HF-120_2018_Catalog150

INSTRUMENT POWERMANAGEMENT PRODUCT CATALOG & REFERENCE GUIDE

WELCOME TO OUR VALUED CUSTOMER, First and foremost, thank you for choosing Hu-Friedy. We know that you pride yourself on performing at your best, and you expect the same from your instruments. That is why for the past 110 years, we’ve dedicated ourselves to crafting the highest quality dental products and services. Being a Hu-Friedy customer means you’re a part of the Hu-Friedy family. One that is incredibly proud of an earned reputation for uncompromising quality and experiences across every interaction you have. As technology advances, so does the dental industry and your patient’s expectations. We are listening, learning, collaborating, teaching, crafting, refining, perfecting, innovating and honing everything we do to make sure you stay atop your practice. Our products and services are exceptional because we develop them in conjunction with the very people who use them— industry key opinion leaders, specialists, private practitioners, schools and educators. Advancing dental performance—smile after smile is a mission we don’t take lightly. Our employees strive to perform at their best every day to supply you with a product that puts a smile on your face, and more importantly, on your patients. We look forward to serving you this year, and we thank you for your continued support. We are Hu-Friedy. How the best perform. Sincerely, Ron Saslow Chief Executive Officer & Chairman of the Board

TABLE OF CONTENTSA | INSTRUMENT MANAGEMENT Files E47 A INSTRUMENT Forceps E50 MANAGEMENTCassettes A2 Grafting Instruments E63 Hemostats E66 B DIAGNOSTICCassette Accessories A7 Implant Probes E68 C POWER Knives E69 D PERIODONTALIMS Signature Series Tubs A19 Mallets E75 E SURGICAL Needle Holders E76 F ENDODONTICOrganization Products A21 Osteotomes E83 G RESTORATIVE Periosteals E88 H ORTHODONTICCleaning & Care Products A22 Periotomes E97 K REFERENCE Retractors, Mouth Props & Gags E99Dental Unit Waterline Products A27 Rongeurs E104 GUIDE & INDEX Root Tip Picks E106Sterilization Products A28 Scalpel Handles & Blades E110 Scissors E114Hand Care Products A33 Sinus Lift Instruments E121 Sutures & Suture Needles E126Reference & Replacement Parts A37 Syringes E131 Tissue Pliers & Nipper E132B | DIAGNOSTIC B2 Wire Products E138 Explorers B6 Probes B13 F | ENDODONTIC F2 Expros B16 Endodontic Microsurgery F10 Dressing Pliers B18 Explorers F11 Mirrors Excavators F12 Endodontic Accessories F13C | POWER C1 Spreaders F16 SWERV®3 Magnetostrictive Scaler C3 Pluggers F19 Ultrasonic Inserts C13 Rubber Dam Clamps Piezon® Units C17 Rubber Dam Clamp F23 Hu-Friedy EMS Tips C20 Accessories & Kits S-Series Tips C27 G2 AIR-FLOW® Units C34 G | RESTORATIVE G10 AIR-FLOW® Powders Satin Steel XTS® Composite Instruments Composite/Plastic Filling Instruments G19D | PERIODONTAL D4 Anodized Aluminum Composite Gingival Retractors G40 Sickle Scalers D11 Instruments G21 Gingival Cord Packers G41 Scaler/Curette Sets D14 Hatchets G22 Crowns G42 Universal Curettes D16 Chisels & Hoes G24 Crown Removers G43 Gracey Curettes D25 Excavators G26 Nash/Taylor Esthetic Instruments G45 Resin Scalers & Curettes D28 Placement Instruments G27 Spatulas & Knives G48 Area-Specific Curettes D30 Amalgam Carriers G28 Measuring Devices & Wax Carvers G49 Implacare® II Scalers D31 Pluggers/Condensers P.K. Thomas & Shaw Waxing Instruments G50 Titanium Implant Scalers D32 Amalgam Files & Articulating Paper G32 Shaw Instruments G51 Specialty Scalers D36 Forceps Chu’s Aesthetic Gauges G52 Disposable Prophy Angles D37 Carvers G33 Instrument Sharpening D42 Amalgam Knives & Cement Removers G37 H | ORTHODONTIC H2 Miscellaneous Burnishers G38 Clear Collection for Clear Aligners H4 Cutters H7E | SURGICAL E4 Utility Pliers H10 Aspirators E6 Wire Forming Pliers H14 Burs & Trephines E7 Hand Instruments H20 Black Line E22 Mathieus, Scissors & Hemostats H21 Calipers E23 Ortho Accessories & Reference Chisels E30 Curettes E36 Elevators 1

ALPHABETICAL NAME INDEX NAME INSTRUMENT PAGE NAME INSTRUMENT PAGE A Boynton Abou-Rass Apical Endodontic Instruments F4-F5, F7, F9 Bradley Needle Holder E82 Acorn Burnishers G4, G39 Buck Elevator E40 Adams Pliers H12 Periodontal Knives E74 Adson Hemostats E67 Bunting Periodontal File E49 Tissue Pliers Buser Curettes D14 Adson-Brown Tissue Pliers E133, E134, E135 Bone Chisels E25 Ainsworth Rubber Dam Punch E133 Byrd Periodontal Chisels E19, E25 Allen Membrane Measurement Card F23 C Periosteals E10, E95 Periodontal Knife E63 Castroviejo Aspirators E4 Allison Periosteal Andrew-Pychon Tissue Pliers E13, E70, E71 Cattoni Calipers E22 Andrew Aspirator E10, E89, E95 Needle Holders E76, E77, E78 Carvers Cawood Scissors Arens Plugger E136 Centennial Probes E114 Arruga Tissue Retractors E5 Chandler Scaler/Curette Set B12 Austin Needle Holder G35 Retractor D12 B Retractors G28 Christensen Sickle Hoe Scaler E99 Backhaus Clappison Bone Chisels D32 Baldwin Towel Clamps E101 Cleveland Gouges E23 Ball Composite/Plastic Filling E78 Cogswell Crown Removers E24 Burnisher E102 Carvers G43 Balshi Scalers Colburn-Miller Rongeurs G35 Barnhart Cord Packer E29 College Aspirator E104 Curettes G18 Collier Elevators E5 Bates Scaler Tips for Implants G38 Colorvue Bone Files E37, E41 Curette D10 Columbia Cotton/Dressing Pliers E48 Beavertail Sharpening Stone G41 Needle Holder B16 Bennett Burnishers D14, D25 Cook Plastic Probes E82 Benque Periosteals D30 Coon Curettes B6, B7 Bernard Periosteals D15 Corn Retractor D14, D25 Beyer Syndesmotome Elevators D38 Cortellini Scaler Tips for Implants E99 Bird Beak Rongeurs G38 Forceps D30 Bishop Pliers E90 Coupland Pliers E53 Black Retractor E92 Suture Pliers H8 Carving Knives E46 Cowhorn Needle Holder E136 Blumenthal Pluggers E105 Scissors E76 Boehler Retractor H10, H11, H12, H13 Crane Aspirator E119 Boghosian Rongeurs E99 Crane-Kaplan Gouge Elevators E5 Rongeurs G37 Explorer E39 Composite/Plastic Filling G28 Forceps B3, B5 XTS Composite Instruments E99 Elevator E51, E55 E105 Periodontal Knife E40 E105 E74 G14, G18 G32

NAME INSTRUMENT PAGE NAME INSTRUMENT PAGE Scalers D10 D4Crile-Wood Needle Holders Sickle Scalers D12Cryer Elevators E79, E82 B15 Forceps E37 Goldman-Fox Curette/Hoe/Scaler SetCumine Scaler G40Curtis Elevators E54, E56 Expros E137Cushing Chisel Scalers D10 E14, E74, E75 Tissue Pliers E41 Gingival Retractor E90D D34 B10, B12Darby-Perry Chisel Scalers E133 Tissue Nippers E8, E116, E119 Composite/Plastic Filling G13Davis Excavators D34 Periodontal Knives G44Dean Root Tip Picks G15 G25 Rongeurs G24 Periosteals G2, G13DeBakey Scissors E106 D16-24 Needle Holder E104 Probes E93Debridement Tissue Pliers E115, E117 E21, E65DeMarco Curettes E80 Scissors G14Derf Curettes E133E Needle Holders D29 Goldstein Composite/Plastic Filling G3Euwe D29 G41 Bone Scoop E79, E82 Crown RemoverF Placement Instruments E78, E79Fedi E65 Excavator E66, H20Felt Periodontal Chisels E64Fox Composite/Plastic Filling XTS Composite E53Frahm Tissue Pliers E26, E27 E67Frazier Carvers G19 Gracey CurettesFreedman Aspirator E134 E79, E82Freer XTS Composite G35 Grisdale Periosteals Periosteals E5 E79, E82Friedman Bone Chisels G4 Bone Graft Condenser E80, E82 ElevatorsG Rongeurs E90, E92 Gregg Composite/Plastic Filling E37Gardner E29 E107Gerald Bone Chisels E40 XTS Composite E56Glick Tissue Pliers E105 E102 Excavator Guyer Cord Packer G15Glickman Plugger E23 D33Goldfogel Probes E133, E135 H E91Goldman Composite/Plastic Filling E45 Curette F11 Halsey Needle Holders E30 F16 E95 B10 Halsted-Mosquito Hemostats G12 G5, G17 G33, G35 D15 Harris Forceps G28 E88, E89 Hartman Hemostats E41 Hegar-Baumgart- Needle Holders ner Needle Holders 3 Hegar-Mayo Hegar-Olsen Needle Holder Heidbrink Elevators Root Tip Picks Henahan Forceps Retractors Heidmann Composite/Plastic Filling Hirschfeld File Scalers Hirschfield Periosteals Hoexter Elevators Periodontal Curettes Periosteals Hollenback XTS Composite Carvers Pluggers Hopkins Periosteals Hourigan Elevators

ALPHABETICAL NAME INDEX NAME INSTRUMENT PAGE NAME INSTRUMENT PAGE E93 E104 Periosteals Rongeurs E20, E122, E123 H7, H8 E135 How Pliers E47 Sinus Lift Instruments E108 E21, E64 Howard Bone Files E89 Tissue Pliers E65 E54 E94 Root Tip Picks D15 L E100 G39 Periosteals D4, D25 LaBanca Bone Plugger G4 D30 Hull Forceps Bone Curette E8, E118 D14 D13, D25 Hutchinson Curette E116, E119 Periosteals D30 Hygienist Scalers G49 Retractors G49 G35 Scaling Tip for Implants D4, D6, D9, D25 Ladmore Burnishers E6 D4 E118 I H10 XTS Composite G15 E118 E115, E117 Indiana University Curettes E65 LaGrange Scissors D15 E18, E33 Iris Scissors E123, E125 Langer Curettes F17 E27, E28 Iwanson Calipers E64 Scaling Tip for Implants F16 E86 E40 J LeCron Carvers D15 E56 H12 Jacquette Scalers E66 Levy Carvers E99 E115, E120 G29 Jacquette-Towner Scalers E67 Lindemann Burs and Drills F6 B9 Jarabak Pliers F6 Lister Scissors G40 G28 Joseph Scissors E29 Loesche Composite/Plastic Filling E81, E82 E13, E69 Jovanovic Bone Scoop E31 Locklin Scissors H20 E67 E120 Sinus Lift Instruments E80 Loma Linda Curette D11, D25, D28 E25 E24 Periodontal Bone Chisels D35 Lucas Surgical Curettes E53, E54, E55, E56 E25, E29 E75 Plugger E69 Luks Endodontic Pluggers E89 E31 E104 Osteotome E10, E93, E94 M G40 B10 K Machtou Endodontic Pluggers Kells Forceps MacMillan Elevators Kelly Hemostats Mallery Curettes Scissors Marcotte Pliers Kelly-Rankin Hemostats Markel Mouth Props Khayat Filling Instruments Markley Pluggers Probe Endo Pluggers Maryland, Univer- Plugger sity of Kincheloe Gingival Retractor Marquette Kirkland Periodontal Chisels Mathieu Needle Holders Periodontal Knives Pliers Surgical Curette Mayo Scissors Kocher Hemostats McCall Scalers/Curettes Kocher-Mathieu Needle Holder McFarland Bone Chisels Kramer-Nevins Bone Chisels Mead Forceps Currettes Mallets Periodontal Bone Chisels Periosteals Periodontal Knives Rongeurs Periodontal Surgical Curettes Meinershagen Gingival Retractors Periosteals Merritt Probes4

NAME INSTRUMENT PAGE NAME INSTRUMENT PAGE E8, E116, E117, E118, E119 B16Metzenbaum Scissors Perry Dressing Pliers B3Michigan, Univer- Expros B15sity of Probes Pigtail Explorers E40, E42 B9, B10 E133 G32 Potts Elevators E47 E10, E94Miller Articulating Paper Forceps E39 Potts-Smith Tissue Pliers E32 E34 Bone Files E48 Prichard Periosteals G18 D29 Elevators E99 Surgical Curettes E117 Surgical Curettes E103 Q E101 E10, E88, E89 D15Miller-Colburn Bone Files Quétin Composite/Plastic Filling E71 E34, E35 E29Minnesota, Univer- Retractors G29 Furcation Curettes D8sity of G32 D8, D25 Quinby Scissors E28 G49Molt Mouth Gag B12 R E67 H12 G39 Periosteals G45 Ramus Retractor E123, E124, E125 D9 D15 Surgical Curettes D5, D25 Ratcliff Curette E53 E71Mortonson Plugger Reddy Periodontal Knives E49 B14 E39Morse Scaler Remington Chisel Scaler E37, E38 B9 E91N Scaler E134 H11 G51Nabers Probes E26 Rhein Amalgam File B2 D9 G35Nance Pliers D29 Rhodes Periodontal Chisels E100 E90 E91, E92Nash/Taylor Esthetic Instruments Roach Carvers D4-10 B4 F17Nebraska Scaler Rochester-Pean Hemostats G29 D33Nevi Scalers D32 Romerowski Burnisher E71 E13, E14, E70Nevius Forceps G31 Rompen Sinus Lift Instruments D9, D14North Carolina, Expro E100 G24University of Probes Rule Curette G35 E28 E56 S 5 E112O F12 Sanders Periodontal KnifeO’Brien Pliers Schluger Periodontal FileOchsenbein Periodontal Chisels Schmeckebier ElevatorsOdont-Jacquette Scaler Seldin ElevatorsO’Hehir Debridement Curettes PeriostealsOhl Periosteal Semkin-Taylor Tissue Pliers ExplorerOld Dominion, File Scalers Shaw Waxing InstrumentsUniversity Shepherd’s Hook ExplorersOrban Shoshan Carvers Hoe Scalers Shuman Retractors Periodontal Knife Sicilia PeriostealsOregon Pluggers Sickles ScalersOrringer Retractors Sleiman Endo PluggersP Smith Plugger Southern Califor- Periodontal KnifePalacci Implant Chisel nia, University of ScalersParmly ForcepsPaquette Blade Holders Spoon ExcavatorsPeet Forceps, Post & Silver Point Sprengel Carver

ALPHABETICAL NAME INDEX NAME INSTRUMENT PAGE NAME INSTRUMENT PAGE D7 Urban Retractors E99 Springfield Scalers V Steiglitz Post & Silver Point Removal F12 Vehe Wax Carvers G49 Steigmann Forceps Velvart Microsurgical Pluggers F6 Periosteals E96 Microsurgical Mirrors F3 E72, E73 Vision Curvettes D28 Splitters W H9 Wagner Scissors E120 Steiner Pliers E117 Wahl Bone Files E47 E40 Wakai Endodontic Spreaders F14 Strabismus Scissors G6 Wakefield Bone Chisels E24 E49 Wall Carvers G34 Stout Elevators E32 Ward Carvers G34 E137 Pluggers G31 StyleSkulpt XTS Composite E117 Warwick-James Elevators E42 Webster Needle Holders E79, E82 Sugarman Periodontal Files G34 Wedelstaedt Amalgam Files G32 G37 Chisels G22 Surgical Curettes G30 Weider Retractor E100 G12 Weingart Pliers H7 Tissue Nippers E28 Weiss Bone Calipers E22 E49 West Root Tip Picks E109 Sullivan Scissors E95 Whiteside Scaler D9 E123 Wiland Carver G33 T D8 Wilkins/Tufts Explorer B2, B3, B5 E134 Expros B13 Tanner Carvers E117 Williams Expros B13, B14, B15 G35 Probes B6, B9, B10, B11, B12 Carver Knives G50 Williger Periosteals E88 E60 Wise Periotomes E14, E98 Pluggers D32 Woodson Composite/Plastic Filling G15, G18 E71 Periosteals E93 XTS Composite D4 Woodward Elevators E40, E41 D4 Forceps E55 Tabanella Bone Chisels E6 Y G15 Yardley Cord Packer G41 Periodontal Files H19 Yankauer Aspirator E5 G14, G18 Younger-Good Curettes D14 Periosteals D28 Scalers D9 H8 Z Tarnow-Eskow Sinus Lift Instruments Zerfing Chisel Scaler D34 F8 Zingheim Implant Instruments E68 Taylor Scalers D14-15 Zingheim Implant Instruments E66 Taylor-Semkin Tissue Pliers H4 E50-E62 Tenotomy Scissors Tharp Carvers Thomas Waxing Instruments Tomes Forceps Towner Hoe Scaler Periodontal Knife Scalers Towner-Jacquette Sickle Scalers Trephine Burs and Drills Trico Composite/Plastic Filling Tucker Ligature Director Tufts University Composite/Plastic Filling Turgeon Curettes Tweed Pliers U Universal Condenser Curettes Cut & Hold Distal End Cutter Forceps6

HOW TO USE THIS CATALOG As the leader in the dental instrument industry, Hu-Friedy has a tradition of strong commitment to customer needs and customer education. As a result, in addition to product descriptions, this catalog contains related educational and maintenance information. Dispersed throughout each section you will find informational statements, maintenance tips, intra-oral photographs and diagrams. These have been included to enhance your knowledge about product use.LOOK FOR THESE ELEMENTS HOW TO USE THIS SECTION PRODUCT CATEGORY INSTRUMENT NAME & PATTERN 11/12 PART CODE OF PICTURED INSTRUMENT Scaler IMPLACARE®II SCALERS AVAILABLE HANDLE DESIGNS | SM11/127 For implant maintenance, Implacare II is used to remove plaque and Handle options: #2, calculus with the least amount of alteration to titanium abutments.* #4, #6, #7, #8, #9 PRODUCT USE Implant Maintenance Care Starter Kit | IMPCKITII Implacare II Colorvue 1 Implacare scaler handle 1 Colorvue probe handle 1 set of 204S scaler tips 1 set of PCV11 tips 1 set of H6/H7 scaler tips (3-6-8-11) 1 set of Columbia 4R/4L tips 1 set of PCV12 tips 1 set of Langer 1/2 tips (3-6-9-12) 1 set of Barnhart 5/6 tips 1 set of Williams tips (1-2-3-5-7-8-9-10) 1 set of UNC12 tips (1-2-3-4-5-6-7-8-9-10-11-12) Langer 1/2 Kit (Handle & 12 pairs) | IMPLLG1/26 Langer 1/2 Tips Refill Package (12 pairs) | IMPLLG1/2 Barnhart 5/6 Kit (Handle & 12 Pairs) | IMPLBH5/66 Barnhart 5/6 Tips Refill Package (12 pairs) | IMPLBH5/6 Columbia 4R/4L Kit (Handle & 12 pairs) | IMPL4R/4L6 Columbia 4R/4L Tips Refill Package (12 pairs) | IMPL4R/4L H6/H7 Kit (Handle & 12 pairs) | IMPLH6/76 H6/H7 Tips Refill Package (12 pairs) | IMPLH6/7 204S Kit (Handle & 12 pairs) | IMPL204S6 204S Tips Refill Package (12 pairs) | IMPL204S Implacare II Intro Kit (Includes all 5 tip designs) | IMPLINTRO6 Implacare II Assorted Tips Kit* (12 pairs) | IMPLSORT6 Implacare II Assorted Tips Refill Package* (12 pairs) | IMPLSORT SICKLE SCALER TIPS UNIVERSAL CURETTE TIPS 204S Hygienist H6/H7 NEW Barnhart 5/6 NEW Langer 1/2 Columbia 4R/4L THE REFERENCE GUIDE at the back of NOW 20% THINNER! NOW 20% THINNER! NOW 20% THINNER! the book includes resource information on the following topics: Titanium abutment images are Scaling with Implacare II caused the least alteration to the abutment surface from the International Journal of Oral & Maxillofacial Implants ORIGINAL TITANIUM PLASTIC MATERIAL Anatomy of a Dental Instrument K1 study. Hallmon WW. Waldrop ABUTMENT MAGNIFIED CONTAINING ABRASIVES Instrument Sharpening K3 TC. Meffert RM. Wade BW. INT Instrument Care K7 J ORAL MAXILLOFAC IMPLANTS 25AFTER Instrument Processing Guidelines K9 1996;11:96–100. The IMS® Cycle K10 *Hasturk H, Huy Nguyen D, Sherzai STROKES Trouble Shooting Guide K11 H, Song X, Soukos N, Bidlack F, Van IMPLACARE II TIP Definition of Black’s Formula K12 Dyke T. Comparison of the Impact MADE WITH PLASTEEL of Scaler Material Composition on Polished Titanium Implant Abutment Surfaces. Journal of Dental Hygiene. 2013;87(4)D30SECTION NUMBER DID YOU KNOW?& PAGE NUMBER 7

SOLUTIONS OVERVIEW PERIODONTAL SURGICAL POWER Since 1908, Hu-Friedy has been putting the highest NTIC quality, most innovative dental products in the hands RESTORATIVE of dental professionals worldwide. And today as one ORTHODONTIC of the world’s leading dental instrument companies, we continue our commitment to advancing dental performance by supporting these products with world class service, support, education and peer communities. We’re committed to making sure the best perform that way. Hu-Friedy. How the best perform. INSTRUMENT MANAGEMENT ENDODO A Worldwide Focus on Quality A Legacy of Innovation transport and store procedural set-ups, and Hu-Friedy is based in Chicago and has been Since the Hu-Friedy Manufacturing Company which ultimately won the prestigious Design privately managed by the Saslow family since was founded in 1908 by Hugo Friedman, we have Engineering Magazine Award for Excellence. 1959. Today, we employ over 700 talented and proudly collaborated with private practitioners, committed employees with a sales force covering dental schools and leading educators to develop Additionally, from our inception we have more than 25 countries. Including our production new technologies, innovative designs and quality been committed to education and developing facilities in Chicago and Shanghai, China; our products that are synonymous with value and relationships with students. At the core is our distribution centers in Des Plaines, Illinois, and performance. Because of our reputation for commitment to helping our customers perform Tuttlingen, Germany; and our additional offices in industry leadership, dental experts have been at their best and to improve lives through better India, Japan, Germany and Italy. Worldwide, our turning to Hu-Friedy with their cutting-edge ideas dentistry. From student to practitioner, products are sold in more than 95 countries. for over a hundred years. Hu-Friedy is proud to be an important part of our customers’ professional lives. Our mandate for excellence is company-wide. In the 1940s, when Dr. Clayton Gracey, the At Hu-Friedy, you will find more than 300 artisans periodontist who first identified gum disease meticulously handcrafting instruments in a as the cause of tooth loss, wanted to develop modern manufacturing facility. Our employees effective scaling tools, he came to Hu-Friedy — are personally responsible for the quality of and the seminal Gracey curette was born. In the their work and each other’s. We believe that 1980s, when Dr. Charles Jerge had a bold idea our success is the result of both our company’s to standardize dental processes, he too turned commitment to excellence and the dedication to Hu-Friedy. The result was the Instrument and pride of our highly skilled instrument Management System (IMS®), which revolutionized craftspeople, management and staff. the way dental practices organize, sterilize,8

A Proud Heritage and a Focus On the FutureKEY DATES & ACCOMPLISHMENTSIntroduced Gracey Launched first restorative line Introduced Entered Ultrasonic Scalingline of instruments of Immunity Steel® instruments IMS® market with insert line1908 1945 1975 1978 1981 1982 1991 1996 1999Founded by Developed Began Japanese Established LaunchedHugo Friedman Wilkins/Tufts Explorer distribution European office Orthodontics partnership in Germany product lineInitiated Friends Introduced Surgical expands to Launched IMS® Infinity Cassettesof Hu-Friedy EVEREDGE® include Black Line Launched Disposable Prophy Anglesonline community Scalers Instruments Opened European office in Frankfurt, Germany 2002 & 2007 2005 2014 2015 2016 2017Expanded globalpresence in Announced Ortho Clear Launched LaunchedJapan and China Strategic Alliance Collection EVEREDGE® Titanium with EMS launches 2.0 Product Line Implant Scalers 9

ORDERING INFORMATION How to Place an Order Pre-payment of an initial prototype fee and HOW TO CONTACT HU-FRIEDY Hu-Friedy instruments may be ordered through an written approval of the price quotation is required authorized dental dealer. Your dental dealer will to begin production. All prototype set-up fees U.S. & CANADA take your order and ship the product to you. If you are non-refundable. Subsequent orders (more CORPORATE OFFICES have questions prior to placing an order or would than two years) after the initial order are subject 1-773-975-6100 like to place an order for Hu-Friedy products, to additional prototyping charges. All custom please call our Customer Care Department via designs are the property of Hu-Friedy. CUSTOMER CARE the communications listed below. We will need to 1-800-Hu-Friedy (1-800-483-7433) know your dealer preference because your order Hu-Friedy Guarantee Fax: 1-800-729-1299 or 1-773-975-1683 will automatically be shipped and billed through Any Hu-Friedy product that fails as a result of Outside U.S. & Canada: 1-773-975-6100 your dental dealer. If you do not have a dental material defect or poor workmanship will be dealer, an authorized dealer listing is available repaired or replaced at no charge. Hu-Friedy SCHOOLS & INSTITUTIONS from Hu-Friedy’s website at www.Hu-Friedy.com. cannot be responsible for the performance or Phone: 1-877-321-HFED replacement of any Hu-Friedy instrument that Fax: 1-866-434-3576 Hu-Friedy’s Customer Care Department has been tampered with, modified, retipped, or Hu-Friedy is proud of its highly trained, qualified refitted in any manner. See Hu-Friedy.com for TECHNICAL SERVICE and professional customer care team. They full product warranty details. 1-888-TEC-TECH (1-888-832-8324) are dedicated to helping you meet your needs. Fax: 1-773-868-3544 Feel free to call a Hu-Friedy Customer Care Returns, Repair & Reconditioning Website: Hu-Friedy.com Representative when special assistance is needed. Complete service for Hu-Friedy instruments and Outside U.S. & Canada: 1-773-975-6100 IMS cassettes is available in our Chicago facility. Special Order Instruments Please call or write Hu-Friedy with any questions EUROPE, MIDDLE EAST OR AFRICA Hu-Friedy manufactures an extensive selection or concerns regarding Hu-Friedy instruments. Hu-Friedy Mfg. Co., LLC. of instruments. We welcome the opportunity to Call 1-888-TEC-TECH and you will automatically be European Headquarters manufacture instruments on a special order basis. connected with the Hu-Friedy Technical Service Astropark Instruments that are currently available but are Representative who covers your area. Lyoner Str. 9 desired in an alternative tip/handle selection D-60528 Frankfurt am Main or are a special school pattern, are considered All returns should be sent to: Phone: +49 (0)69 24 75 3 64 0 special order instruments. Price quotations Hu-Friedy Technical Service Fax: +49 (0)69 25 57 70 15 are available upon request. Submit all special 3232 N. Rockwell St., Chicago, IL 60618. Toll Free: 00800 48 37 43 39 order requests to: Hu-Friedy Customer Care Email: [email protected] Department. All special order instruments are No Retipping Website: HuFriedy.eu the property of Hu-Friedy. Hu-Friedy does not repoint or retip instruments. To do so would compromise the structural LATIN AMERICA Custom Design Instruments integrity of the instrument and our quality Website: Hu-Friedy.com Hu-Friedy is a leader in the development, standards. In addition, there is a high degree manufacture and distribution of quality of potential risk to all parties inherent in such ASIA/PACIFIC RIM dental instruments as well as products and a service. Therefore, retipping or repointing Hu-Friedy Japan LLC services related to their use, maintenance instruments will void Hu-Friedy’s warranty. ProsTech Akihabara 6F and management. Because of our tradition to 6-13-10 Soto Kanda, Chiyoda-ku, Tokyo continually meet the needs of our customers, Canadian Sales 101-0021 JAPAN Hu-Friedy produces custom designed instruments Note: Some of the devices advertised may Phone: 03-4550-0660 as well. not be licensed for sale in accordance with Fax: 03-4550-0661 Canadian law. Email: [email protected] Submit all custom design requests to the Website: Hu-Friedy.co.jp Hu-Friedy Technical Service Department and include the following: CHINA Hu-Friedy Medical Instrument 1) An actual sample and/or a detailed written (Shanghai) Co. Ltd. description that includes all dimensions and Building #29, 1365 Kangqiao Road (E) measurements. For example: bend angle(s), Shanghai 201319 P.R. of China point width(s), length(s), radius(radii), bevel Phone: +86-21-68183182 angle(s), handle design, special material Fax: +86-21-68183017 requirements, etc. 2) Provide the name and phone number of your dental dealer. This information will be used to prepare a price quotation.10

INSTRUMENTMANAGEMENT INSTRUMENT MANAGEMENT Cassettes A2-A18 Cassette Accessories A7 IMS Signature Series Tubs A19 Organization Products A21 Cleaning & Care Products Dental Unit Waterline Products A22 Sterilization Products A27 Hand Care Products A28 Reference & Replacement Parts A33 A37

THE INSTRUMENTMANAGEMENT SYSTEM CYCLEOptimal infection prevention is facilitated by the use of tools that allow for improved efficiency and safety.Instrument integrity is further enhanced by the use of Hu-Friedy’s Instrument Management System (IMS).IMS allows clinicians to move instruments from cleaning through chairside without touching or damagingthe instruments while improving safety and compliance..1. Chairside: Patient Preview & Presentation CHAIRSIDE CLEANING • Systematically organizes instruments according to procedure type, allowing for more 12 focus on patients and less time spent looking 43 for missing instruments. • Neatly organized instruments offer more STORAGE STERILIZATION professional appearance and can help enhance referrals.2. Cleaning: Processed & Prepped • Instruments are kept together throughout cleaning, rinsing and drying, reducing the potential for breakage or loss. • Minimizes handling of instruments, reducing the chance for sharps injuries.3. Sterilization: Wrapped & Ready • Complete procedures are packaged in IMS Sterilization Wrap and placed in autoclave together to help reduce consumable usage. • Reduced handling of instruments provides safer protocol and minimizes liability.4. Storage: Neat & Complete • Ready for use or storage until needed for increased time savings. • Complete procedural set-ups for easy set-up and teardown.

POINTS OF PERFORMANCE Ergonomic latch with positive locking Revolutionary new hole pattern design mechanism is safe and easy-to-use, allows creates more access to instruments one-handed opening and visual confirmation if during cleaning and sterilization the cassette is locked / unlocked. (Figure 2) and increases compatibility with today’s cleaning equipment,Innovative color-coded silicone rail system, including automated washers. available in 11 color options, significantly reduces instrument contact, allowing for High quality, electropolished more water flow while protecting the stainless steel protects against corrosion while providing a instruments during reprocessing. (Figure 1) professional appearance. Smooth round corners and slotted edges increase drainage and reduce drying time.New beveled edge allows for a more ergonomic grasp. Figure 1 Figure 2 A1

IMS INFINITY SERIES™ IMS Infinity Series™ Cassettes are made of long-lasting, low-maintenance CASSETTES stainless steel. Soft, colored silicone rails securely hold instruments throughout the processing cycle. Available in over 100 different sizes,A2 configurations and color options, cassettes can be specialized to meet your needs. Exam Cassette – 5 Instruments Exterior Dimensions 3\" x 8\" x 1.25\" (76 mm x 203 mm x 32 mm) Holds 5 instruments. Red | IMN6050 Gray | IMN6051 White | IMN6052 Orange | IMN6053 Purple | IMN6054 Yellow | IMN6055 Lavender | IMN6056 Black | IMN6057 Blue | IMN6058 Green | IMN6059 Ocean Blue | IMN60511 Small Cassette – 8 Instruments | IMN5080 Exterior Dimensions 5.5\" x 8\" x 1.25\" | IMN5081 (140 mm x 203 mm x 32 mm) | IMN5082 Holds 8 instruments with an accessory area. | IMN5083 | IMN5084 Red | IMN5085 Gray | IMN5086 White | IMN5087 Orange | IMN5088 Purple | IMN5089 Yellow | IMN50811 Lavender Black Blue Green Ocean Blue Small Cassette – 10 Instruments Exterior Dimensions 5.5\" x 8\" x 1.25\" (140 mm x 203 mm x 32 mm) Holds 10 instruments. Red | IMN5100 Gray | IMN5101 White | IMN5102 Orange | IMN5103 Purple | IMN5104 Yellow | IMN5105 Lavender | IMN5106 Black | IMN5107 Blue | IMN5108 Green | IMN5109 Ocean Blue | IMN51011

Signa-Stat Cassette – 12 Instruments Exterior Dimensions 6.5\" x 10.5\" x 1.25\" (165 mm x 267 mm x 32 mm) Holds 12 instruments with an accessory area. Fits in SciCan® STATIM® or Midmark M3 autoclave. Red | IMN8120 Gray | IMN8121 White | IMN8122 Orange | IMN8123 Purple | IMN8124 Yellow | IMN8125 Lavender | IMN8126 Black | IMN8127 Blue | IMN8128 Green | IMN8129 Ocean Blue | IMN81211 Large Cassette with Accessory Area – 12 or 16 Instruments Exterior Dimensions 8\" x 11\" x 1.25\" (203 mm x 280 mm x 32 mm) Also available in 8\" x 10.5\" x 1.25\" size (IMN416xQ) to fit unique ultrasonic tanks. 12 16 Instrument Instrument Red | IMN4120 | IMN4160 Gray | IMN4121 | IMN4161 White | IMN4122 | IMN4162 Orange | IMN4123 | IMN4163 Purple | IMN4124 | IMN4164 IMN416x, 16 Instrument Yellow | IMN4125 | IMN4165 Cassette shown left. Also available in 12 Lavender | IMN4126 | IMN4166 instrument cassette with larger accessory Black | IMN4127 | IMN4167 area (IMN412x). Blue | IMN4128 | IMN4168 Green | IMN4129 | IMN4169 Ocean Blue | IMN41211 | IMN41611 Large Cassette – 20 Instruments Exterior Dimensions 8\" x 11\" x 1.25\" (203 mm x 280 mm x 32 mm) Holds 20 instruments. Red | IMN4200 Gray | IMN4201 White | IMN4202 Orange | IMN4203 Purple | IMN4204 Yellow | IMN4205 Lavender | IMN4206 Black | IMN4207 Blue | IMN4208 Green | IMN4209 Ocean Blue | IMN42011SciCan and STATIM are registered trademarks of SciCan Ltd. A3

IMS INFINITY SERIES™ Double-Decker® Cassette – 8 Instruments CASSETTES Exterior Dimensions 3\" x 8\" x 1.5\" (76 mm x 203 mm x 38 mm)A4 Holds 8 instruments. Red | IMN9080 Gray | IMN9081 White | IMN9082 Orange | IMN9083 Purple | IMN9084 Yellow | IMN9085 Lavender | IMN9086 Black | IMN9087 Blue | IMN9088 Green | IMN9089 Ocean Blue | IMN90811 Double-Decker® Cassette – 14 Instruments Exterior Dimensions 4.5\" x 8\" x 1.5\" (114 mm x 203 mm x 38 mm) Holds 14 instruments. Red | IMN9140 Gray | IMN9141 White | IMN9142 Orange | IMN9143 Purple | IMN9144 Yellow | IMN9145 Lavender | IMN9146 Black | IMN9147 Blue | IMN9148 Green | IMN9149 Ocean Blue | IMN91411 Double-Decker® Cassette – 20 Instruments Exterior Dimensions 6\" x 9.7\" x 1.5\" (152 mm x 246 mm x 38 mm) Holds 20 instruments with an accessory area. Has a built-in needle cap holder and slot for a winged syringe. Red | IMN9200 Gray | IMN9201 White | IMN9202 Orange | IMN9203 Purple | IMN9204 Yellow | IMN9205 Lavender | IMN9206 Black | IMN9207 Blue | IMN9208 Green | IMN9209 Ocean Blue | IMN92011

Oral Surgery Cassette Exterior Dimensions 8\"x 14.5\" x 1.25\"(203 mm x 368 mm x 32 mm) Accommodates 12 instruments, 4 elevators, 3 hinged instruments in the lid and a separate accessory area. Fits in most 10\" chambers or larger sterilizers, most instrument washers and larger ultrasonics. Red | IMNOS0 Gray | IMNOS1 White | IMNOS2 Orange | IMNOS3 Purple | IMNOS4 Yellow | IMNOS5 Lavender | IMNOS6 Black | IMNOS7 Blue | IMNOS8 Green | IMNOS9 Ocean Blue | IMNOS11 Ultrasonic Insert/Handpiece Cassette Small: Exterior Dimensions 1.5\" x 8\" x 1.25\" (38 mm x 203 mm x 32 mm) Large: Exterior Dimensions 3\" x 8\" x 1.25\" (76 mm x 203 mm x 32 mm)Small Ultrasonic Insert/Handpiece Cassette Small LargeLarge Ultrasonic Insert/Handpiece Cassette Cassette Cassette Red | IMN30HU0 | IMN60H0 Gray | IMN30HU1 | IMN60H1 White | IMN30HU2 | IMN60H2 Orange | IMN30HU3 | IMN60H3 Purple | IMN30HU4 | IMN60H4 Yellow | IMN30HU5 | IMN60H5 Lavender | IMN30HU6 | IMN60H6 Black | IMN30HU7 | IMN60H7 Blue | IMN30HU8 | IMN60H8 Green | IMN30HU9 | IMN60H9 Ocean Blue | IMN30HU11 | IMN60H11 Small holds 2 ultrasonic inserts or 1 handpiece. Large holds up to 3 high-speed handpieces or 5 ultrasonic inserts. Radiography Cassette | IMN7000 Exterior Dimensions 5.5\" x 8\" x 1.25\" (140 mm x 203 mm x 32 mm) Holds heat sterilizable x-ray accessories A5

IMS INFINITY SERIES™CASSETTES Large Thin Orthodontic Cassette Exterior Dimensions 8\" x 11\" x 0.75\" (203 mm x 280 mm x 19 mm) Holds up to 7 pliers and 4 hand instruments. Purple | IMNORTHL4 Blue | IMNORTHL8 Green | IMNORTHL9 Small Thin Orthodontic Cassette Exterior Dimensions 7\" x 8\" x 0.75\" (178 mm x 203 mm x 19 mm) Holds up to 4 pliers and 3 hand instruments. Purple | IMNORTHS4 Blue | IMNORTHS8 Green | IMNORTHS9 Double-Decker® Small Orthodontic Cassette Exterior Dimensions 4.5\" x 8\" x 1.5\" (114 mm x 203 mm x 38 mm) Holds up to 3 pliers, a Mathieu needle holder and 2 hand instruments. Red | IMN9140-O Gray | IMN9141-O White | IMN9142-O Orange | IMN9143-O Purple | IMN9144-O Yellow | IMN9145-O Lavender | IMN9146-O Black | IMN9147-O Blue | IMN9148-O Green | IMN9149-O Ocean Blue | IMN91411-O Using Hu-Friedy cassettes can save you over 31% linear feet in your sterilization area.A6

IMS PARTS BOX CASSETTE ACCESSORIESDesigned to keep small items such as rubber dam clamps and matrixband retainers organized during the sterilization process. IMS BUR CUSHIONSIMS Large Parts Box A hollow, rectangular, silicone base with a stainless steel lid that is designed| IMS-1273 to hold burs securely in place during cleaning and sterilization. Hollow designExterior Dimensions: 3.5\" x 1.12\" x 1\" allows drainage and proper cleaning.(89 mm x 29 mm x 25 mm) IMS-1372S IMS-1372TIMS Small Parts Box| IMS-1271 IMS-1372SHExterior Dimensions: 1.56\" x 1.25\" x 1\"(40 mm x 32 mm x 25 mm)IMS CASSETTE BARCODE CLIP IMS Bur Cushion, Short Lid IMS-1372THSnap-on Barcode for outside of Cassettes | IMS-1372S IMS Bur Cushion, Tall Lid| IMS-CABLDimensions: .75\" x 2.26\"x .067\" Holds 12 burs. | IMS-1372T(19 mm x 57.4 mm x 1.7 mm) Exterior Dimensions: 3.3\" x 1.3\" x 0.9\" Holds 12 burs.Contains lasermarked barcode to be used (84 mm x 33 mm x 22 mm) Exterior Dimensions:for identification and tracking purposes. 3.3\" x 2.44\" x 0.9\"Compatible with standard barcode reader. IMS 1/2 Bur Cushion, Short Lid (84 mm x 62 mm x 22 mm)Follows HIBC barcode standards. Lasermarktested to last more than 800 sterilization | IMS-1372SH IMS 1/2 Bur Cushion, Tall Lidcycles. (Shown at 50% actual size.) Holds 6 burs. | IMS-1372TH Exterior Dimensions: 1.75\" x 1.3\" x 0.9\" Holds 6 burs. (44 mm x 33 mm x 22 mm) Exterior Dimensions: 1.75\" x 2.44\" x 0.9\" (44 mm x 62 mm x 22 mm)IMS ENDODONTIC STANDHinged, double-lid stand holds endodontic files and reamers. Lid is etched IMS RUBBER DAM CLAMP ORGANIZING BOARDwith a ruler to measure stop positions easily from either direction. RDC Organizing Board not actual sizeIMS Endodontic Stand, Holds 24 | RDCOB| IMS-1275 Dimensions: 4.6\" x 2.4\" x .375\"Exterior Dimensions: (117 mm x 61 mm x 10 mm)2.6\" x 2.25\" x 1.2\"(67 mm x 57 mm x 30 mm) Holds up to 8 clamps during sterilization. Fits into cassette accessory area of most cassettes.IMS Endodontic Stand, Holds 48 IMS-1275 HINGED INSTRUMENT CLIPS| IMS-1275D Secure scissors, hemostats and otherExterior Dimensions: hinged instruments in the open position2.6\" x 2.25\" x 1.2\" for optimal cleaning and sterilization.(67 mm x 57 mm x 30 mm) Hinged Instrument Clips, 2 PackAIR WATER SYRINGE IMS-1278 | IM1000CLIPS – RESINCASSETTES Hinged Instrument Clips, 6 Pack | IM1002Designed to fit large or small ResinCassettes. Clip holds air/water syringe NEEDLE CAP HOLDERtip securely in place throughoutcleaning and sterilization. Needle Cap Holders, 2 Pack | IM1001IMS Resin Cassette Clip| IMS-1278 Needle Cap Holders, 6 PackFor large resin cassettes | IM1003IMS Resin Cassette Clip Combination Pack**| IMS-1279 | IM1004For small two-tier resin cassettes **6 snap-in needle cap holders andAIR AND WATER CLIPS 6 snap-in hinged instrument clips. Maintains cap in upright position forDesigned for IMS Cassettes. Air and Water clips one-handed needle recapping.can be permanently installed in your cassettes. Complete list of cassette replacement parts can be found onInfinity Series Air/Water Clip | IM1005N Hu-Friedy.com/IMS-Replacement-PartsSignature Series Air/Water Clip | IM1005Infinity and Signature Series | IM1006Double-Decker Air/Water Clip A7

IMS COLLECTIONS The IMS Infinity Series Collection and IMS Signature Series Collection feature a compilation of clinicians’ most popular procedural set-ups. Order a Collection today and receive high quality Hu-Friedy instruments and IMS cassettes together at significantly reduced prices. Create a professional, efficient working environment with the IMS Infinity Series Collection. Perio — Double-Decker® | IMN9148 | IMPERIO | IMNPERIO | MH6 Signature Series Infinity Series | MIR5/3 | EXD11/126 | IM9148 14 Instrument Cassette, Blue | MH6 | MIR5/3 Satin Steel® Mirror Handle | EXD11/126 5 Front Surface Mouth Mirror, 3 pack 11/12 Old Dominion University Explorer, Satin Steel Handle CP-12 Color-Coded Probe, | PCP126 | PCP126 Satin Steel Handle Infinity Series EverEdge® 2.0 H6/H7 Hygienist Scaler | SH6/79E2 | SH6/79E2 Signature Series EverEdge 2.0 204S Sickle Scaler | S204S9E2 | S204S9E2 EverEdge 2.0 1/2 Gracey Curette | SG1/29E2 | SG1/29E2 EverEdge 2.0 7/8 Gracey Curette | SG7/89E2 | SG7/89E2 EverEdge 2.0 11/12 Gracey Curette | SG11/129E2 | SG11/129E2 EverEdge 2.0 13/14 Gracey Curette | SG13/149E2 | SG13/149E2 | SC13/149E2 | SC13/149E2 EverEdge 2.0 13/14 Columbia University Curette 3C Ceramic Sharpening Stone | SS3C | SS3C A/W Syringe Tip Clip | IM1006 | IM1006 Prophy | IMN5106 | IMPROPHY | IMNPROPHY Signature Series Infinity Series | MH6 | IM5106 | MIR5/3 Small Infinity Series 10 Instrument | EXD11/126 | MH6 Cassette, Lavender | MIR5/3 | PCP126 | EXD11/126 Satin Steel Mirror Handle | PCP126 5 Front Surface Mouth Mirror, 3 pack 11/12 Old Dominion University Explorer, Satin Steel Handle CP-12 Color-Coded Probe, Satin Steel Handle Infinity Series EverEdge 2.0 H6/H7 Hygienist Scaler | SH6/79E2 | SH6/79E2 Signature Series EverEdge 2.0 11/12 Gracey Curette | SG11/129E2 | SG11/129E2 EverEdge 2.0 13/14 Gracey Curette | SG13/149E2 | SG13/149E2 | SC13/149E2 | SC13/149E2 EverEdge 2.0 13/14 Columbia University Curette 3C Ceramic Sharpening Stone | SS3C | SS3C A/W Syringe Tip Clip | IM1005N | IM1005A8 These collections may be ordered using the collection part code bolded at the top of the list (ex. IMNPERIO).

Exam | IMN6055 | IMEXAM | IMNEXAM Signature Series Infinity Series | IM6055 Exam Infinity Series 5 InstrumentInfinity Series Cassette, Yellow | MH6 | MH6 Satin Steel® Mirror Handle | MIR5/3 | MIR5/3 | EXD56 | EXD56 5 Front Surface Mouth Mirror, 3 pack | PCP126 | PCP126 Signature Series 5 Explorer, Satin Steel Handle CP-12 Color-Coded Probe, | DPU17 | DPU17 Satin Steel Handle U17 Utility Pick-Up Dressing Pliers Sinus Lift | IMN4121 | IMSINUS | IMNSINUS Signature Series Infinity Series | IM4121 Large Infinity Series 12 Instrument Cassette, Gray | IM1000 | IM1000 2-Pack Signature Series Hinged Instrument Clips | PPBUSER6 | PPBUSER6 Buser Periosteal, Satin Steel Handle | IMP6522 | IMP6522 Palti Bone Graft Scoop | BONT | BONT Bone Tamper 7 mm | RASP | RASP Bone Rasp | SRM10 | SRM10 Sinus Retractor Misch 10 | SINC1 | SINC1 Sinus Curette 1 | SINC2 | SINC2 Sinus Curette 2 | SYBG | SYBG Bone Grafting Syringe, 7 mm | MAL1 | MAL1 #1 Mead MalletInfinity Series Crile-Wood Perma Sharp | NH5038 | NH5038 Signature Series Needle Holder, 15 cm (6\") #2/4 Molt Curette | CM2/4 | CM2/4 #UNC 12 Colorvue Kit | PCVNCKIT6 | PCVNCKIT6 #23 Seldin Periosteal Retractor | P23 | P23 Bone Packer 6 mm/8 mm | BPACK | BPACK Suture Removal | IMN5103 | IMSUTURE | IMNSUTURE Signature Series Infinity Series | IM5103 Small Infinity Series 10 Instrument Cassette, Orange | MH6 | MH6 Satin Steel Mirror Handle | MIR5/3 | MIR5/3 | EXD56 | EXD56 5 Front Surface Mouth Mirror, 3 pack | SC13/149E2 | SC13/149E2Infinity Series 5 Explorer, Satin Steel Handle | DP2 | DP2 | S13 | S13 EverEdge 2.0 13/14 Columbia | IM1005N | IM1005 University Curette 2 College Dressing Pliers 13 Suture Scissors A/W Syringe Tip Clip Signature Series A9

IMS COLLECTIONS Total Restorative — Composite, Crown & Bridge, Amalgam | IMNRESTOR | IMRESTOR Infinity Series Signature Series Large Infinity Series 16 Instrument | IMN4165 | IM4165 Cassette, Yellow | MH6 | MH6 Satin Steel Mirror Handle | MIR5/3 | MIR5/3 | XP23/126 | XP23/126 5 Front Surface Mouth Mirror, 3 pack | EXC186 | EXC186 23/CP-12 Color-Coded Expro, | GCP1136 | GCP1136 Satin Steel Handle | PICH6 | PICH6 18 Excavator, Satin Steel Handle | PLG0/16 | PLG0/16 113 Serrated Gingival Cord Packer, Satin Steel Handle | PLG1/26 | PLG1/26 | AC5202 | AC5202 Calcium Hydroxide Placement | CD3/66 | CD3/66 Instrument, Satin Steel Handle | CVWI86 | CVWI86 0/1 Marquette Condenser, | CVHL1/26 | CVHL1/26 Satin Steel Handle Infinity Series | TNCVIPC | TNCVIPC Signature Series 1/2 Blk Condenser, Satin Steel Handle | TNCIGFT2 | TNCIGFT2 Regular/Large CFII Amalgam Carrier | TNCIGFT3 | TNCIGFT3 3/6 Discoid-Cleoid Carver, Satin Steel Handle | BB27/296 | BB27/296 8 Wiland Carver, Satin Steel Handle | CS246 | CS246 1/2-3 Hollenback Carver, Satin Steel Handle | DP2 | DP2 IPC Interproximal XTS Carver | APF2 | APF2 2 Goldstein Flexi-Thin XTS® | S18 | S18 Composite Instrument | SYRCW | SYRCW 3 Goldstein Flexi-Thin XTS Composite Instrument | WA | WA 27/29 Burnisher, Satin Steel Handle | IMS-1372S | IMS-1372S 24 Spatula, Satin Steel Handle | IM1000 | IM1000 2 College Dressing Pliers | IM1005N | IM1005 Miller Articulating Paper Forceps Curved Iris Scissors CW Aspirating Anesthetic Syringe Amalgam Well Bur Cushion Short Lid, Holds 12 Hinged Instrument Clips, 2 A/W Syringe Tip Clip Cement (Crown Seat) | IMN5100 | IMCEMENT | IMNCEMENT Signature Series Infinity Series | IM5100 Small Infinity Series 10 Instrument Infinity Series Cassette, Red | MH6 | MH6 Satin Steel® Mirror Handle | MIR5/3 | MIR5/3 5 Front Surface Mouth Mirror, 3 pack | EXD56 | EXD56 5 Explorer, Satin Steel Handle | CVWI86 | CVWI86 8 Wiland Carver, Satin Steel Handle | CS246 | CS246 24 Spatula, Satin Steel Handle | APF2 | APF2 Miller Articulating Paper Forceps | SYRCW | SYRCW CW Aspirating Anesthetic Syringe | DP2 | DP2 2 College Dressing Pliers | IMS-1372SH | IMS-1372SH Bur Cusion Short Lid, Holds 6 | IM1005N | IM1005 A/W Syringe Tip Clip Signature SeriesA10

Crown and Bridge | IMN4169 | IMCROWN | IMNCROWN Signature Series Infinity Series | IM4169 Large Infinity Series 16 Instrument Cassette, Green | MH6 | MH6 Satin Steel® Mirror Handle | MIR5/3 | MIR5/3 5 Front Surface Mouth Mirror, 3 pack | EXD56 | EXD56 5 Explorer, Satin Steel Handle | PCP126 | PCP126 CP-12 Color-Coded Probe, Satin Steel Handle | CVWI86 | CVWI86 8 Wiland Carver, Satin Steel Handle | EXC186 | EXC186 18 Excavator, Satin Steel Handle | GCP1136 | GCP1136 113 Serrated Gingival Cord Packer, Satin Steel Handle | TNCIGFT2 | TNCIGFT2 2 Goldstein Flexi-Thin XTS® | CS246 | CS246 Composite Instrument 24 Spatula, Satin Steel Handle | DP2 | DP2 2 College Dressing Pliers Miller Articulating Paper Forceps | APF2 | APF2 CW Aspirating Anesthetic Syringe 18 Curved Iris Scissors | SYRCW | SYRCW Bur Cusion Short Lid, Holds 12 Hinge Instrument Clips, 2 | S18 | S18 A/W Syringe Tip Clip | IMS-1372S | IMS-1372SInfinity Series | IM1000 | IM1000 Signature Series | IM1005N | IM1005Infinity Series Signature Series Amalgam | IMNAMALGAM | IMAMALGAM Infinity Series Signature Series Large Infinity Series 16 | IMN4162 | IM4162 Instrument Cassette, White Satin Steel Mirror Handle | MH6 | MH6 5 Front Surface Mouth Mirror, 3 pack | MIR5/3 | MIR5/3 5 Explorer, Satin Steel Handle | EXD56 | EXD56 18 Excavator, Satin Steel Handle | EXC186 | EXC186 Calcium Hydroxide Placement | PICH6 | PICH6 Instrument, Satin Steel Handle Regular/Large CFII Amalgam Carrier | AC5202 | AC5202 0/1 Marquette Condenser, | PLG0/16 | PLG0/16 Satin Steel Handle 1/2 Black Condenser, Satin Steel Handle | PLG1/26 | PLG1/26 3/6 Discoid-Cleoid Carver, | CD3/66 | CD3/66 Satin Steel Handle 89/92 Discoid-Cleoid Carver, | CD89/926 | CD89/926 Satin Steel Handle 1/2-3 Hollenback Carver, | CVHL1/26 | CVHL1/26 Satin Steel Handle 21B Burnisher, Satin Steel Handle | BB21B6 | BB21B6 27/29 Burnisher, Satin Steel Handle | BB27/296 | BB27/296 2 College Dressing Pliers | DP2 | DP2 Miller Articulating Paper Forceps | APF2 | APF2 CW Aspirating Anesthetic Syringe | SYRCW | SYRCW Amalgam Well | WA | WA Bur Cushion Short Lid, holds 12 | IMS-1372S | IMS-1372S A/W Syringe Tip Clip | IM1005N | IM1005 A11

IMS COLLECTIONS Infinity Series Composite/Crown Prep | IMN4168 | IMCOMPOSIT Signature Series | IMNCMPOSIT Signature Series Infinity Series | MH6 | IM4168 | MIR5/3 Large Infinity Series 16-Instrument | EXD56 | MH6 Cassette, Blue | EXC186 | MIR5/3 Satin Steel Mirror Handle | GCP1136 | EXD56 5 Front Surface Mouth Mirror, 3 pack | EXC186 5 Explorer, Satin Steel Handle | TNCVIPC | GCP1136 18 Excavator, Satin Steel Handle | TNCIGFT2 113 Serrated Gingival Cord Packer, | TNCVIPC Satin Steel Handle | TNCIGFT3 | TNCIGFT2 IPC Interproximal XTS® Carver 2 Goldstein Flexi-Thin XTS | CS246 | TNCIGFT3 Composite Instrument | DP2 | APF2 | CS246 3 Goldstein Flexi-Thin XTS | SYRCW | DP2 Composite Instrument | S18 | APF2 24 Spatula, Satin Steel Handle | IMS-1372S | SYRCW 2 College Dressing Pliers | IM1000 | S18 Miller Articulating Paper Forceps | IM1005N | IMS-1372S CW Aspirating Anesthetic Syringe | IM1000 18 Curved Iris Scissors | IM1005 Bur Cushion Short Lid, holds 12 Hinge Instrument Clips, 2 A/W Syringe Tip Clip Infinity Series Endo | IMN4121 | IMENDO | IMNENDO Signature Series Infinity Series | MH6 | IM4121 | MIR4/3 Large Infinity Series 12-Instrument | EXDG166 | MH6 Cassette, Gray | EPL1 | MIR4/3 Satin Steel Mirror Handle | EPL1 | EXDG166 4 Front Surface Mouth Mirror, 3 pack | EXC31L6 | EPL1 DG16 Endo Explorer, Satin Steel Handle | RCSD11NT | EPL1 1 Locking Endo Pliers | RCP1/3 | EXC31L6 1 Locking Endo Pliers | RCP5/7 | RCSD11NT 31L Excavator, Satin Steel Handle | RCP9/11 | RCP1/3 D11 Nickel Titanium Endo Spreader | RCPGL1 | RCP5/7 1/3 Endo Plugger | APF2 | RCP9/11 5/7 Endo Plugger | SYRCW | RCPGL1 9/11 Endo Plugger | RDF | APF2 1 Glick Blade/Endo Plugger | RDCM1 | SYRCW Miller Articulating Paper Forceps | RDCM2 | RDF CW Aspirating Anesthetic Syringe | RDCM9 | RDCM1 Rubber Dam Forceps | RDCM26N | RDCM2 1 Satin Steel Rubber Dam Clamp | IMS-1275 | RDCM9 2 Satin Steel Rubber Dam Clamp | IMS-1372S | RDCM26N 9 Satin Steel Rubber Dam Clamp | IMS-1271 | IMS-1275 26N Satin Steel Rubber Dam Clamp | IMS-1372S Endo Stand, Holds 24 Files & Reamers | IMS-1271 Bur Cushion Short Lid, Holds 12 IMS Small Parts Box Signature SeriesA12

Ortho Banding/Bonding | IM5203-OR| IMORTHOBB | MH6 Double-Decker 20-Instrument Cassette | MIR5/3 Orthodontic Cassette, Orange | 678-912 Satin Steel Mirror Handle | CVHL1/26 5 Front Surface Mouth Mirror, 3 pack | DP18 LD1/BPS2 Ligature Band Pusher | 678-101L 1/2-3 Hollenback Carver, Satin Steel Handle | 678-107 #18 Dressing Pliers | 678-201L Universal Cut and Hold Distal End Cutter | 678-212 Micro-Mini Pin and Ligature Cutter | 678-330 Weingart Pliers Direct Bond and Bracket Holder Mathieu Pliers Available in Signature Series onlyOrtho Archwire Adjustment | IM5209-OR| IMORTHOAA | MH6 Double Decker 20-Instrument Cassette | MIR5/3 Orthodontic Cassette, Green | 678-905 Satin Steel Mirror Handle | 678-101L 5 Front Surface Mouth Mirror, 3 pack | 678-103 Ligature Director/Scaler | 678-107 Universal Cut and Hold Distal End Cutter | 678-201L 15º Hard Wire Cutter | 678-212 Micro-Mini Pin and Ligature Cutter | 678-304 Weingart Pliers | 678-302 Direct Bond and Bracket Holder | 678-330 Light Wire Bird Beak Pliers Three Jaw Pliers Mathieu Pliers Available in Signature Series only Additional IMS Signature Series® Collection cassettes are available, contact 1-800-Hu-Friedy for more information or visit www.Hu-Friedy.comIMS is a great tool to reduce the potential for sharps injuries during processing. A13

IMS SIGNATURE SERIES® CASSETTES Exam Cassette – 5 Instruments Exterior Dimensions 3\" x 8\" x 1.25\" (76 mm x 203 mm x 32 mm) Holds 5 instruments. Red | IM6050 Gray | IM6051 White | IM6052 Orange | IM6053 Yellow | IM6055 Lavender | IM6056 Blue | IM6058 Green | IM6059 Small Cassette – 8 and 10 Instruments Exterior Dimensions 5.5\" x 8\" x 1.25\" (140 mm x 203 mm x 32 mm) Holds 8 instruments with an accessory area. 8 10 Instrument Instrument Red | IM5080 | IM5100 Gray | IM5081 | IM5101 White | IM5082 | IM5102 Orange | IM5083 | IM5103 Yellow | IM5085 | IM5105 Lavender | IM5086 | IM5106 8 instrument cassette shown Blue | IM5088 | IM5108 above. Also available in 10 instrument cassette with Green | IM5089 | IM5109 no accessory area. Signa-Stat Cassette – 12 Instruments Exterior Dimensions 6.5\" x 10.5\" x 1.25\" (165 mm x 267 mm x 32 mm) Holds 12 instruments with an accessory area. Fits in SciCan® STATIM® or the Midmark M3 autoclave. Red | IM8120 Gray | IM8121 White | IM8122 Orange | IM8123 Yellow | IM8125 Lavender | IM8126 Blue | IM8128 Green | IM8129 SciCan and STATIM are registered trademarks of SciCan Ltd. Hu-Friedy cassettes can be modified to fit the unique needs of your practice. Call Hu-Friedy for more information.A14

Large Cassette–12, 16 and 20 Instruments Exterior Dimensions 8\" x 11\" x 1.25\" (203 mm x 280 mm x 32 mm) Holds 16 instruments with an accessory area. Also available in 8\" x 10.5\" x 1.25\" size (IM416xQ) to fit unique ultrasonic tanks. 12 16 20 Instrument Instrument Instrument Red | IM4120 | IM4160 | IM4200 Gray | IM4121 | IM4161 | IM4201 White | IM4122 | IM4162 | IM4202 Orange | IM4123 | IM4163 | IM4203 Yellow | IM4125 | IM4165 | IM4205 Lavender | IM4126 | IM4166 | IM4206 Blue | IM4128 | IM4168 | IM4208 Green | IM4129 | IM4169 | IM4209 Ultrasonic Insert/Handpiece Cassette Small: Exterior Dimensions 1.5\" x 8\" x 1.25\" (38 mm x 203 mm x 32 mm) Large: Exterior Dimensions 3\" x 8\" x 1.25\" (76 mm x 203 mm x 32 mm) Small Large Cassette CassetteSmall Ultrasonic Insert/Handpiece Cassette Red | IM30HU0 | IM60H0Large Ultrasonic Insert/Handpiece Cassette Gray | IM30HU1 | IM60H1 Double Symmetry IQ® Handpiece Cassette White | IM30HU2 | IM60H2 Orange | IM30HU3 | IM60H3 Yellow | IM30HU5 | IM60H5 Lavender | IM30HU6 | IM60H6 Blue | IM30HU8 | IM60H8 Green | IM30HU9 | IM60H9 Small holds 2 Ultrasonic Inserts or 1 handpiece. Large holds up to 3 high-speed handpieces or 5 ultrasonic inserts. Symmetry IQ® Handpiece Cassette | IM30IQ8 Small: Exterior Dimensions 1.5\" x 8\" x 1.25\" | IM60IQ8 (38 mm x 203 mm x 32 mm) Large: Exterior Dimensions 3\" x 8\" x 1.25\" (76 mm x 203 mm x 32 mm) Single Double (pictured) Symmetry IQ Wrench Cassette | IMIQ38 Exterior Dimensions 5.63\" x 1.95\" x 1.77\" (143 mm x 50 mm x 45 mm) Blue Wrench not included. A15

IMS SIGNATURE Oral Surgery Cassette SERIES® CASSETTES Exterior Dimensions 8\" x 14.5\" x 1.25\" (203 mm x 368 mm xA16 32 mm) Accommodates 12 instruments, 4 elevators, 3 hinged instruments in the lid and a separate accessory area. Has a built-in needle cap holder and slot for a winged syringe. Fits in most 10\" chambers or larger sterilizers, most instrument washers and larger ultrasonics. Red | IMOS0 Gray | IMOS1 White | IMOS2 Orange | IMOS3 Yellow | IMOS5 Lavender | IMOS6 Blue | IMOS8 Green | IMOS9 Double-Decker® Cassette – 8 Instruments Exterior Dimensions 3\" x 8\" x 1.5\" (76 mm x 203 mm x 38 mm) Holds 8 instruments. Red | IM9080 Gray | IM9081 White | IM9082 Orange | IM9083 Yellow | IM9085 Lavender | IM9086 Blue | IM9088 Green | IM9089 Double-Decker® Cassette – 14 Instruments Exterior Dimensions 4.5\" x 8\" x 1.5\" (114 mm x 203 mm x 38 mm) Holds 14 instruments. 14 Small Ortho Instrument Cassette Red | IM9140 | IM9140-OR Gray | IM9141 | IM9141-OR White | IM9142 | IM9142-OR Orange | IM9143 | IM9143-OR Yellow | IM9145 | IM9145-OR Lavender | IM9146 | IM9146-OR Blue | IM9148 | IM9148-OR Green | IM9149 | IM9149-OR Double-Decker® Cassette – 20 Instruments Exterior Dimensions 6\" x 9.7\" x 1.5\" (152 mm x 246 mm x 38 mm) Holds 20 instruments with an accessory area. Has a built-in needle cap holder and slot for a winged syringe. Red | IM9200 Gray | IM9201 White | IM9202 Orange | IM9203 Yellow | IM9205 Lavender | IM9206 Blue | IM9208 Green | IM9209

IMS SIGNATURE SERIES® CASSETTES Large Thin Orthodontic Cassette Exterior Dimensions 8\" x 11\" x 0.75\" (203mm x 280mm x 19mm) Holds up to 7 pliers and 4 hand instruments. Blue | IMORTHLG8 Small Thin Orthodontic Cassette Exterior Dimensions 7\" x 8\" x 0.75\" (178mm x 203mm x 19mm) Holds up to 4 pliers and 3 hand instruments. Holds up to 7 pliers and 4 hand instruments. Blue | IMORTHSM8Large Thin Orthodontic Cassette Small Thin Orthodontic Cassette Double-Decker® Small Orthodontic Cassette Exterior Dimensions 4.5\" x 8\" x 1.5\" (114mm x 203mm x 38mm) Holds up to 3 pliers, 1 Mathieu needle holder and 2 hand instruments. Red | IM9140-OR Gray | IM9141-OR White | IM9142-OR Orange | IM9143-OR Yellow | IM9145-OR Purple | IM9146-OR Blue | IM9148-OR Green | IM9149-OR Double-Decker® Large Orthodontic Cassette Exterior Dimensions 6\" x 8\" x 1.5\" (152mm x 203mm x 38mm) Holds up to 6 pliers, 1 Mathieu needle holder and 3 hand instruments without accessory area. Red | IM5200-OR Gray | IM5201-OR White | IM5202-OR Orange | IM5203-OR Yellow | IM5205-OR Purple | IM5206-OR Blue | IM5208-OR Green | IM5209-OR *Double-Decker Large Ortho Cassette with Accessory Area – IM920x-OR **Shown with optional instrument rack. Part code IM520x-ORA A17

IMS RESIN CASSETTES Hu-Friedy Resin Cassettes are constructed of high-grade medical resin. Soft silicone instrument rails gently hold instruments in place. Cools down quickly after sterilization and are lightweight. Small Resin 7 Instruments | IMS-3107 Holds up to 7 instruments. The cassette is perfect for exam and prophylactic procedures. Small Resin 12 Instruments | IMS-3112 Holds up to 12 instruments Small Resin 16 Instruments | IMS-3116 Holds up to 16 instruments in a compact space (pictured) Large Resin 18 Instruments | IMS-1118 Holds up to 18 instruments (pictured) | IMS-1124 Large Resin 24 Instruments Holds up to 24 instruments Large Resin 12 Instruments | IMS-1112 Holds up to 12 instruments (pictured) | IMS-1116 Large Resin 16 Instruments Holds up to 16 instrumentsA18 BLEACH CLEANING RECOMMENDATIONS FOR RESIN CASSETTES The resin cassettes should be bleach cleaned on a six month basis. They may be submerged in a solution of two cups bleach to one gallon of water (0.5 liters bleach to 4 liters of water) for 5 to 30 minutes. If staining has occurred, use less water and more bleach. If bleach does not break through the stain, wipe cassettes with isopropyl alcohol prior to bleaching. Be sure to remove instruments before placing cassettes in bleach solution as bleach is destructive to metal. This cleaning procedure is only recommended with resin cassettes. If staining does occur on stainless steel cassettes, wipe clean with soap and water. DO NOT use bleach process described for resin cassettes on stainless steel cassettes.

SIGNATURE SERIES™ TUBSTogether, procedure tubs and cassettes create the most efficient and organized system for managing instrumentsand consumable products. The time savings achieved by using IMS (Instrument Management System) cassettesand procedure tubs will allow the staff to spend time on more value added activities in the dental office.Signature Series Tubs are designed to match IMS cassette rail colors and feature antimicrobial product protection.* Signature Series™ Complete Tub 12-3⁄4\" x 11-3⁄16\" x 4\" Includes: Red | IMS-1400 | IMS-1401 • Signature Series Tub Gray | IMS-1402 | IMS-1403 • Tub Liner† White | IMS-1404 | IMS-1405 • Tub Divider (package of 8) Orange | IMS-1406 | IMS-1407 • Single Tub Cup w/Cover† Purple | IMS-1408 | IMS-1409 • Double Tub Cup w/Cover† Yellow | IMS-14011 • Divided Slide Tray† Lavender • Locking Tub Cover† Black Blue Green Ocean BlueSignature Series Tub Divided Slide Tray†12-1⁄4\" x 10-7⁄8\" x 2-3⁄4\" 9-3⁄4\" x 5-3⁄8\" x 1 1⁄16\"Red | IMS-1410 Stores cotton rolls, cotton squares, clampsGray | IMS-1411 | IMS-1421White | IMS-1412Orange | IMS-1413Purple | IMS-1414Yellow | IMS-1415Lavender | IMS-1416 Flat Slide Tray† 9-3⁄4\" x 5-3⁄16\" x 1- 3⁄8\"Black | IMS-1417 Can be used to store discs,Blue | IMS-1418 strips, toffelmeil, articulating paper, etc.Green | IMS-1419 | IMS-1422Ocean Blue | IMS-14111Locking Tub Cover† Tub Dividers Dividers12-3⁄4\" x 11-3⁄16\" x 2-3⁄4\" Tub Liner 12-3⁄4\" x 11-3⁄16\" x 1-3⁄8\"Protects items from | IMS-1427airborne materials duringtransportation and storage Includes 8 dividers | IMS-1420 Tub Liner† 9-5⁄8\" x 8-7⁄8\" x 1⁄8\"Tub Insert9-3⁄4\" x 10-3⁄4\" x 1 1⁄32\" | IMS-1428The insert features 10 Non-slip liner prevents smallcompartments for easy items from slipping under dividerorganization of tub materials sectionsSits on rim of tub allowing forstorage underneath | IMS-1423 †Clear components and tub liner do not contain antimicrobial product projection A19

SIGNATURE SERIES TUBS SIGNATURE SERIES TUB CUPS & COVERS SIGNATURE SERIES CLIP-ON HOLDERS Signature Series Tub cups and covers can be used to store brushes, Capsule Clip-On Holder clamps, cotton pellets, syringe tips, prophy paste, prophy angle tips, pumice, implant tools, etc. Syringe Clip-On Holder Capsule Clip-on Holder 2-1⁄4\" x 1-5⁄8\" x 1-1⁄8\" | IMS-1424 8\" x 2-1⁄2\" x 3⁄4\" | IMS-1429 | IMS-1425 Double Tub Cup with Cover† | IMS-1426 • Allows quick access to composite material during procedure 3-3⁄8\" x 2-1⁄4\" x 1-1⁄8\" • Conveniently clips on any side of tub • Holds up to 8 capsules, 4 syringe tubes and capsule/gun dispenser Long Tub Cup with Cover† 8-1⁄3\" x 2-1⁄4\" x 1-1⁄8\" Syringe Clip-on Holder • Provides 5 storage compartments 8\" x 2-5⁄8\" x 3⁄4\" | IMS-1430 • Dividers are removable for customization • Perfect for storing capsules, discs, abrasive strips, • Allows quick access to composite material during procedure • Conveniently clips on any side of tub wedges, matrix bands, etc. • Holds up to 15 syringe tubes and 3 applicator tips SIGNATURE SERIES RACKS SIGNATURE SERIES SYRINGE STANDS 18-3⁄4\" 13\" 10-1⁄2\" 10-1⁄2\" 20-Unit Syringe Stand | IMS-1431 9\" x 4-3⁄4\" x 2 1⁄2\" | IMS-1432 Minimum 7-1/2\" – Maximum 15-1/2\" Minimum 7-1/2\" – Maximum 15-1/2\" • Stands up for easy access to syringes Adjustable 3 Tub Rack Adjustable 4 Tub Rack • Lays flat to fit inside a tub or drawer • Holds up to 20 syringe tubes Adjustable 3 Tub Rack 10-Unit Syringe Add On MIN 7-1⁄2\" – MAX 15-1⁄2\" x 10-1⁄2\" x 13\" | IMS-1433 8-1⁄2\" x 2-3⁄8\" x 3⁄4\" • Fits most standard storage • Non-slip feet • An add-on for the Syringe 20 Unit Stand cabinets • Provides additional space for syringe storage • Sturdy metal construction • Holds up to 10 syringe tubes • Holds a maximum of 3 tubs with lids or 6 cassettes • No screws, tools, nuts or bolts needed Adjustable 4 Tub Rack MIN 7-1⁄2\" – MAX 15-1⁄2\" x 10-1⁄2\" x 18-3⁄4\" | IMS-1434 ANTIMICROBIAL PROTECTION • Holds a maximum of 4 tubs • Non-slip feet *Antimicrobial protection is integrated into the tub and tub components with lids or 8 cassettes during the manufacturing process. This technology works by interrupting key cell functions that allow the microorganisms to function, grow • Sturdy metal construction and reproduce. Antimicrobial protection begins to work as soon as the microorganism comes into contact with the product surface and worksA20 continuously to inhibit the growth of microbes that can cause stain, odors and product degradation – for the lifetime of the product.

ORGANIZATION PRODUCTSIMS COLOR CODE INSTRUMENT RINGS Assorted Colors Regular Large Gray Use on #2 and 4 Handles Use on #6, 7, 8 and 9 HandlesIMS Color Code Instrument Rings are silicone rubber rings used for identifying and White | IMS-1280 | IMS-1280Lorganizing instruments. Useful for maintaining proper instrument order in cassettes and Orange | IMS-1281 | IMS-1281Lidentifying instruments by procedure; can withstand all heat sterilization methods. Brown | IMS-1282 | IMS-1282L Yellow | IMS-1283 | IMS-1283L Red | IMS-1284 | IMS-1284L Green | IMS-1285 | IMS-1285L Blue | IMS-1286 | IMS-1286L Black | IMS-1287 | IMS-1287L Pink | IMS-1288 | IMS-1288L Lavender | IMS-1289 | IMS-1289L Ocean Blue | IMS-12810 | IMS-12810L Purple | IMS-12811 | IMS-12811L | IMS-12812 | IMS-12812L | IMS-12813 | IMS-12813L All single color packages contain 50 pieces. The assorted color package contains 90 pieces.SIGNATURE SERIESTM GRIPS RESIN 8 COLORS GRIPSSignature Series grips can only be used with Satin Steel Colours®, EverEdge® technology and ResinEight® instruments, Red | SSGRED8and are used for identifying and organizing instruments. They’re useful for maintaining proper instrument order in Orange | SSGORANGE8cassettes and identifying instruments by procedure. Grips will withstand all approved heat sterilization methods Yellow | SSGYELLOW8 Purple | SSGPURPLE8 Gray | SSG1 Blue | SSG8 Lavender | SSGLAVNDR8 White | SSG2 Black | SSG9 Green | SSGGREEN8 Orange | SSG3 Pink | SSG10 Blue | SSGBLUE8 Brown | SSG4 Lavender | SSG11 Gray | SSGGRAY8 Yellow | SSG5 Ocean Blue | SSG12 Red | SSG6 16 Assorted | SSG0 All single color packages contain 16 pieces. Green | SSG7 80 Assorted | SGMULTIAll single color packages contain 16 pieces. The assorted color packages contain your choice of either 16 or 80 pieces.IMS COLOR TABS Red | IMS-1290N IMS CASSETTE I.D. LABELS Gray | IMS-1291N AND I.D. MARKERSilicone tabs that fit on cassette lid for White | IMS-1292Nidentifying cassette procedure by color. Orange | IMS-1293N Specially designed polyester pressure- IMS Cassette | IMS-1234 Purple | IMS-1294N sensitive labels for cassette identification. I.D. LabelsAll single color packages contain 5 Yellow | IMS-1295Npieces. The assorted color package Lavender | IMS-1296N 50 per packagecontains 11 pieces (Red, Gray, White, Black | IMS-1297NOrange, Purple, Yellow, Lavender, Blue | IMS-1298N IMS I.D. | IMS-1235Black, Blue, Green, and Ocean Blue). Green | IMS-1299N Marker Pink | IMS-12910N Ocean Blue | IMS-12911N Permanent indelible ink marker Assorted | IMS-12912N is ideal for identifying procedural set-ups. For use on I.D. Labels or Monitor Tape. A21

CLEANING & CARE PRODUCTS SHINE RENEW PRODUCTS Shine reNEW™ Products Effectively remove stain and rust, restoring the luster to stainless steel and tungsten carbide instruments. Liquid, 1 Gallon (3.8 liters) | IMS-1453 Instrument Wipes (20 wipe canister) | IMS-1455 • Keeps hinged instruments • Quick and simple to use moving freely by dissolving • Shine reNEW Instrument Wipes built-up residue can also be used on copper, • Eliminates the need for brass and anodized aluminum abrasive scrubs IMS® DAILY CLEAN GENERAL PURPOSE DETERGENT IMS® Daily Clean General Purpose Detergent Concentrated powder detergent specifically formulated for efficient ultrasonic cleaning or presoaking of cassettes and instruments. 1.1 lb (500 g) | IMS-1220 Makes 35 Gallons (132 liters) 5 lb (2.27 kg) | IMS-1218 Makes 160 Gallons (606 liters) INSTRUMENT LUBRICANTS Instrument Lubricants The instrument lubricants come in a convenient non-aerosol pump bottle. Penetrating Oil 8 oz (236 ml) | IPS Removes light rust and corrosion to loosen problem joints Instrument Lubricant Spray 8 oz (236 ml) | ILS Keeps hinged instruments moving freely Instrument Lubricant Spray (ILS) and Penetrating Oil (IPS) do not contain silicone.A22

Enzymax® Dual Enzyme Ultrasonic Detergent is specifically formulated for efficient ultrasonic cleaning and pre-soaking ofcassettes and instruments. Contains Steelgard™ agents to extend instrument life and chelating agents to protect instrumentsfrom harmful minerals naturally found in water that contribute to buildup, spotting and corrosion. Multi-purposeapplications including ultrasonic detergent, presoak, linen presoak and evacuation cleaner.ENZYMAX Enzymax Liquid | IMS-1222 | IMS-1222C Box of 40 Liquid Packets | IMS-1224 Makes 40 Gallons (151 liters) | IMS-1224C | IMS-1224P 10 boxes of 40 Liquid Packets | IMS-1226 Makes 400 Gallons (1,510 liters) | IMS-1226P Quart Bottle Makes 32 Gallons (121 liters) Case of 12 Quart bottles Makes 384 Gallons (1,452 liters) Quart Pump Gallon Bottle Makes 128 Gallons (485 liters) Gallon Pump Enzymax Powder | IMS-1230 | IMS-1230C 1.76 lb (800 g) Powder Makes 50 Gallons (189 liters) 6 containers of 1.76 lb (800 g) Powder Makes 300 Gallons (1,134 liters) Enzymax Pax® Single Use Packets | IMS-1232 | IMS-1233 32 Dissolvable Single-Use Powder Packets Makes 32 Gallons (121 liters) 96 Dissolvable Single-Use Powder Packets Makes 96 Gallons (363 liters) Enzymax Spray Gel Dual enzyme gel with corrosion inhibitor acts as a ready-to-use instrument pre-cleaner. Maintains moisture to help prevent debris from drying on instruments before cleaning and helps dissolve blood, tissue, and other debris. Can also be used as a linen spot remover. 24 Fl oz (709 ml) | IMS-1229 450 SpraysHu-Friedy strongly recommends Enzymax with our instruments A23to maintain instrument longevity, integrity and appearance.

CLEANING & CARE PRODUCTS Enzymax Earth™ Dual Enzyme Ultrasonic Detergent offers the same superior cleaning attributes as Enzymax with an increased awareness of our environment. All Enzymax Earth products are biodegradable* and phosphate free.ENZYMAX EARTH Gallon Bottle | IMS-1336 Makes 128 Gallons (485 liters) Enzymax Earth Pax Single Use Packets 32 Dissolvable Single-Use Powder Packets | IMS-1332 Makes 32 Gallons (121 liters) 96 Dissolvable Single-Use Powder Packets | IMS-1333 Makes 96 Gallons (363 liters)LILAC UTILITY GLOVES Small (Size 7) | 40-060 Medium (Size 8) | 40-062 Large (Size 9) | 40-064 Extra Large (Size 10) | 40-066 USE THIS CHART *Biodegradable formula according to the Organization for Economic Cooperation and Development (OECD) testing. TO DETERMINE YOUR APPROPRIATE 7 8 9 10 GLOVE SIZE Place hand as indicated to X-LARGE select correct size in order LARGE to avoid hand fatigue. MEDIUMA24 SMALL

CLEANING MONITORSProper instrument cleaning is the most important step to instrument reprocessing.If an instrument is not properly cleaned, it cannot be effectively sterilized. Takethe steps to assure that your cleaning process achieves the highest quality resultsby incorporating Hu-Friedy Cleaning Monitors into your instrument reprocessingprotocols. Using multi-parameter testing, Hu-Friedy Cleaning Monitors are designedto give you a clear interpretation of your cleaning process. Colored test soil on strip is designed to parallel the removal of blood and bioburden from an instrument surfaceCleaning Monitor Holder acts asa hinged instrument measuringimpingement in washer-disinfectors Reusable stainless steel holder secures monitor in place in order to provide accurate resultIdeal Cleaning Monitor UsageWASHER-DISINFECTOR ULTRASONIC CLEANINGRun a monitor test in the morning Monitor once daily with an emptyto release the equipment for use load for a machine release andand minimum of one monitor per periodically throughout theload for load release. day with instruments for a load release, if needed. A25

CLEANING & CARE PRODUCTS Clear & Simple Results Interpretation Removal of all test soil indicates effective cleaning Washer-Disinfector Ultrasonic Fail Washer-Disinfector Cleaning Monitor, 50 PCS | IMS-1200W (Unexposed) Fail Ultrasonic Cleaning Monitor, 50 PCS | IMS-1200U Pass See Troubleshooting Charts (N1736 and N1692) for possible reasons for results Cleaning Monitor Holder, 1 EA and corrective actions. | IMS-1200H Parameters Tested & Common Failures Parameters tested Washer-Disinfector Ultrasonic by the cleaning monitors • Time • Cavitation Common • Temperature • Time Cleaning Process • Detergent concentration • Temperature • Spray arm function • Detergent Failures • Enzyme soak • Ineffective cavitation • Inadequate water spray/impingement • Overloading • Clogged spray arms • Insufficient time, temperature • Overloading • Instrument shadowing and/or detergent • Inadequate detergent dosing • Improper detergent dosingA26

Team Vista™ Dental Unit Waterline Cleaner provides a more effective and DENTAL UNITeconomical way to keep waterlines safer and cleaner. This easy-to-use WATERLINE PRODUCTSsystem provides both an organic irrigant and registered antimicrobialcleaner for enhanced patient care and equipment protection.TEAM VISTA DENTAL UNIT WATERLINE CLEANER Team Vista™ Dental Unit Waterline Cleaner | IMS-1450 CONTAINS: 1 - One Fl oz bottle of VistaClean Irrigant Solution 15 - VistaTab Cleaner Tablets • For use in independent water • Non-corrosive – gentle and safe bottle systems on equipment • Provides continuous cleaning of waterlines • One year supply per operatory for up to one week VistaTab™ Dental Waterline Cleaner Tablet CONTAINS: | IMS-1451 15 – VistaTab Cleaner Tablets • Antimicrobial tablet used periodically • EPA registered antimicrobial for the cleaning and control of in all 50 states microbial contaminants • Quickly dissolves to create a non-corrosive dif- sthoaluFefnertoroibreotnlreneotxpaashccmeoshvputlheneatn,rtymtmiamwanyiyellbspeeompoftrpoeelnrseeewnretehafionfcetttrchatatvoitevwltehtaoeteard.cifiTfteyhrieisnnitsa het- true even though that city also treats its water with chlorine. It’s simply a matter of what one is used to. They may experience several days of diarrhea and/or stomach upset until their immune system responds to bring them back to normal. VistaPCroletoaznoa™nIsrfroigunadnitnSwoatluertisoupnpClieosn. centrate CONATlAthIoNugSh:there are many protozoans found in drinking | IMS-1452 1 – OwgnaaeitneeFrdlacnoedrztdaiebnnotnaotl ttwolreaiteetorylfionvVees,irstthhteearepCaalserte2as0nevyeeIrraarrlsi.tghGaatinahrtadviSaeolution lamblia is a single-celled microscopic parasite that lives • Deririnhveetahdledfiirnsoteemassteinokerngooafwnpneicoapscliegtiraaunrddsiaabsnoiismt.aanlGsiicaaanrddlsiacahuassesbaecdoimare- • Safe for use with patients • Listoheundme woafnistthhientmthhoeestFUcDnoAimteadmsSoantatcCeasluasasenssdoIafMroweuandtdeicrtbaholerDnweeodvrilisdce.easSeevin- • No odor or taste • Heleprsalpcroomtemcutnwitya-tweirdleinoeustbarenadkseoqfugipiamrdeiansits have been • Non-toxic, non-corrosive fromclionndkteeadmptoionsadittersidnakwinnidgthsmGcuainaliercdipiaa.l water or recreational water No eFfrfiefgeeu-cfrlteoao1t.ninCgblooearngndadnseistnmrtaeslnpwgraettsheernlitn. e tubing. No biofilms or The parasite is found in • • Wordkrisnktoingemanudlsriefycreoartgioannalicwaantedrsinaondrgiasnpicassed in the • Ava_il_a_b_l_e_i_n__t_h_e__U_.S__. _a_n_d__C_a_n__a_d_a__________________ consattnaoomoluitonefraansnhtesilnltfhethcaatett dbalpuloeirwldsos unitpotroinasnwuirmaviatvel.erloIitnu’tsesispdreottehcetebdobdyy and in the environment for long periods of time. It’s step process involving attachment, colonization and extremely difficult to kill with chlorination and other growth. Creating suitable conditions for biofilm devel- opment actually begins the instant water enters the den- methods due to its ability to enter an encysted state. tal tubing. Common organic particles from the water are Cryptosporidiosis is a diarrheal disease caused by the adsorbed onto the inner surface of the tubing forming a microscopic parasite Cryptosporidium parvum. It can conditioning layer.WATER SAFETY REQUIREMENTS live in the intestine of humans and animals and is passed For example, many people who travel to a city in ainditfh-e stool of an infected person or animal. Like (CDfeCer)oretrnreotpchcoosmuthnmatrtyemnwadyisllbetohpfatreetnsednretenaincttathltaout nwtihatetewrd.aiftTfeehrrielsninitsGiethtisrtaeourtbe-dseiuar,viitvteooouitssipdreottehcetebdobdyy an outer shell that allowsThe Centers of Disease Control for long periods of timetested on a regular basis to maintaIeitvn’esnistitsmhoepulsygthaatbhmlaiatstthceiertydoafslswtoahatnrtedaoatnsreditissowufsaleteedsr tswo.tithhTachnhely5oasornm0indn0aseym. wakitehs it very resistant to chlorine disinfection. Per- weakened immune systems are at risk forcolony-forming units per milliliter.*uexnptielritehnecire several days of diarrhea and/or stomach muposreet serious disease. Symptoms may be severe and immune system responds to bring themcboauclkd lead to serious or life-threatening illness. Exam-If dental unit waterlines are not matoinntoarminael.d on a regular basis, bacteria wiltplhldoesesevofewlpoiethprsoHnIsVw/AitIhDwSe, ackaennceedr immune systems include and transplant patientson the inner surfaces of the tubingP, brolotcokzsoaannsdfootuhnedr sinyswteamtecrosmuppopnliens.ts. who are taking certain immunosuppressive drugs, and those with inherited diseases that affect the immune sys-Sbainemdgpinmlytaomincatreiennataatneincmein.igcOrtvoheberiatwilmadteee,prbloiansciettsse.ilAwgirnasUaialmaittstnnhhebieocoernlduiataiaggncnnehteidaesnrosttdaahodtviieenuasennrieeigrntnlawogyholafltr;hewioep-rierctaerimelteoiemilgtpaslryelnlaeidaoytnnhvaemttpnese,wr,ridcolwttoirtahhkooneaeeszpircotmepaoeVaaarpnarsiltirsstlsceit2pnafpaso0nreaeCudorvynaelceecedsnraaeiaartuviselsnns.istetr,hhdsoGoaaarantitfinn1tUtsamehdlhpkdc9rinmeiavoid9lainevecerid.t3rgaeeisn-lae.ddeaTtnitauOhhiaSmnnesvntigaeolndrtarfeegrssa4gut0ellso0teitc,na0cogs0uut0rti5rbne0prdeetphareskeioonpnohlsfoeMs.wwpiliaewttraeealriubziknaoetfrieenoc,entedWdoifsibes4cay,os0eCn0sri0inynpattnhoidne-*tatohRneedpfwrecoroatetnenetccrrteloipnlCaemetsniiectrerneortgsbsu,filaosalrtraclDyofifsnweatiaantshmdeaieCnnqoauEnniPttprlcohsdresAimhotrornunoaietnlmekanolaeotaekllopaacndinmfnpoodpntsdtmftigri.rhosnoioaeemPnaandavvtmrnusetrieehiiendddonnevdiskekfterweytUineacnn-icoicntwmgtnotrewhiemitidtmoedpnaiGdmmtenpruiaoeionS.oosairninvtGcusrcagaodteriutclibpenioaadiarsarwdueb.odlsaaweairiwenkaatlaseaTidssalnrni,tothssoaeeiefel.mrfrisroawkoagpnGuefqalriadno.iatruaderVrraeridraIsstbcidtIiihs’lrnaotiiseeepatstrfaianaeypwsthisTericssaooohwadtesrntafibdilehoaovsdbc,lueei.netilawenwbuIHwncebstSddoCin’eaioeiesomdtlhotbhetflvieieeiwhennynneer-lcrsmslttlptibredasmoinainewlaodnngth.fetiidTclaFf_mhthrl_hieegm_aewsutc_-afrr_a9alkeeo_9netaa_%1estdtifFt_.iroltun_iohonlgCogb_iefauol_ntmiobetnhf_rearai_eggnnevcsb_at.geri1den_borN.reyi_ofcisCenoi_amorlitcl_mmagiebnso_nlasapi_ptmwononnia_rsaafre_imeitttsdsb_auleemmaen_rrfnilset_onnitissn._ctautaoea_gpoalln_gtsrlrleu_yrtetwduebf_ssrgdi_ma.neeay_tgtune_ee.al-_ttnrai.N_ld-si_on_eb_i_o_f_il_m_F_ins__itg__oeur_rir_oe_Fiwrn_is2ag_tu.et_ruefr_raCri_ecolo_eirn2n_wt_.seai_Cumtt_hroui_nfan_baabt_itcuaen_endm_gd_w.dai_nBnei_tntai_hotfta_rfeela_iedl_bwm-_fudal_otnoe_eadrn_ntli_aitnn_ange_lt.o_r_gB_a_ino_if_silm_m_s_.o_n an outer shell that allows it to survive outside the body step process involving attachment, colonization and free-floating organisms.in Dental Health-Care Settings – 2003a.nMd MinWtRhe2e0n0v3ir;o5nm2 e(nNtof.oRr Rlo-1n7g):p[eprigo.d3s 1o].f time. It’s extremely difficult to kill with chlorination and other growth. Creating suitable conditions for biofilm devel-Team Vista, VistaTab and VistaClean are trmadetehmodasrkdsueoftoViiststaabRielistyeatorcehnGterroaunpeLnLcCy.sted state. opment actually begins the instant water enters the den- A27 tal tubing. Common organic particles from the water are Cryptosporidiosis is a diarrheal disease caused by the adsorbed onto the inner surface of the tubing forming a microscopic parasite Cryptosporidium parvum. It can conditioning layer.

STERILIZATION PRODUCTS IMS CASSETTE WRAP 24\" x 24\" (610 mm x 610 mm) | IMS-1210 For Large Cassettes, 500 Sheets | IMS-1212 IMS Cassette Wrap is engineered to withstand the harsh conditions of sterilization. | IMS-1211 Our unique compilation of textiles is designed to be strong and soft for easy 20\" x 20\" (508 mm x 508 mm) | IMS-1213 wrapping and durability. This low-lint, memory free wrap is available in two grades For Large Cassettes, 500 Sheets to meet your needs. Manufactured for single use only. 15\" x 15\" (380 mm x 380 mm) For Small Cassettes, 1,000 Sheets 12\" x 12\" (305 mm x 305 mm) For Small Cassettes, 1,000 Sheets 24\" x 24\" (610 mm x 610 mm) | IMS-1214 For Large Cassettes, 500 Sheets | IMS-1216 | IMS-1215 20\" x 20\" (508 mm x 508 mm) | IMS-1217 For Large Cassettes, 500 Sheets 15\" x 15\" (380 mm x 380 mm) For Small Cassettes, 1,000 Sheets 12\" x 12\" (305 mm x 305 mm) For Small Cassettes, 1,000 Sheets Note: Hu-Friedy wrap is also available in packs of 100 sheets. Add “H” to the end of the part code. WRAPPING TECHNIQUES WRAP SIZE RECOMMENDATIONS Method 1: Standard Gift IMS Cassettes 12\" x 12\" 15\" x 15\" Method 2: Hospital style 20\" x 20\" 24\" x 24\" Exam, Double-Decker® 8-Instrument, Ultrasonic Insert, • • Symmetry IQ & Handpiece Cassette Space Saver Seven™ Cassette •• Double-Decker 14-Instrument Cassette  •• Small 8- or 10-Instrument Cassette  •• Signa-Stat or Double-Decker 20-Instrument Cassette • Large 16- or 20-Instrument Cassette Large 12- or 20-Instrument Cassette • Oral Surgery Cassette • Orthodontic Cassette Box • Large Thin Orthodontic Cassette • Small Thin Orthodontic Cassette • Double-Decker Large Ortho Cassette •  The Double-Decker 14-instrument cassette and Small cassettes are best with the 15\" x 15\" sterilization wrap. However, if an office is trying to purchase only one size, the 20\" x 20\" size is recommended.A28

IMS® TAPEIMS Monitor TapeStrong 3⁄4\" (19 mm) tape can be written on and visually differentiates processed from non-processed cassettes.Pre-printed tape is available with specific procedural set-ups, color-coded or blank. 60 yards (55 m) per rollPROCEDURE | IMS-1243 Exam | IMS-1256 IMS Tape DispensersOrtho | IMS-1244 Extraction | IMS-1257Archwire | IMS-1245 Perio | IMS-1258 Rubber suction cups on the base secure dispenser to tableBanding | IMS-1246 Prophy | IMS-1259 or counter. Dispenser can also be mounted under cabinet.Bonding | IMS-1247 Pedo | IMS-1260Restorative | IMS-1248 Gray | IMS-1262 IMS Tape Dispenser | IMS-1270Surgery | IMS-1249 Orange | IMS-1263X-Ray | IMS-1250 Purple | IMS-1264 10.75\" x 6.25\" x 7.6\"Blank | IMS-1251 Yellow | IMS-1265 (273 mm x 159 mm x 194 mm)Amalgam | IMS-1252 Red | IMS-1266C&B | IMS-1253 Green | IMS-1267 Holds up to 9 rolls of IMS Monitor TapeCement | IMS-1254 Blue | IMS-1268Composite | IMS-1255 Black | IMS-1269EndoIMS Lead and Latex Free Monitor Tape* IMS Mini Tape Dispenser | IMS-1270HSafe for the environment, your staff and patients. Not made with 4.4\" x 6.25\" x 7.6\"lead or natural rubber latex. Does not require special hazardous (111 mm x 159 mm x 194 mm)disposal. Easy to use and read results. For steam autoclaves.60 yards (55 m) per roll. Holds up to 4 rolls of IMS Monitor Tape.75\" (19 mm) | IMS-1460BAGETTE® SELF-SEALING STERILIZATION POUCHESBagette® Self-Sealing Sterilization Pouches are constructed with durable materials and thick seals. Built-in external and internal qualitycontrol indicators relay accurate time and temperature verification, allowing you peace of mind. The full line of pouches include thosecustom fit especially for our cassettes and smaller sizes for all other sterilization needs. Size QTY Suitable Contents Part Code 2-1/4” x 4” 200 2-3/4” x 9” 200 Rubber Dam Clamps or Burs | IMS-1346 3-1/2” x 9” 200 5-1/4” x 10” 200 1 Handpiece or 1-3 Hand Instruments | IMS-1347 7-1/2” x 13” 100 2-5 Hand Instruments | IMS-1236 10” x 14” 100 Handpiece or Multiple Instruments | IMS-1348 12” x 17” 100 | IMS-1237 13” x 20” 100 Exam Cassette†, Double-Decker | IMS-1238 8 Instrument | IMS-1239 Small Cassette† , Double Decker | IMS-1345 14 Instrument, Small Thin Ortho Large Cassette†, Double Decker 20 Instrument, Large Thin Ortho Oral Surgery Cassette† *Not made with natural rubber latex † Please see Hu-Friedy.com for complete list of suitable cassettes for this pouch. A29

STERILIZATION PRODUCTS IMS STEAM STERILIZATION MONITORS IMS Steam Sterilization Indicators IMS Steam Indicator strip verifies that steam sterilization parameters of Sterilization time and temperature have been met. Use one in each cassette or pouch and retain for office records. Indicators 250 per box | IMS-1240 IMS Steam IMS Steam Sterilization Integrators Sterilization Integrators Sterilization Integrators are a Type 5, multi-variable, sterilization monitor designed to react to all critical variables in the sterilization cycle: time, temperature and presence of steam. The integrators utilize a moving front indicator technology, which is an advancing color bar moving from reject to accept, eliminating the need to interpret or match colors. 100 per pouch | IMS-1241 SPORECHECK The SporeCheck 24 Hour In-Office Test® biological monitoring system provides reliable results in 24 hours, while being in compliance with local, state and federal guidelines. The SporeCheck system can be used with all types of steam sterilizers — including gravity, pre-vacuum and flash sterilizers. SporeCheck Starter Kit | IMS-1376 Contains: Dry Block Incubator with built-in vial crusher, record notebook and 1 box | IMS-1373 SporeCheck Biological Indicators, 25 count | IMS-1373H | IMS-1374 SporeCheck Biological Indicator Vials, | IMS-1375 25 count | IMS-1377 SporeCheck Biological Indicator Vials, 100 count (pictured at left) 55–60° Dry Block Incubator Sterilizer Record Notebook Replacement Vial CrusherA30 The Center for Disease Control (CDC) recommends that an internal chemical indicator is placed in every package to be processed.* *Reference: Centers for Disease Control and Prevention. Guidelines for Infection Control in Dental Health-Care Settings — 2003. MMWR 2003; 52 (No. RR-17): [pg. 24].

STERILIZATION CONTAINER SYSTEMHu-Friedy’s Sterilization Containers are a reusable, rigid system used for the packaging of cassettes and instruments duringsterilization. An alternative to the wrap and pouch materials commonly used to package cassettes and instruments, SterilizationContainers provide significant economic and environmental benefits along with enhanced safety. The filter retention plates audibly click to lock into place providing easy filter changes Two external display windowsprovide space for a process indicator card and container identificationTamper evident seals on latches provide Lid and bottom are made of anodized aluminum visual evidence of sterility breach making them lightweight with excellent drying Latches on the lid act as handles for properties. The aluminum alloy with an anodized easy, contamination free lid removal oxide surface helps resist corrosion.Container Cassette A31for 12 InstrumentsBlue | IMECC128268 x 176 x 34 mm10-1/2” x 7” x 1-1/3”Fits all sterilization containersContainer Cassette with handle on lid and filter outlets.Fits 12 instruments, with an accessory area.

STERILIZATION PRODUCTS | IMDINC00M | IMDINC01M STERILIZATION CONTAINER SYSTEM | IMDINCO2M Sterilization Container 312 x 190 x 50 mm 12-1/4” x 7-1/2” x 2” Sterilization Container 312 x 190 x 65 mm 12-1/4” x 7-1/2” x 2-1/2” Top and bottom with filter. Fits one container cassette. Sterilization Container 312 x 190 x 100 mm 12-1/4” x 7-1/2” x 4” Top and bottom with filter. Fits two container cassettes. Sterilization Container | IMDINCO3M 312 x 190 x 135 mm 12-1/4” x 7-1/2” x 5-1/3” Top and bottom with filter. Fits three container cassettes. CONTAINER ACCESSORIES Container Indicator Card | IMCO-INDNA 250 pieces, single use | IMCOM-SEAL | IMCO-FIL3M Tamper Evident Seal for Lock Tamper Evident Seal for Lock 100 pieces, single use Disposable Paper Filter 100 pieces, blank, single use Container Indicator CardA32

HAND HYGIENE PRODUCTSHAND ESSENTIALSHu-Friedy Hand Essentials is a complete line of medical grade hand moisturizers, sanitizers and soaps designedfor frequent use to help with program compliance. All of Hu-Friedy’s hand hygiene products are non-irritating,cost effective and are tested to be Chlorhexidine Gluconate (CHG) and latex glove compatible.SANITIZERS MOISTURIZER SOAPSHand Essentials™ Skin Repair CreamHelps restore the skin’s natural moisture balance US Canada | IMS-1500CA32 Fl oz (946 mL) Bottle w/Pump | IMS-1500 | N/A | IMS-1502CA4 Fl oz (118 mL) Tube | IMS-1501 | IMS-1508CA2 Fl oz (59 mL) Tube | IMS-15024 mL Packet, Case of 144 | IMS-1508• Aids in delivering moisture and nutrients to skin• Contains Olivamine® to aid in the skin repair process• CHG and latex compatibleOlivamine is a registered trademark of McCord Research Inc. A33

HAND HYGIENE Sterillium Comfort Gel® Hand Antiseptic Scientifically proven, easy-to-use hand sanitizing gel 16.06 Fl oz (475 mL) Bottle w/Pump | IMS-1504 Sterillium Wall Bracket (for IMS-1504) 2/pk | 974730 1.69 Fl oz (50 mL) Bottle | IMS-1504S • 85% alcohol kills 99.999% of a broad range of nosocomial pathogens within 15 seconds • Proven at only 2.4 mL per application • Proven to increase skin hydration within one week • CHG and latex compatible INCREASED SKIN HYDRATION TRADING ECONOMY FOR EFFICACY – IN VIVO TEST Our test comparing Sterillium Comfort Gel® against two Sterillium Comfort Gel® significantly increases skin hydration after competitors products showed that for Sterillium, only only one week of product usage compared to untreated skin.1 2.4 mL was required to entirely cover the hands and nails. 14% 2.4mL 12% 3.0 10% 8% 2.5 6% FDA TFM 4% 2% Requirement 0% 2.0 After 1 week 1.5 1.0 0.5 0.0 Test method follows FDA TFM for Health-Care Antiseptic Drug Products2 and compliant with ASTM E1174, Standard Test Method for Evaluation of Healthcare Personnel Handwash Formulations. Sterillium Comfort Gel® in comparison to two other alcohol-based hand sanitizers available on the market.3 In vivo testing shows, use of only 2.4 mL of Sterillium Comfort Gel® exceeds the FDA TFM efficacy requirements.4 Log10 Reduction Sterillium Comfort Gel® Competitive Product A Competitive Product B After 2 weeks Hand Essentials Instant Hand Antiseptic An essential germ-killing aid to disinfect hands 16 Fl oz (473 mL) Bottle w/Pump | IMS-1505 • Contains Vitamin E and aloe vera to condition skin • 70% v/v ethyl alcohol gel dries quickly on hands • Scent-free formula • CHG and latex compatible Hand Essentials Antibacterial Soap Effective against bacteria, yet gentle enough for frequent use 16 Fl oz (473 mL) Bottle w/Pump | IMS-1506 • Rich lathering, quick-rinsing soap • 0.5% Triclosan active antibacterial ingredient • CHG and latex compatible Hand Essentials Lotion Soap Canada Soothing, gentle on hands and pH balanced | IMS-1507CA U.S. 16 Fl oz (473 mL) Bottle w/Pump | IMS-1507 • Enriched with moisturizing skin conditioners • Rich feel, clean light scent • CHG and latex compatible Sterillium Comfort Gel is a registered trademark of Bode Chemie GmbH Co.A34

Hu-Friedy offers complete Infection Control Starter Packages INFECTION CONTROLthat include everything you need to ensure a safer and smarter STARTER PACKAGESpractice for you and your patients from day one. Simply choosethe appropriate package based on whether or not you are acassette user and whether you practice in the U.S. or Canada.UNITED STATES PACKAGESCassette User | ICSPCASS Cassette User Expanded | ICSPCassette Infection Control Starter Package Cassette Infection Control Starter Package, ExpandedIMS Universal Wrap 20\"x20\" (100 Sheets) | IMS-1216H IMS Universal Wrap 20\"x20\" (500 Sheets) | IMS-1216IMS Universal Wrap 15\"x15\" (100 Sheets) | IMS-1215H IMS Universal Wrap 15\"x15\" (1000 Sheets) | IMS-1215IMS Lead/Latex Free Autoclave Mon. Tape | IMS-1460 IMS Lead/Latex Free Autoclave Mon. Tape (Qty 2) | IMS-1460IMS Integrator Strips (100/Pkg) | IMS-1241 IMS Monitor Tape – Exam | IMS-1256SporeCheck, Starter Kit | IMS-1376 IMS Monitor Tape – Prophy | IMS-1259Enzymax Earth, 1 Gallon Bottle | IMS-1336 IMS Monitor Tape – Restorative | IMS-1247Pump for Enzymax Gallon Bottle | IMS-1226P IMS Monitor Tape – Endo | IMS-1255Sample Pack, Enzymax Earth Powder (Qty 2) | IMS-1332SP IMS Mulitple Tape Dispenser (9 Roll Cap.) | IMS-1270Enzymax Spray Gel, 24 oz | IMS-1229 Steam Sterilization Integrators | IMS-1241Team Vista Waterline Cleaner Combo Pack | IMS-1450 SporeCheck, Starter Kit | IMS-1376Hand Essentials Skin Repair Cream, 2 oz (Qty 3) | IMS-1502 Enzymax Earth, 1 Gallon | IMS-1336Sterillium Comfort Gel, 475 mL | IMS-1504 Pump for Enzymax Gallon Bottle | IMS-1226PHand Essentials Lotion Soap, 24 oz (Qty 2) | IMS-1507 Sample Pack Enzymax Earth Powder | IMS-1332SP Enzymax Spray Gel, 24 oz | IMS-1229 Team Vista Waterline Cleaner Combo Pack | IMS-1450 Cleaning Monitor Holder | IMS-1200H Cleaning Monitors – Ultrasonic (50/Pkg) | IMS-1200U Hand Essentials Skin Repair Cream, 4 oz | IMS-1501 Sterillium Comfort Gel, 16.06 oz | IMS-1504 Hand Essentials Lotion Soap, 16 oz | IMS-1507Non-Cassette User | ICSPCONSBL | IMS-1236 Enzymax Spray Gel, 24 oz | IMS-1229Infection Control Starter Package | IMS-1241 Team Vista Waterline Cleaner Combo Pack | IMS-1450 | IMS-1376 Hand Essentials Skin Repair Cream, 2 oz (Qty 3) | IMS-1502IMS Bagette 3-1/2\"x 9\" (200 Pouches) | IMS-1336 Sterillium Comfort Gel, 475 mL | IMS-1504IMS Integrator Strips (100/Pkg) | IMS-1226P Hand Essentials Lotion Soap, 16 oz (Qty 2) | IMS-1507SporeCheck, Starter Kit | IMS-1332SPEnzymax Earth, 1 Gallon BottlePump for Enzymax Gallon BottleSample Pack, Enzymax Earth Powder (Qty 2) A35

INFECTION CONTROL For a discounted price off of retail, you will receive Hu-Friedy IMS wrap STARTER PACKAGES or Bagettes, SporeCheck, Team Vista, Hand Essentials and more. CANADIAN PACKAGES Cassette User | ICSPCASSCA Cassette User Expanded | ICSPCA Cassette Infection Control Starter Package Cassette Infection Control Starter Package, Expanded IMS Universal Wrap 20\"x20\" (100 Sheets) | IMS-1216H IMS Universal Wrap 20\"x20\" (500 Sheets) | IMS-1216 IMS Universal Wrap 15\"x15\" (100 Sheets) | IMS-1215H IMS Universal Wrap 15\"x15\" (1000 Sheets) | IMS-1215 IMS Lead/Latex Free Autoclave Mon. Tape | IMS-1460 IMS Lead/Latex Free Autoclave Mon. Tape (Qty 2) | IMS-1460 IMS Integrator Strips (100/Pkg) | IMS-1241 IMS Monitor Tape – Exam | IMS-1256 SporeCheck, Starter Kit | IMS-1376 IMS Monitor Tape – Prophy | IMS-1259 Enzymax Earth, 1 Gallon Bottle | IMS-1336 IMS Monitor Tape – Restorative | IMS-1247 Pump for Enzymax Gallon Bottle | IMS-1226P IMS Monitor Tape – Endo | IMS-1255 Sample Pack, Enzymax Earth Powder (Qty 2) | IMS-1332SP IMS Mulitple Tape Dispenser (9 Roll Cap.) | IMS-1270 Enzymax Spray Gel, 24 oz | IMS-1229 Steam Sterilization Integrators | IMS-1241 VistaClean Irrigant Solution Concentrate (Qty 2) | IMS-1452 SporeCheck, Starter Kit | IMS-1376 Hand Essentials Skin Repair Cream, 2 oz (Qty 3) | IMS-1502CA Enzymax Earth, 1 Gallon | IMS-1336 Hand Essentials Lotion Soap, 16 oz (Qty 2) | IMS-1507CA Pump for Enzymax Gallon Bottle | IMS-1226P Enzymax Spray Gel, 24 oz | IMS-1229 VistaClean Irrigant Solution Concentrate (Qty 2) | IMS-1452 Cleaning Monitor Holder | IMS-1200H Cleaning Monitors – Ultrasonic (50/Pkg) | IMS-1200U Hand Essentials Skin Repair Cream, 2 oz | IMS-1502CA Hand Essentials Lotion Soap, 16 oz | IMS-1507CA Non-Cassette User | ICSPCONSCA | IMS-1236 Sample Pack, Enzymax Earth Powder (Qty 2) | IMS-1332SP Infection Control Starter Package | IMS-1241 Enzymax Spray Gel, 24 oz | IMS-1229 | IMS-1376 VistaClean Irrigant Solution Concentrate (Qty 2) | IMS-1452 IMS Bagette 3-1/2\"x 9\" (200 Pouches) | IMS-1336 Hand Essentials Skin Repair Cream, 2 oz (Qty 3) | IMS-1502CA IMS Integrator Strips (100/Pkg) | IMS-1226P Hand Essentials Lotion Soap, 16 oz (Qty 2) | IMS-1507CA SporeCheck, Starter Kit Enzymax Earth, 1 Gallon Bottle Pump for Enzymax Gallon BottleA36