylstsaridsessroeocrfe”teidteowftoooaprdliErurddsooteyatsheieaannraracmtndg;nhsutdidn.ltthtguahesrees. ◗◗ Digital resources Co•••m•MAUpGsanklkrdaiienneshsgrgsWeaGtannolnadrsksdisReionreasgncsaptMicovtainitvidynitisnyIhdgseehteaoetae(Qnpt uda(pegDasetgei1toea4n1i4ls4s) 3) ◗◗ Interactiv-eBooks with three activities © Teacher Created Materials per book (one for word work, one for comprehension, and one for writing). #14622—Early Fluent—Teacher’s Guide 137 Kindergarten includes an assessment activity ◗◗ Audio recordings of books and poems Oral RbgLeleeaacsdsosHsimno?ognewRR1seedo3acmood:rtCedohtrnheasitfneotgiIfnitmn:gdarHedoadeunietod.nf-tBs lown GlassHaCnrda-fBtlotw:n to model fluent reading G l a s s G l a sName: ___________________ sgtygilbelaalElaeaspgvressesrlbsnaa!rblscophElstowrxebiawcpalicenoriltndowgiocgrtfeeaionfranto.dghdgraGetayohha.hvoeeeiwsearrtr?rio4sttr,Th0oiysha0foav0tfe’s 12 sAssessor: ___________________________________________D_a_t_e_:____________________LDGeERRxWuaLeiAriledoealyvLd®ereedIdi6nnlvC52teRge0o.le4rLL2uave4ndevtinen:tl4giCo5Lon3erLvreeelvlaeKtlio2n0s: 13 HaCnrda-fBt lotw: n Craft It: Hand–Blown Glass Interactiv-eBooks A furnace is an oven Word Count TCM 14619 Spielman used to melt glass. Integrate technology into your reading The heat used to Madison Spielman lessons. Each kit includes Interactiv- make glass is very eBooks that allow students to: high. The oven has 222 E = errors SC = self-corrections Codes a special screen for Page Text M = meaning ◗◗ Listen to the entire book protection. ◗◗ Hear individual words spoken S = structure V = visual ◗◗ Record themselves reading the book The ingredients are mixed hmigehlWt etohngeoenutghthhee,r ttthoeemmipnaegkrreaetlduiqireueniitdss 4 sRfkRooTifolrGhmolfmeuulbaalrelnslfoy.isstrw.bhTslwtihoonuiepwgssroieaingpsngluadabblsaiesslyreceawauatuosravsseseemaroiyntgafhvokoegeelnlidafntgisrealssMadtrstwes.minsaIoeetsapRtbaisoonilemltygapaemainap.ncnieaTidea.hnbetout E SC Cues Used ◗◗ Respond to text orally together and heated. glass. 5 E SC itsheusTpeoadsdtta,oyv,mearaygkahesottfhuwerohnoiagdchefih(rFeeUsatRw. -eInnries) ◗◗ Practice writing words, sentences, built in brick ovens. Gaffers must be very careful MSV MSV or captions 14 not to burn themselves! 15 ◗◗ Draw evidence from text MSV MSV ◗◗ Complete additional comprehension activities 14 - 15 6 giGnalfaftehsrsesblNforoewwmingWEuowrroaldps.eoC. naeptoafinthJeohfnirsStmbiuthsinbersosuegs ht MSV MSV 7 nGeaafrfetrhsearseangdlaysssbhloorweseros.f They built their factory MSV MSV 8 Jamestown. MSV MSV pMaostrethpaenoppleeokpnleewknhoowwhtoowbtloowdoglasoss SUBTOTALS in the today.Literacy Support © Teacher Created Materials GO ON #14623—Early Fluent—Assessment Guide 51 Developed in collaboration with noted reading consultant Timothy Rasinski, Ph.D., Kent State University Our books are leveled using our own leveling system, developed with consultant Timothy Rasinski, Ph.D. We also partnered with The Lexile® Framework for Reading to establish official Lexile measures for each book. Additionally, each book has been correlated to other widely used leveling systems such as Guided Reading (GR) by Fountas and Pinnell. Many of our books have also been leveled by Accelerated Reader. Complete reading level correlations available online at www.tcmpub.com/reading-levels. 12 To order, call 800-858-7339

Emergent and Foundations and Reading Levels BR • Lexile® NP and BR • GR A To easily pair nonfiction with Upper Emergent Foundations Plus fiction, see pages 14–15. Levels include: ◗◗ Building oral language ◗◗ Engaging images and precise text/image correlation ◗◗ Easy-to-read font and consistent word spacing ◗◗ 5.25\" x 7.75\" size • 12 pages per book Reading Levels 1.0–1.9 • Lexile® BR–460L • GR A–I Levels include: ◗◗ Picture-text matching ◗◗ Use of key high-frequency words and some content-area vocabulary ◗◗ Text features such as picture glossaries, table of contents, and bulleted/numbered lists ◗◗ 5.25\" x 7.75\" size • 12–20 pages per bookEarly Fluent and Reading Levels 2.0–2.9 • Lexile® 390L–780L • GR I–M Early Fluent Plus Levels include: ◗◗ More challenging content‑area vocabulary and high-frequency words ◗◗ More complex sentence structures and abstract concepts ◗◗ Text features such as sidebars, maps, time lines, and diagrams ◗◗ More text-heavy pages ◗◗ 5.25\" x 7.75\" size • 24–28 pages per book Reading Levels 3.0–3.9 • Lexile® 580L–930L • GR M–Q Levels include:Fluent and ◗◗ Text requiring some reader inference Food ayroouunardetuhseewdotorldeamtianyg.bWe ahliicthtleofdtihffeesreent Latin America Fluent Plus ◗◗ Chapter format from what ◗◗ Increasingly specialized vocabulary would you like to eat? Tvehgisewtaobmleasnaitsasmellainrkget ➤ in Peru. blood sausage fresh fish for sale in Mexico poucltpoopudseleggaslle) gfraom(friSepdain from Ireland etoMphdfoegettrehxtee.Oie.crSonlyPah,eeCrloirgonipuetfep’yssBn.telsrorGa,saurauzgbtnidaeuld’tsoysetolmlifmavrreuramagsliratteakso’s,rsectkvtklmeeactg(roasgLerveitAkneasertbHtsthlmseYaeisasV,cwraiok-tonsynetrdtobltdshksleoee)ilasc.lwksffoo!afooutOedonrddn’s,ein ➤ ➤ Danish pancakes 13 12 - 13 ◗◗ Higher-level text features such as table of contents, marmite (yeast spread) ➤ glossary, and index from the United Kingdom ➤ ➤ salted licorice ➤ from Sweden ◗◗ Complex language and sentence structures 12 ◗◗ 7\" x 9\" size • 28–32 pages per bookAdvanced and Reading Levels 4.0–4.9 • Lexile® 640L–800L • GR Q–S Advanced Plus Levels include: ◗◗ Challenging vocabulary ◗◗ Introduction of “Dig Deeper” graphic features to support visual literacy ◗◗ Text features such as a bibliography, a “More to Explore” section, a glossary, an index, and a table of contents ◗◗ Activities to prompt critical thinking ◗◗ 48 pages • 5.25\" x 8\" sizeChallenging and Reading Levels 5.0–5.9 • Lexile® 690L–900L • GR T–V AtTtihelaScoutrhgeeof Hun The Scourge Challenging Plus Attila the Hun was so bad that he Levels include: God was known as the Scourge of God. ◗◗ Detailed and descriptive text A scourge is a whip made of many ◗◗ Text features such as a bibliography, a “More to Explore” When people think of bad guys from long straps, meant to cruelly punish an ago, they get a mental picture. They see individual—or even oneself! section, a glossary, an index, and a table of contents aplordooikbrtayibn,lmyhiuhssaecsyleaedss.hmaTaghngeyyinmsaeoepuAosittnatitclehadetfhauenrdHhaautnw. , iHoldnee ◗◗ Increased use of diverse illustrations, graphics, and text features of the most feared leaders of ancient times. Asottbilaar’sbacrriucetlhwaatyms awneyreof ◗◗ Text structures to prompt critical thinking those he tried to conquer ◗◗ 64 pages • 5.25\" x 8\" size 48 joined his forces just to Literacy Support protect themselves. 49 48 - 49NONFICTION READERS, 2ND EDITION Spanish Price Each English Spanish Price Each EnglishComplete Kits $649.99 $649.99Foundations (Gr. K) NEW SSC24051 $649.99 Fluent (Gr. 3) SSC15352 SSC15569 $769.99 $649.99 Fluent Plus (Gr. 3) SSC15371 SSC15572 $769.99Foundations Plus (Gr. K) NEW SSC24483 $699.99 Advanced (Gr. 4) SSC15674 SSC18050 $879.99 $699.99 Advanced Plus (Gr. 4) SSC15675 SSC18089 $879.99Emergent (Gr. 1) SSC15276 SSC15557 Challenging (Gr. 5) SSC15676 SSC18128 $935.99 Challenging Plus (Gr. 5) SSC15677 SSC18167 $935.99Upper Emergent (Gr. 1) SSC15295 SSC15560Early Fluent (Gr. 2) SSC15314 SSC15563Early Fluent Plus (Gr. 2) SSC15333 SSC15566Visit us at www.tcmpub.com for Titles also available on Explor-eBook.additional ordering information. See pages 22-23.For correlations, research, samples, and online ordering: www.tcmpub.com 13

Literacy Support Reading Levels 1.0–3.9 • Lexile BR–750L Spanish GR A–Q • Interest Level K–5 Available! Build literacy skills by engaging students with It’s perfect weather for a picnic on Saturn! 3 high-interest, appropriately leveled original and Robo-Pilot knows all the shortcuts. If we miss space adapted fiction. Books feature increasingly jams and falling stars, we’ll be there in a wink and complex vocabulary, sentence structures, plots, a blink! characters, literary devices, and illustrations to 2 grow reading skills gradually and appropriately. 2-3 Each kit includes: Interactiv-eBook available ◗◗ Books—15 titles, 6 copies each, 12–32 pages for every title! per book in print and digital formats ajRabmolibIsnto’aks-n!pPdeilroffaetlclkitnnwgowesatsatharsel,lrwtfhoee’rllsahbopericttchnueictrse.oinnIfSawaewtumirnnik!ssasnpdace ◗◗ Teacher’s Guide with lesson plans 2 for each book 3 ◗◗ Assessment Guide provides placement tests and formative and summative assessments “First question—what is all that blue you see on in print and digital formats Earth?” asks Mama. Amarissa quickly says, “Blue paint!” ◗◗ Digital resources including student reproducibles, supporting Reader’s Theater “No, absolutely wrong!” scripts, and school and home connection resources “Blue cheese?” “No, Amarissa,” says Mama. ◗◗ Interactiv-eBooks with two activities per “Can you give us a clue?” asks Zachariah. 7 book (one comprehension and one writing) “Okay. It starts with W.” ◗◗ Audio recordings of books and supporting Reader’s Theater scripts to build fluency 6 Lesson 4 Interactiv-eBooks Planet Puzzle Integrate technology into your reading Lesson OvePrlavnieewt PPlaunzeztle Assessment GuideFocus ObjectivesPlanet Puzzle lessons. Each kit includes Interactiv-eBooks that allow students to: Puzzle LeStud•• ecunostnesfwmirmiellabpnerienadgbiccletluioteons:sIt’s a perfect day for a picnic on Saturn. ◗◗ Listen to the entire book ◗◗ Hear individual words spoken Planet Pu sson 4Let’s go! ◗◗ Record themselves reading the book 21CBADCBA zzle Multiple-C54hoBADCBAice TestStaW••n•CoCovCda•LCi•fosr•non•oaaucS•iHdlfcWdn•bnhi•WcoSm•arqAeWiRatcagg:rmoduWCbUecoHfhermtA(auohpirahpoalnsrsysadeciydraco-and/dsniamtkrk,r,nFbtegt:ekgwfSreSeineeirPganaieU,)eoaerrmtkeoepTchtlsmuTs:ntMtaqhwahh7,rueEhiied,yiemetciu7eLnlernWcnReiheEeGm,y:nDdevnoaLdr)euVaahecerRrgecgleddierdlxyAd:ci,2iielCnlennIshaL.eleocnr,6ludogaeg®osaotiuvPeaRL4roityacinesrpcee5ddvcneltnatva0is:er2ohemydrnL6anoh8hltiidec2,tgntCdin2oBgioibn/neetaWndlvrinLirgicaeeLenoCnrnnvfesuliaiegvlefnrttcoletgioglobteLdllayhun2wtga0srctrya:bi-p?ehedscoulrehruoshsohneyaesnaep(eu)ecnc::rabgsneasgeatetcreoiasserrnttecveeakfoaloisip(enaitsvpSwtnntyaadhic(asttgtiearih/isydgennenrbh,iew,nengneeclrleueatpriocc7adensnaueoem6tikdatcagsi)hniorpsalhfo,etafmnr,Mseg,erdryoumhielfekfenTuovCyntMairn1el6s5oai6iw2coucanaCdtBdereu•o•m•i•sSAil•cRswdcsRrnsPiye-(tieieeopnctl:anatnhatSaoudtendcgtgincinsuereneehytgdfF:rrgamo7PSe’isrlr5uttcnasuuThv)zctudzohesetlleeieendcBarnaierconvrtetssyoeogaigCsri;kdc:tnc:eeuodreraseden’c;sayvlhruntteeWtoIihlnlnlauhreiosteatrtdgeercaenpartiebatanmtidhyneiBdbgasiylroogliKpCbnwisoomnmnaicgbdntiecorsatr;nal.ieehtpryrs.eSgtchoaittindpaifDnNlogirarmteWhcWeeht:heiaor_oneoono_iMnZsnSsdnD_swaaoott:aE_acshhmedaRekh_seesrirpae_tamnthraay_hiacaood_eerhoru_sseanht_tahoio_pcrar_yhv(i_cnteoqa_ntkcut_h.e)h_eispo_sslts_atieoo_cnre_ny?._.?_C_h_o_o_s_e__WthET_hahe_are_ttbhc_TwTeoh.eha_hvisnvieele_lltleeodrf_mfrytaarpayemnlmotoinhtessitiillDtlwmknyyelngawiwekotireiwlel.lll:yggF__ooh_il__ablto__pain__cpbka_eetbhnhd_oo._enmu_ebtxe_u.t_?b_bleCondon ◗◗ Respond to text orallyLiteracy Support ◗◗ Practice writing words, sentences, D CWriting on Saturn The family will ride on the 3 DSsttourdyewntisthwEraitrethto. Lunar Leap. or captions planet in the ◗◗ Draw evidence from text compare the The family will eat dinner. ◗◗ Complete additional comprehension What can you infer about activities Matefraimalsily? 70 Teacher's Guide DCBA 6CBA#16574—Early Fluent Plus—Teacher’s Guide Teacher Created this cWhhilidcrheonflethaernseaibsonuottEsaormthe?thing the 14 Earth has gravity. © They are very poor. They live in a big city. Earth is mostly made of water. They do not like to play games. There are billions of people They do not live on Earth. on Earth. D Earth has seven continents. 26 #16576—Early Fluent Plus—Assessment Guide © Teacher Created Materials To order, call 800-858-7339

Emergent and Upper Emergent Reading Levels 1.0–1.9 To easily pair fiction with Lexile® BR–530L nonfiction, see pages 12–13. GR A–I fMorarecyJPoeuensmne. ag1k5ue: isHneallnBo,laoWliegonrldw!ith kiwi fruit He makes a nose of berries that are each Levels include: a different size. ◗◗ Picture-text matching cfoaWionnltadehallrlcwyelooeamhn-teyegearesstdawooirn-fimmofgAlydsnonbeoutlamrothtrghpc.tteiotrTcooamhrs.ieypseeihsnthogmemueiwe,nPo.inarIlldathh.kaeiNv,fearoenbwedez,eiIInn’’mmg ◗◗ Use of key high-frequency 26 words and some content‑area vocabulary 73 ◗◗ 5.25\" x 7.75\" sizeEarly Fluent and Early Fluent Plus ◗◗ 12–20 pages per book Penguin Blog Reading Levels 2.0–2.9 June 15: Hello, World! Lexile® 320L–670L Welcome to my blog. This is me, Palaki, and I’m GR I–M a three-year-old emperor penguin. I have been on a long swim north to see the world. Now, I’m Levels include: finally heading south to my home in the freezing ◗◗ More challenging cold waters off Antarctica. content‑area vocabulary 2 and high‑frequency words ◗◗ More complex sentence 3 structures and abstractFluent and Fluent Plus concepts Then, Henry went to France. ◗◗ More text-heavy pages npsaaicimd“tuMear.eopInaitnianismatemipr, yaywroknhuaoirmnnwePa,amaasrseipsw.aisie“nlHAlt.i”enfnginraei,” ◗◗ 5.25\" x 7.75\" size ◗◗ 24–28 pages per book “On-ree?” Henry asked. Reading Levels 3.0–3.9 “Oui,” said the painter. “You Lexile® 380L–750L mustn’t forget Henri.” GR M–Q E“In“-armIeweH-iklelannyroayt,nHfdoerOgnendt--,”rreiskea.,i”dHHineen-rryik. , Levels include: ◗◗ Text requiring reader eveArytolenaestutnhtaitl’shwe whaetnhtetotoAldmerica. Literacy Support inference 20 ◗◗ Chapter-book format ◗◗ Increasingly specialized 21 vocabulary ◗◗ Complex language and sentence structures ◗◗ 7.75\" x 5.25\" size ◗◗ 28–32 pages per book FICTION READERS English Spanish Price Each English Price Each Complete Kits SSC20946 $649.99 SSC20986 $649.99 Emergent (Gr. 1) SSC15795 SSC21025 $699.99 Early Fluent Plus (Gr. 2) SSC15798 $699.99 Fluent (Gr. 3) SSC15799 $769.99 Upper Emergent (Gr. 1) SSC15796 Fluent Plus (Gr. 3) SSC15800 $769.99 Early Fluent (Gr. 2) SSC15797 Visit us at www.tcmpub.com for Titles also available on Explor-eBook. additional ordering information. See pages 22-23. For correlations, research, samples, and online ordering: www.tcmpub.com 15

Literacy Support NTitEleWs! Teaching through Text Sets Reading Level Grades 3–8 Meet standards with easy-to-use lessons designed around reading, writing, content, and language objectives. Kits include authentic fiction and nonfiction texts in multiple genres and modalities. Introductory Text: Anchor Text: Activates prior knowledge Builds content knowledge Each kit includes: Extension Text: Extends understanding ◗◗ Read Aloud Introductory Text through performance ◗◗ Anchor Text (24 copies) ◗◗ 3 Supporting Texts (6 copies each) ◗◗ Extension Text (6 copies each) ◗◗ Teacher’s Guide with easy-to-use lessons that focus on reading, writing, and content activities ◗◗ Digital resources including an Interactiv‑eBook to engage students ◗◗ Assessments including a culminating project-based assessment TEACHING THROUGH TEXT SETS Complete Kits • $399.99 each Title Item Title Item Science Social Studies SSC23501 SSC23502 Grade 1 Reading Level Grade 1 Reading Level SSC23503 Animals NEW SSC23507 My Community NEW SSC23504 SSC23505 Light and Sound NEW SSC23508 American Symbols NEW SSC23506 Space NEW SSC23509 Being a Good Citizen NEW SSC20192 SSC20193 Grade 2 Reading Level Grade 2 Reading Level SSC20194 Plants NEW SSC23510 Coming to America NEW SSC20189 SSC20190 Basics of Matter NEW SSC23511 My Family NEW SSC20191 The Changing Shape of Land NEW SSC23512 Amazing Americans NEW SSC21342 SSC21343 Grade 3 Reading Level Grade 3 Reading Level SSC21344 Adaptation NEW SSC23279 American Indians in the 1800s SSC21336 SSC21337 Forces and Motion NEW SSC23280 Westward Expansion SSC21338Literacy Support Climate and Weather NEW SSC23281 Citizenship and Government SSC21339 SSC21340 Grade 4 Reading Level Grade 5 Reading Level SSC21341 How Plants and Animals Survive NEW SSC23282 Colonial America Movement of Energy NEW SSC23283 The American Revolution Weathering and Erosion NEW SSC23284 Constitution and Government Grade 5 Reading Level Grades 6–8 Reading Level Energy of Ecosystems NEW SSC23285 The Civil War Supporting Texts: Guides students Changing Matter NEW SSC23286 Immigration through close readings Sustainability NEW SSC23287 The Industrial Revolution To order, call 800-858-7339 Grades 6–8 Reading Level Ancient Rome Ancient Egypt Ancient Greece Grades 6–8 Reading Level Medieval Times The Renaissance Exploration 16

School and Home ConnectionKids Learn! Includes standardized testGrades Pre·K–8 preparation inPrevent away-from-school learning loss! Grades 3–8Kids Learn! is a parent-involvement resource designed to bridge theaway‑from‑school gap in instruction* with standards-based activities in reading,writing, and mathematics.◗◗ The full-color activities both reinforce information learned during the recently completed school year and prepare students for the upcoming grade level.◗◗ Suggestions offer quick and fun family activities that will provide a rich knowledge base for students to draw upon in the coming school year.◗◗ The bilingual version has parent/caregiver instructions provided in both English and Spanish. Language Arts Activity Writing Activity Mathematics Activity Week Solar System Week Ready to Research Grouping for Multiplication Week 3 3 3 Directions: Read the text. Then, answer the questions. Directions: Choose a topic that you would like to learn more about, Directions: Circle the objects in each box to show equal groups. such as an animal, a planet, or a different country. Have your parent help Then, complete the multiplication equation. you research the topic using the Internet, encyclopedias, or nonfiction books. Then, write a paragraph that includes new facts you learned. A solar system has many parts. The sun is at the center. Around the Example: 4 groups of 4 sun are planets or other bodies. They all revolve around the sun. Think 4 × 4 = 16 about our solar system. What do you know about it? It has a sun. It has eight planets. But that is not all. There are moons. There are comets and __________________________________________________________________ 1. 6 groups of 2 3. 5 groups of 4 asteroids, too. __________________________________________________________________ __________________________________________________________________ Here are some facts about our solar system: __________________________________________________________________ __________________________________________________________________ • Neptune is a planet. It is the farthest from the sun. __________________________________________________________________ • Jupiter is the biggest planet. __________________________________________________________________ • Mercury is a planet. It is the closest to __________________________________________________________________ __________________________________________________________________ the sun. __________________________________________________________________ • Saturn is known for its rings. __________________________________________________________________ • Mars is known as the “red planet.” __________________________________________________________________ __________________________________________________________________ 1. Which are not a part of our solar system? __________________________________________________________________ □6 × 2 = □5 × 4 = A moons 2. 3 groups of 6 4. 2 groups of 7 B comets C rockets D planets 2. Which is the largest planet in our solar system? □3 × 6 = □2 × 7 = School and Home Connections __________________________________________________________________ © Teacher Created Materials #17790—Kids Learn! Getting Ready for 3rd Grade36 #17790—Kids Learn! Getting Ready for 3rd Grade © Teacher Created Materials 46 #17790—Kids Learn! Getting Ready for 3rd Grade © Teacher Created Materials 39 Activities and test preparation to engage students and reinforce key skills in reading and math! KIDS LEARN! Level item item price each level item item price each English Bilingual English Bilingual Grade K SSC17787 SSC13532 $9.99 Grade 5 SSC17792 SSC13537 $9.99 Grade 1 SSC17788 SSC13533 $9.99 Grade 6 SSC17793 SSC13538 $9.99 Grade 2 SSC17789 SSC13534 $9.99 Grade 7 SSC17794 SSC13539 $9.99 Grade 3 SSC17790 SSC13535 $9.99 Grade 8 SSC17795 SSC13540 $9.99 Grade 4 SSC17791 SSC13536 $9.99 Kids Learn! is designed for each student to receive a personal copy of the appropriate level. *For a summary of pertinent research on learning loss experienced 17 during breaks from school, visit www.tcmpub.com/research For correlations, research, samples, and online ordering: www.tcmpub.com

School and Home Connections Spanish Item Take-Home Backpacks Available! TakeB-Hacokmpeack SSC21502 Grades Pre·K–8 Grades Pre-K–K SSC21512 SSC23622 Each Take-Home Backpack includes one or more TCM 21502 (i10491) of the following: Title ◗◗ Kids Learn! book featuring reading, writing, and mathematics activities (Grades Pre·K–8) Grades Pre·K–K English Grades Pre·K–K Spanish ◗◗ High-interest fiction and nonfiction books Second Language Support* ◗◗ Parent Guide for Your Child's Success to help prepare parents and students for the upcoming school year (Grades Pre·K–8) ◗◗ Second Language Support backpacks include instructions in both English and Spanish for parents and caregiversSchool and Home Connections Spanish Item Spanish Item Available! Available! SSC21503 SSC21504 TakeB-Hacokmpeack SSC21513 TakeB-Hacokmpeack SSC21514 Grades K–1 SSC23623 Grades 1–2 SSC23624 TCM 21503 (i10492) TCM 21504 (i10493) Title Title Grades K–1 English Grades 1–2 English Grades K–1 Spanish Grades 1–2 Spanish Second Language Support* Second Language Support* Spanish Item Spanish Item Available! Available! SSC21505 SSC21506 TakeB-Hacokmpeack SSC21515 TakeB-Hacokmpeack SSC21516 Grades 2–3 SSC23625 Grades 3–4 SSC23626 TCM 21505 (i10494) TCM 21506 (i10495) Title Title Grades 2–3 English Grades 3–4 English Grades 2–3 Spanish Grades 3–4 Spanish Second Language Support* Second Language Support* 18 To order, call 800-858-7339

Title Spanish Title Spanish Available! Available!Grades 4–5 English Grades 5–6 EnglishGrades 4–5 Spanish Item Grades 5–6 Spanish ItemSecond Language Support* Second Language Support* SSC23617 SSC23618 SSC21517 SSC21518 SSC23627 SSC23628 TakeB-Hacokmpeack Item Title Item Grades 6–7 SSC21509 Grades 7–8 English SSC23620TCM 21509 (i10498) SSC23629 Second Language Support* SSC23630 Title Grades 6–7 English Second Language Support* TAKE-HOME BACKPACKS School and Home Connections $45.00 each See item numbers on this page. For a complete list of book titles for each grade level, visit us online at www.tcmpub.com/backpacksTitle Item *Second Language Support Backpacks Our Second Language Support BackpacksGrades 8–9 English SSC23621 contain books in English for students withSecond Language Support* SSC23631 parental support materials in Spanish. Visit us online for a complete list of components at: www.tcmpub.com/backpacks.For correlations, research, samples, and online ordering: www.tcmpub.com 19

English Language Development Building Language Proficiency Grades K–8 Empower language learners to build English-language proficiency with this highly differentiated and rich instructional resource. Each kit provides rigorous instruction in the four language domains. Listening Speaking Reading Writing Each kit includes: Msatnreoyanwngihnelgarnfeugtluocamogneavkseekristlaalsltki.o-ntUimsweeitthahefysuoenutrtiipcmsheial!ndydtiemveeloanpds Level A KIT FEATURES Beginner ◗◗ 30-piece themed and leveled WAw•s•F•oq•hkeuueafylhewodclosautofoutddrniuneroodlaeWcdnaihsfastlmo.ioiuhlvldopeieaulslewsioatolrkrhnpnpdyasyuodohwtpwoeuhYhpl.reele.yoa.ror?o?rewusr??nsDhfueon ? Join In Words on the Go! ◗◗ High-interest texts Text Set featuring a variety Activities outside Play these fun games with your ◗◗ Strong visual support and of genres, subjects, and of school such as child anytime. high-interest topics in print sports or clubs are • Rhyme Time: I am thinking of text-to-picture match and digital formats natural opportunities ◗◗ Simple vocabulary and for your child to a word that rhymes with star… ◗◗ Student Guided Practice practice language • Find the Word!: Find the word language structures for Book (Each kit includes a skills. student practice single copy; additional that is spelled m-i-l-k... copies can be ordered) ◗◗ Wider variety of text THscmtkaaohievlnalkessvtseeyybarooysgauuaehLrrtaifaccoMovshhnirniic.leladgdonsYncapoovsartupeahnarrcecsedtgraatiececnfealieniovlmdepneaierhpl.vysohemnsoiaengeenmifbiceartivas con su hijo desarrollan Language Proficiency Levelsorganization and more ◗◗ Teacher’s Guide aptitudes sólidas de lenguaje. ¡Usen estos consejos en Level B complex language structures ◗◗ Audio recordings of texts cualquier momento y lugar para que se diviertan a©laTehacohrear Created Materials Intermediate ◗◗ Content-related vocabulary #16385—Language Power Purple Level C—Cadrde Sheat blar! to encourage discussion ◗◗ Parent Tip Cards in English and Spanish ¿P•rQegueúénncteholenatarrasríauauh?nijocqacuhéohraroría si… Forme parte cP•¡•orPonl¡p-rpHHmieaasmeao-luuancllarelbs-haaavcharijaadol-nobaendeeqe.rpos.uehn.taeasoealctanscsrsuebeejaulurrllndeaaqera…eg!nui:mloipeeEstaaarnrlesdmacca:ibuvoEceremasnrittteóqoirdnauynotelosa!. ◗◗ Use of expanded vocabulary N•p••roegdtgppuuuaeuvndnrditdeeaaireirdseaaronaduu.ihvnvniaevsmcriúrteiipdelrleónasrnsucp.sduoaepdlrqdeouórp.ileiaarrselusg. ar. and descriptive words ◗◗ Digital resources including Las actividades fuera all text set items, audio of del ámbito escolar, ◗◗ Text complexity to build texts, Student Guided como hacer deportes high-level vocabulary and Practice Book pages, and o ir a un club, son language skills assessment resources oportunidades naturales para que ◗◗ Supports advanced listening Parent Tip Cards empower families su hijo practique sus and speaking skills to support language development. aptitudes lingüísticas. ◗◗ Strong models for developing (Written in English and Spanish) MMfppidcruaeeátneicclndtatieaiescfnaacdgamoaesjnijulauiesasrnuuahytnahcsbieoumjoinllihedvpeinaejaosfdrrasaópeajesuqcneuptióedieacnleerpaofteóoeonnlnettigrrfceoóaagnmseai.cnriealoUm.sbterod grade‑appropriate writing skills #16385—Language Power Purple Level C—Card Set © Teacher Created Materials Lessons target listening, speaking, reading, andEnglish Language Development writing skills.Level C Advanced Eagles Up Close Objectives Language Objective: Use content-related vocabulary in discussions and reading. Content Objective: Know that living organisms have distinct structures and body systems that serve specific functions in growth, survival, and reproduction. Vocabulary Word Bank Extension Words • aeries • eagle • eaglet • reproduce • hatch • hollow • prey • survive • soar • talon Student Guided Practice Book Before Reading develops listening, speaking, reading, and writing skills. Building Background Knowledge and Vocabulary: 1. Share with students that they are going to learn and use new vocabulary to talk about eagles. Introduce vocabulary words to the students. Show examples from the text to clarify and support the vocabulary words. 2. Talk Time: Ask students to predict how each word is related to eagles. I think that the word _______ is related to eagles because _______. 3. Talk Time: Show students the cover of the book. Discuss what students see. Describe what you see on the cover. I see _______. What do you notice about the eagle’s body? I notice that eagle bodies have _______. What do you think those parts help the eagle do? I think the _______ helps the eagle _______. 4. Talk Time: Talk about the parts of an eagle that may be included in this book. What other parts of an eagle do you know about? Other parts of an eagle that I know are _______. Other parts include _______. 34 #16395—Language Power Red Level B —Teacher’s Guide © Teacher Created Materials 20 To order, call 800-858-7339

Language Power Student Gains and Sustained Proficiency LevelsLanguage Domains Listening Research pilot study 89.5% of Language Power available online at Speaking www.tcmpub.com/research 87.4% 10 20 30 40 50 60 70 80 90 100 Reading 65.3% Percent of Students Writing 50.8% 0GRADES K–2 GRADES 3–5 GRADES 6–8 LANGUAGE POWER: BUILDING LANGUAGE PROFICIENCY English Language Development Complete Kits Student Guided Practice Books Level Item Level Item Grades K–2 Level A SSC16370 Grades K–2 Level B SSC16376 Grades K–2 Level A SSC16374 Grades K–2 Level C SSC16382 Grades K–2 Level B SSC16380 Grades 3–5 Level A SSC16388 Grades K–2 Level C SSC16386 Grades 3–5 Level B SSC16394 Grades 3–5 Level C SSC16400 Grades 3–5 Level A SSC16392 Grades 6–8 Level A SSC16406 Grades 3–5 Level B SSC16398 Grades 6–8 Level B SSC16412 Grades 3–5 Level C SSC16404 Grades 6–8 Level C SSC16418 Grades 6–8 Level A SSC16410 All Kits $499.99 each Grades 6–8 Level B SSC16416 Grades 6–8 Level C SSC16422 Each kit includes a single copy; additional copies can be ordered. 1–9 copies $14.99 ea 10+ copies $9.99 ea Visit us online for complete information on the contents of each Language Power Text Set and to order Text Set Add–on Packs.For correlations, research, samples, and online ordering: www.tcmpub.com 21

Bring authentic content to students with a comprehensive library of over 500 books, each including a lesson and assessment that are specially designed to meet today’s classroom needs! Inspire Stimulate Use authentic, engaging Use an array of digital tools books and lessons to inspire designed to improve reading students to read widely and comprehension and fluency. explore deeply. Collaborate Assess Engage Fuel student interaction and Monitor students’ progress Bring content to life using teacher communication via and use data to drive diverse media such as audio, instruction. video, and interactive text safe, user-friendly collaboration tools. features.Interactive Learning Ready to Purchase? We Integrate For multiple teachers or a schoolwide subscription, Explor-eBook can integrate with your please call for pricing: existing system: (800) 858-7339 For a single teacher subscription, please sign up at: LTI™ Certified www.tcmpub.com/myexplor-ebook Schoology $249 per classroom (up to 35 users) Moodle™ More coming soon! 22 COPPA and FERPA compliant. To order, call 800-858-7339

Access anywhere 5B0oo0k+s! from a computer or tablet. Genres Nonfiction (68%) Fiction (32%) Interest Levels Pre•K - 1 (26%) Grades 2 – 3 (41%) Grades 4 – 5 (20%) Grades 6 – 8 (13%)Small Content Math/Science (35%)Groups Social Studies (32%) Whole Library Language Arts (14%) Class Intervention Learning Phonics (19%) Programs Centers Lexile Levels BR (15%) Up to 530L (26%) Reinforce the four domains of language. 420L – 820L (46%) 740L – 950L (13%)Listening Speaking Reading Writing Guided Reading K: A–D (11%) Levels 1st: A–I (19%) 2nd: E–N (18%) 3rd: J–Q (18%) Interactive Learning 4th: M–T (19%) 5th: Q–V (12%) 6th: T–V (4%)Where Does It Work? Customer SupportBrowsers Latest versions of Chrome, Safari, Our customer service team is here to offer assistance Firefox, and Internet Explorer where needed.PCMac Windows 7 and higher Phone: (800) 858-7339 Monday – Friday 6 a.m. – 5 p.m. Pacific TimeiPad® App OS 10.9 and higher Email: [email protected]™ App Gen 2 or newer running iOS 7 and higher Website: www.tcmpub.com/myexplor-ebook Running Android 4.4 and higherFor correlations, research, samples, and online ordering: www.tcmpub.com 23

Make checks payable and mail to:Dept.Code S15SSC5301 Oceanus DriveHuntington Beach, CA 92649Customer Code S15SSCPlease include the customer codeabove on your Purchase Order.Name_____________________________________________________________________________ ORDER AND SHIPPING NOTESTitle______________________________________________________________________________School Name______________________________________________________________________ SHIPPING CHARGESSchool Address____________________________________________________________________City___________________________________________ State_____________ Zip_______________ Order Amount Standard* 2nd Day** OVERNIGHT**Email Address_____________________________________________________________________Home Address_____________________________________________________________________ 0-$24.99 $4.50 Additional $5.99 Additional $15.99City____________________________________________________State________ Zip____________Ship to: ❒ School Address or ❒ Home Address $25-$249.99 15% Additional $15.99 Additional $19.99Please complete the following:What grade do you teach?_________________________________________________________ $250+ 10% Additional 5% Additional 10%Home ( _____ )____________________________ School ( _____ )___________________________ Note: Orders cannot be delivered to a P.O. Box. Orders must beCall: 800-858-7339 or Fax: 888-877-7606 • Online: www.tcmpub.com placed by 1 pm Eastern time for 2nd Day and Overnight delivery.For customer service, call 800-858-7339 6am-5pm Pacific Time Available Mon-Fri No Sat or Sun delivery. OUR GUARANTEE CANADIAN CHARGES We take pride in creating quality products for your classroom. If you Add 13% of subtotal to all orders or call 800-858-7339 for ordering are not satisfied with any product, please return it within 90 days. assistance. We will issue a credit or return your money—whichever you prefer. FOREIGN CHARGES*** Add $30.00 for orders under $100.00. Add 30% for orders between $100.00 and $1,000.00. Add 25% for orders over $1,000.00. Call 714-891-2273 for expedited shipping quote. SALES TAX**** Residents of AR, CA, CT, DC, FL, GA, IL, KS, KY, MA, MI, MN, MO, MS, NC, NJ, NV, OH, PA, SC, SD, TX, VA, WA please add applicable sales tax. • Prices subject to change. • Non-public schools are subject • Minimum order $10.00. to credit approval. • Payable only in U.S. funds drawn • A ll orders from on a U.S. bank. Outside U.S., individuals must be accompanied by payment. please use U.S. funds: Money Orders, VISA, or MasterCard only.Item Quantity Title Page No. Unit Price Total PriceI am enclosing: ❒ Check ❒ Purchase Order (P.O. with valid signature Order Total ❒ Money Order must be included with order form.) *Standard Shipping ChargesCredit Card: ❒ Personal ❒ School (VISA or MasterCard only) **Overnight or 2nd Day Delivery SurchargeAcct.# ***Foreign Charges SubtotalExpiration Date���������������������������������������������������������� ****Sales TaxPrint Card Holder’s Name_______________________ �������������������������� TOTAL ENCLOSEDCard Holder’s Signature ��������������������������������������������������Phone Number (required for credit card purchase) ( _____ )������������������B2113