WFTI FALL 2018 BINDER cropped

FFAALLLL 22001188SPRING GRINDING...P. 64 Serving Manufacturers of Springs, Wire WWW.WIREFORMINGTECH.COM Formed Parts, Wire Mesh and Rebar ProductsTrade ShowCoverage...pages24, 44, 60 & 70 COATING & PLATING...P. 50TESTING..P. 58EMPHASIS ON FENCE MAKING...P. 34-37COMPANY PROFILES...P. 77-94

YOUR FAVORITE MACHINES JUST GOT BETTERWith the AT Attachment option now available on both CSX and HAX machines, you can start and finish yourpart on one machine, no matter which one you prefer. There’s no need to move a part off the machine to yoursecondary department to complete it, so you can widen your scope with a broader range of wire forms andtorsion springs completed on just one machine. At RK Trading, we don’t just sell machinery—we service it,support it, and carry an extensive tooling and parts inventory, all in the U.S.Improve production rates and increase profits with:CSX Series with removable AT Attachment (2mm and 3.5mm machines)HAX Series with fixed AT Attachment (2mm and 4mm machines)

High PerformanceExotic alloys in wire and barsSpring wire for valves. .827”(21mm) to .001”(0.025mm) dia Visit Alloy Wire atINCONEL®, HASTELLOY˘, NIMONIC®, MONEL®, PHYNOX†, MP35N* etc.Tested in-house to relevant AMS, ISO and NACE standards*1-866-482-5569 DFARS 27–29 November 2018alloywire.us.com HALL 03: STAND C30®Trade name of Special Metals Group of Companies. †Trade name of Aperam Alloys Imphy. ˘Trade name of Haynes International. *Trade name of SPS Technologies.*AMS, ISO and NACE specifications must be requested in full at time of placing your order.

FZ–11 DESIGNED & BUILT R–12W24S Retrofit Single Point Our fastest, most accurate single point spring coiler ever: The Torin FZ Series. Available with four, five or six axes of independent motion and capable of producing springs such as compression, extension, torsion, constant force, and simple wire forms. Available for a wire diameter of .003”–.750”. Dual Point Now a standard offering from Torin! With the REVOLUTION Series of Dual Point coilers easily switch from left to right hand coiling. Save time and get production up and running faster with our multi-wire line tooling. Capable of single point and torsion coiling. Available for a wire diameter of .008”–.750”. Retrofits & Control Upgrades Retrofit Program for W-Series Mechanical Coilers—Maximize the potential and output of your aging coiler with CNC technology. Z-Series and CNC Control Upgrade Program— Eliminate the risk of relying on obsolete components and worn mechanics. Upgrade to the modern control system currently implemented on new Torin coilers. To learn more about all of our product lines, contact us today. [email protected] www.fenn-torin.com

TablTeabolefoCf CoonntteenntstsFalFl 2a0ll072018 Vol. 21V, oNl.o1.04, No. 4 www.wireformingtech.comWFTI EMPHASIS: FeatuFreaAturrteic AlertsiclesFence Making 34-37 Dheyadlirnog3gwe4nith Tw1o4 NWeFwTIC TheachinniLcainl kAcWhieeavveimnegnMt Aawcahridnse –s Class of 2007 embrittlement GregorySJeecnodnrdeAansn-uAaldWvairnecFeodrm, UinSg ATe-mchandoelo,gwy oInrtledr-ncalatiosnsaml TaecchhninicearlyAacthiaevceomset-netffAewcatrivdes, pgriviceen.out sitneespl.r.3.in.26g0 AutomarenlaantuteaidlclytotWoeqsuiprirpienmgeFmntea, kmninacgteeorriawMlsiroearfnoarcumceifnsagsocinritdeuussrftoriyrnmingadkivMinidguaaspclsrhifnogirsnmoearjsowrirteecfohrnmiceadl developments parts. M. Demirci - Double spiral chain link and wire plastic fence coating technologies. 38 wThi1t e6h St“BDhuHrueecwosc IwiGnenr etesRressnoesb-dlS aEStuttn a-oc gAvrt iemiynoduelCn teii-tpro orifonnrfnoggttmie hnMd eusEytre xaTWtstewiginyroc ere-t PsFiouollntaerd”mt eini ngVrgoaw rthi aanndt re turn to pr ofitability . OSimn2o0lny HtHRahicyaehsdaerrMdo- DNgu.eesSwniiscs sEopnMrm,inJagbr. yre-iAntSdtrleegwvrimeiinwndeoegnfrtthf eoeafpt uhSyrespiscracilnommge ptaSallntueyrg’esylloaftheysdtriongneonveamtiobrnit.tlement of Fence manufacturing 40...34 (above) and 36 (below) 42 Ralf Jaesnpircinkge s-teCeol malopnregswsiitohna sdpisrcinugsssioisnoolfamteititgwaotiocnomnceethrot dhsa.lls to prevent vibration.50Drum washer for springs and SStpu2ar3rit nMCmDgcreSo.tMRhamloeluageprehgnoryyuNso-.ffiSWtsaipporcrirgiinntnhgu gtE-mrpPfearfaokerridntcug6Htcaostenfi odtlihnnpwep simCrreouaMfclotreir-bompsasoenredtnsispt efaSoarriecttrsesil,miHetTaalhteneeuahfSaletctraethulntrghinotchgaf.orefaSatNedevala, tdniecodeimncaetendt.to the wire formed parts...30 CEdo2it o4ar tiailnCKSirgottaaanff&t Ri-n.TP Dghlhesaa mstftioia n-tr eAg t- lohoRfoe-kth o a2etu1 -hasnirgtt hdCi-npueecnrpofotarutminraygncaen adnpd lacotirnrogstioenc-hrensoislotagnyt, fleuqouroippomlyemnet ra/PnTdFmE a teria ls. 56 DrivincgoatMinges fsorhspWringesladnidnwgireIfnornmeodvpaarttsi.on Mic2h6a elSRtariechss- F Pleexeibnleinangd –e ffiAc iPenrtapcrtoidcuaclt iAonpopflsicimaptlieoonr complex reinforcement mesh. 58 SpotliDfogrr.hbEecttkteeOrhmanradtTeMreiüalslleutrtii-lnizSagtrteiosnsv(isahhoitg) hpeerehnainrgdnceasnsbreesuuslteindgininmreadkiuncgeadumtoatseursiapleunsseiodn/recdouilcsepdrinwgesight. Compact mesh Mike McNulty - Testing of finished/semi-finished products as well as raw wire ensures quality.welding cyl- 64 Sp3r0i nHEgdeiGtoartira i&lnS tdSafifun-rSgfuapcRpelioe rTusrhneaadvetumrepsepnont dRedotuo noudr ucapll for the state-of-the-art in heat inder...36 EditorialaSndtasffur-faTcheetrsetaatmtee-ontf-ethquei-pamrteinnt.spring grinding technology, equipment and materials. 68 Si3m6 ulMaotiroen FolefxIinbidliutyc atinvde VHeersaattiinligty &foCr tahsee WHiraer Wdeonrkinegr Volker MDeonrostihnege-JSuneggembleondt--toA-rsaenggme eofnmt ceashlcwulealdtiionng mmaecthhiondessitsabbeiliinzgesoffaenreddstpoeweirdeswtohrekeprrso, cess. 77 CompaandnwyhePn sreot fiuplebysa:wAelln-trnainuead lwoSrkpere, tcheiadolwAntdimveecarntibseilensgs thSane3c0tmioinnutes.Twin-plate grinding ...38 C ol3u8m MSnosanicahViitnarei -sV eforsra tiPlerwoirdeuhacnignegr f oWrmiirneg aHndanotgheer rwsire processing machines offered globally with after-sales support and engineering. 24 CMA3e9mS MbCExeIAcrHeSsrpoMhtesdiIp tfSrsocMmShteohPeelRaCtriAInsNShgMGiIp&C WOANHwONoaERlCridTLdIsODa NRy®, eaP2ap0aucb1hrlitc8 yTa,toiotnaolf of US$463,000 in 2007Compression springs used MichaelCBAaSnMdIy (C- hCicAaSgMo IANsseowcsia&tioEnv oefn StsprUinpgd aMtaenufacturers, Inc.), Naperville, IL, USA.in concert halls ...40 26 Up44A gWaiirnes Rtoad W& aCholating Supplier Consolidates Ran dy DItesF oArdct-iAvliltTiehsin gins SVperinngeszuela & Columbia28Versatile system for producing wire hangers....38 UsefuJalcIqnuefsoAAnckbaoertu-tCotmhpeanEy iuntreondps etoatanp thUendeivoenlop,inEg ugrroowtph meaarknetAin uLattoin mAmoerticiav.e In4d5u sCtroymapnadnyt hPeroBfilreesxit, Certain British Firms Might Convert to GeIrnmformaantioan oftf evarlueBtorethxe iintt,erFnaatisontael snperinrgsan&d wSirepfrorimnegdspaartstinwduisrtrey. 2020 30 DKo enfrao IdnrDmdeuangstliteorryn- EEHuvreoepanetaitnnsgPe–rspPeactrivtesVI Dr.3R7o gSertNra. iWgrhigthFt -roThme STthreengSthhoofwSteel 32 The ImImpagoesratandnfaccets forofmRwiereliSaobuthleeasTt eASsIAt 2R00e7s, huelldtsOcitnobeMr 1e6c-1h8,a20n0i7c, ian lBaTnegksotki,nThgailand.Production of coils that look like DepartAmlaen nThtsomas - Wire Product Testingdust without a microscope ...44 Industry Events Next Issue: Winter 2008Wire Forming Events ..................................................4EN..de.4iwt4os-r4iWa8l.i.r.e......................................4......4............SN....e..t..wr....as....i..a..gn....dh......it..m....Fa....g..r..eo....s..m..f..r..o....mT......hS....P..e....R..S86INhGoWwOR–LDS®P20R1I8N, hTGeowldpWiO rPecOrto2oRb0deL0ur 8D3c ttP®osr 72eo,0vf2 1i02e180w80, i7n Rosemont, IL, USA.Product Showcase......6...0......SN..e.t.wr..as..i.a.gn..dh...it.m..Fa..g.r.eo..s.m.f.r.o..mT...hw...ier.e4S0Chhinoaw20–18,wheirldeSCephtReimnobuaenr2d206u1tpo8:2 M9,a2t0e1r8i,ainlsShanghai, China....60-63AEddvitoerrtiais.l.e.I7rns0d’-e7Inx1d..e..x................7......0............MP....r..ee....v..ti..ea....w..l....oT....f..r..w..a..i..rd..e....eI..n....d..S..ia....h..2..o..0....1w..8....,66FN43oaviermTbreiro27Rtoe2t9u,Sr2pn01os8t,ltibogehinItng: hdMeilaedsinhM Wumebldaii,nIngdia. Departments Fall 2007/Wire Forming Technology International 3Wire Forming Events ............................................................4 Next Issue: Winter 2019Editorial.................................................................................6News Wire ............................................................................8 Top Products of 2018Product Showcase..............................................................72 Emphasis: Rebar ProcessingAdvertisers’ Index ...............................................................95 Roundups: Mesh Welding • PackagingEditorial Company Index ....................................................96 Spotlight: Spring Coiling Fall 2018/Wire Forming Technology International 3

WIRE FORMING EVENTS Table of Contents SeptembeFra2ll62,0200719 Vol. 10, No. 4November 27 – 29, 2018 wire India 2018 th10 International Congress of Spring Wire Feature ArticlesMumbai, India www.wire-india.com • www.mdna.com Hamburg, Germany Dealing with 1741 Akron Peninsula Rd, hydrogenJanuary 24 – 26, 2019 www.esf-springs.comembrittlement 14 WFTI Technical Achievement AwaArdksr o–n C,laOssHo4f 24030173 USAWFA Winter Meeting in spring steel....20 Tel: +1 330 864 2122 • Fax: +1 330 864 5298Second Annual Wire Forming Technology International Technical Achievement Awards, given out annually to spring making or wire forming industry individuals for major technical developments www.wireformingtech.comrelated to equipment, materials or accessories for making springs or wire formed parts. October 1 – 3, 2019 16 “ How Re-Engineering My Wire Forming SMI Metal Engineering eXpo 2019 DBruews iGnreeesnsbl aStt a- Av emdul tii-tp rfornogmed sEtrxatteignyc retsioulnted” in gCrowhthi pandL reipturpn itno pcrooftitatbility.San Antonio, TX, USA Pittsburg, PA, USA 20 H ydrogen Embrittlement of SpringP Srteeseildent and Publisherwww.wirefabricators.org www.metalengineeringexpo.org [email protected] D. Sisson, Jr. - A review of the physical metallurgy of hydrogen embrittlement of spring steel along with a discussion of mitigation methods. 23 Composition Effects in Carbon Steel SMtreinkgteh oMf StceNel,udeldtiycated to the Dr. Roger N. Wright - Part 6 of the multi-part series, The metallurgy of spring making and wire formed partsVmiacneufPacrtuerisnigd. ent and EditorMarch 13 – 16, 2019 March 30, 2020 – April 3, 2020 wire formed parts...30 24 Coatings for the 21st Century [email protected] ‘19 Drum washer for springs and wire 2020 Kirtan R. Dhami - A look at high-performance and corrosion-resistant fluoropolymer/PTFE coatings for springs and wire formed parts. Tom HutchinsonIndianapolis, IN, USA wDüwswse.lwdiorref-,tGraedrmefaainry.c om Compactwww.americanfenceassociation.com 26 SDrt.rEecskesh aPrdeMeünllienr -gS –tre Ass P(shroatc) pteicenainl gAcpanpbliecuGastelidooibnnmalakSinaglaeusto Msusapennasigonecroil springs for better material utilization via higher hardness trlehsu@ltinwg inirreedfuocremd miantegritael cushe.dc/roedmuced weight. www.mdnwaelmd.iencsghocyml- 30 Heat & Surface Treatment Roundup for the sJtaitme-ofM-thea-asrat inrheat inder...36May 13 – 16, 2019 Editorial Staff - Suppliers have responded to our call and surface treatment equipment. Senior EditorInterwire 2019 June 2 – 4, 2020 36 MDoororthee eFJleunxgiebbilolidtty- Aarnandg eVoef rmseashtiwlietyld infgojmra amtchh@ein eWws iisirrbeee iWfnogoromfrfekrieendrgtotewcirehw.corokemrs,Atlanta, GA, USA and when set up by a well-trained worker, the downtime can be less than 30 minutes.www.interwire19.com WAI Operations Summit & 38 Machines for Producing Wire Hianntgeersrnational Sales Wire Expo 2020, Uncasville, CT, USA Sonia Vitari - Versatile wire hanger forming and other wire processing machines offered globally with after-sales support and engineering. CHINA www.wirenet.orgMay 13 – 16, 2019 39 CASMI Scholarship Awards ReachR Tinogtaiel roTf UraSd$e4M63e,0d0i0a iLnt d20. 07 CExAcSeMrpIt e(Cdhfriocmagtoh eACssAoScMiaIEtCioaOnsN otNf CESCphrTiiInOngNa M,:aaVnpuuifbvalciictaautnrioenrSso,h fInacn.),gNa+p8er6vi-lle2,1IL,6U2S8A.9-5533, EXT 169WFA Spring Meeting Atlanta, GA, USA SweirpetCemhibnaer2Ve20rs32atwi0lei–re,syh2sSaten6hmge,faros2r.n..p.03rog8d2uhc0ina gi, C4 4 h iWIJntasciaq rAue ec sRtAio vncdikt ia&eers tC -ioCnoa VmtiepnanNngey ozSinurtuetenphdlpas&E lt&ioeXt SarC pToCotuhol9eutnh3dmsev3vCoib2evllhioiaidpiaminnangata@eg:grsoMgr w iitnehaglgmiiguaeri@kreett rrLianindiLuageti.in+ceA8or mt6mre-ari2cda0e. .8c 7o3m2-3 316,www.wirefabricators.org www.wirechina.net • www.mdna.com 45 Company Profiles interHnaotionnagl sKpriongnagn:d MwireikfoermHedapyart+s i8nd5u2stry2. 369 8788, ext 11 Information of value to the [email protected] 17 – 19, 2019 Industry Events SSohuothweastTASoImA 20H07u, htcelhd iOncstGoobenEr,1R6G-M1l8o,A2b0aN0l7Y,SinaBlaensgkMok,aTnhaailganedr.wire Southeast Asia 2019 [email protected], Thailand October 7 – 9, 2020 37 Straight From Thewww.wire-southeastasia.com SPRING WORLD® 2020 Images and facts from wire Next Issue: WINinDtIeAr 2008www.mdna.com Rosemont, IL, USA De partments www.casmWiire-Fsoprmriinng Egvwentos.r..l..d.......o...r..g..................................4 Strategise.inToPpv Pt.rLodtdu.c,tAs bohf i2j0at07Sanghvi, Co-Founder Editorial....................................................................... 6 News Wire ..................................................................8 Tel : +91-22-w6i5re262300186 5P/r6e6v,ieCwell : +91-98211 27628 Product Showcase....................................................40 REoumnadiul p: :a [email protected] Advertisers’ Index .....................................................63 Spotlight: MeIsThA WLeYlding Editorial Index...........................................................64 Casiraghi Pubblicatá Internazionale DFailel 2g00o7/WCirae FsoirrmaingghTeic,hnOololgiyvIneterrnCatioansail ra3ghi Tel: +39 031 261407 • Fax: +39 031 261380 [email protected] JAPAN Sakura International, Ken Myohdai Tel: +81 6 6264 3900 or +81 3 5646 1160 Fax: +81 6 6264 3901 or +81 3 5646 1161 [email protected] TAIWAN Worldwide Services Co. Ltd. Robert Yu Tel: +886 4 23251784 • Fax: +886 4 23252967 [email protected] Publisher's Notice: We assume no responsibility for the validity of claims in connection with items appearing in Wire Forming Technology International magazine. Ad- dresses are given to facilitate further inquiry. Wire Forming Technology International is published in the months of February, May, August and November by Initial Publications Inc., Chip Lippincott, Pres., 1741 Akron Peninsula Rd, Akron, OH 44313 USA. For subscription info write: Circulation Dept., Wire Forming Technology International, 1741 Akron Peninsula Rd, Akron, OH 44313 USA. For changes of address, visit www.wireformingtech.com. Wire Forming Technology International is distributed with- out charge to people employed by a company or division of a company engaged in the manufacture of springs, wire formed parts, wire mesh and rebar products and the materials, tooling, machinery and control systems for making those parts. Others may subscribe at US$35/yr in the USA and Canada or US$65/yr elsewhere. Single copy price is US$20 plus shipping. Editorial reprint prices will be furnished upon request.CanadaPostInternationalPublicationsMailProduct (Canadian Distribution) Sales Agreement No. 40025486. Canadian return address: BleuChip International, PO Box 25542, London, Ontario N6C 6B2 Canada. Postmaster: Send address changes to Wire Forming Technology International, 1741 Akron Peninsula Rd, Akron, OH 44313 USA.4 Wire Forming Technology International/Fall 2018

PTC - Pretension Control HIGH SPEED CNC COILERS INTERNATIONAL PATENT MX 15 Ø 0.010” - 0.067” MX 30 Ø 0.016” - 0.118”MI LA N O - ITALY NIMSCO LLC North American distributor 5115 B Tremont Ave. Davenport, IA 52807 Ph: 563-391-0400 Fax: 563-391-0403 [email protected]

EDITORIALShow Business Technology and news for the entire wire forming industry...We just completed participation in two trades shows that SSUUMMMMEERR 22001188 Wire Forming Technology International: 2019 Editorial Planare very important to the local and global wire forming Send all editorial text and image files toindustry: SpringWorld 2018 Rosemont and wire China WWW.WIREFORMINGTECH.COM2018 in Shanghai. Both featured outstanding exhibits Mike McNulty, Editor, at [email protected] wide ranging industry expertise related to makingsprings, wire formed parts, wire mesh and rebar prod- Serving Manufacturers of Springs, Wireucts. The business activity and mood at each event was Formed Parts, Wire Mesh and Rebar Productsstronger than we observed in the most recent stagingsof these long-running biennial exhibitions. MX 15 Ø 0.010” - 0.067” Trade Show Winter 2019 Summer 2019 MX 30 Ø 0.016” - 0.118” Coverage...pages Top Products of 2018 SMI Metal Engineering eXpo 2019 PreviewWe produced detailed preview articles of each event in Rebar Processing Emphasisthe last issue of Wire Forming Technology International, 42, 50, 66 & 72 Mesh Welding Roundup wire Southeast Asia 2019 Previewand we have some show reports in this issue, see pages Packaging Roundup wire South America 2019 Preview24-25, 44-48 and 60-63. Booth #1005 Spotlight on Spring Coiling Editorial deadline: February 4 , 2019 Surface Treatment RoundupI enthusiastically endorse visits to upcoming editions FORMING & Ad closing: February 8, 2019 Packaging Roundupof these shows in 2020, either as a visitor or exhibitor, BENDING...P. 60 Production finished: February 15, 2019depending on your location and regional interests. Visit Mail date: February 22, 2019 Fence Making & Wire Weaving Roundupwww.casmi-springworld.org and www.wirechina.net SSPPRRIINNGG 22001188 Spotlight on Rebuild & Upgradefor details, and turn to page 70 for our preview article Spring 2019 Editorial deadline: August 12, 2019on wire India 2018, which takes place in Mumbai in Serving Manufacturers of Springs, Wire WWW.WIREFORMINGTECH.COM Interwire 2019 Preview Ad closing: August 16, 2019November, www.wire-india.com. Formed Parts, Wire Mesh and Rebar Products wire Russia 2019 Preview Materials (Wire, Strip & Bar) Emphasis Production finished: August 23, 2019Both And SPRING COILING...P. 54 Straightening & Cutting Roundup Mail date: August 30, 2019 Spotlight on Wire Forming &USA tariffs have officially been imposed on many wire REBUILD & UPGRADE WIRE HANDLING...P. 64 Fall 2019products including springs, wire, rod, mesh, fencing, EMPHASIS ARTICLES...P. 30-41 Tube Bending Company Profilesand pins, see news story on page 17 for details. Editorial deadline: April 1, 2019 Heat Treatment Emphasis STRAIGHTENING & CUTTING..P. 62 Testing RoundupIn the last issue, I wrote about the ”Zero-Tariff Solution”, Ad closing: April 5, 2019 Wire Handling Roundupwhich may or may not be on the radar somewhere down Nashville Exhibits: pages 42-51 Production finished: April 12, 2019 Spotlight on Spring Grindingthe road, but for the time being, we are faced with the Editorial deadline: October 28, 2019stark reality of tariffs (taxes) on a 194-page list of prod- WWIINNTTEERR 22001188 Mail date: April 19, 2019 Ad closing: November 1, 2019ucts that are being imported into the USA as well as Production finished: November 8, 2019retaliatory ones being levied on products being exported FFAALLLL 22001177 Mail date: November 15, 2019from the USA. Lots of consequences, both intended andunintended as well as good and bad, are sure to come Serving Manufacturers of Springs, Wire WWW.WIREFORMINGTECH.COM Serving Manufacturers of Springs, WireTESTING...P. 62 Read by manufacturers andto many people, companies and governments. There Formed Parts, Wire Mesh and Rebar Products Formed Parts, Wire Mesh and Rebar ProductsWWW.WIREFORMINGTECH.COM users of springs,will be some horror stories as well as victories to come. wire formed parts, TOP PRODUCTS OF 2017...PAGE 38-43 EMPHASIS ON HEAT TREATMENT...P. 32-35 & 71 COMPANY PROFILES...P. 74-94 wire mesh andLike many people, I see tremendous value in the natu- rebar products.ral forces of the free market, and I am not a fan of the MATERIALS...72 • MESH WELDING...32 SPRING GRINDINGintrusive government intervention or protections. But ..P. 64 Subscribe and read online @the only practical approach is to pursue the proper bal- REBAR PROCESSING...P. 66ance of both a free market economy and protection from WIRE www.wireformingtech.compredators, not just complete reliance on one or the other. HANDLING ...P. 44 Four Issues per yearSo while we wait and hope for the ultimate goal “no Readers in 70+ countriestariffs and no barriers” in local and global markets, I wire 2018 Trade Fair Straight From The Show Reports: ...46 & 66begrudgingly admit that some sabre rattling and shocks Preview: pages 44-65to the system are needed to get both freedom and protec-tion in an equitable and fruiful balance. And the players All editorial content and dates are subject to changes.with the most leverage are surely the ones to use it. 2019 Plan As another year comes to a close, we are looking forward to our next four issues, which will be filled with spring making, wire forming, mesh welding and rebar process- ing technology and news. Our editorial plans and trade show coverage for 2019 are now complete and detailed in the graphic shown above, which can be found online at http://wireformingtech.com/EditOp.asp. USA Manufacturing The National Association of Manufacturers (NAM) in Washington, DC, USA, says that optimism among USA manufacturers remains exceedingly high (92.5%) follow- ing enactment of tax and regulatory reform, and NAM’s Outlook Survey results are on pace for the highest yearly reading in the survey’s 20-year history. In October, thousands of manufacturers hosted “Manufacturing Day” events across America, to show off their “stuff” and to combat the ongoing problem of finding skilled workers, which stunts growth. Visit www.nam.org for details. Mike McNulty, Editor [email protected] Wire Forming Technology International/Fall 2018

“Bending in a New Dimension”FMU Series Designed for the production of torsion, extension and extended loop springs and bent parts, the WAFIOS FMU series opens up a host of new options for the spring and wire forming industries. • Universal machine concept • Premium quality with zero-error production • Operation and setup flexibility for the range of operator skill sets • Unmatched power, capability and flexibility across the entire series FMU Series Technical Data FMU 08 Working range .006 - .031 in Ø 0.16 - 0.80 mm Ø 0.40 - 1.60 mm Ø FMU 16 Working range .016 - .063 in Ø 0.80 - 2.50 mm Ø 0.80 - 3.20 mm Ø FMU 25 Working range .031 - .098 in Ø 1.80 - 4.00 mm Ø 1.80 - 5.00 mm Ø FMU 32 Working range NEW! .031 - .126 in Ø 2.80 - 6.50 mm Ø 2.80 - 8.00 mm Ø FMU 40 Working range .071 - .157 in Ø FMU 50 Working range NEW! .071 - .197 in Ø FMU 65 Working range .110 - .256 in Ø FMU 80 Working range .110 - .315 in Ø spring+ Collision control and automatic determination of programming sequences to yield the best possible cycle time Economical • Versatile • ReliableEngineered for What’s Next Spring Coiling & Forming Wire Bending & Forming Wire Straightening, Cutting Tube Bending & Forming Nail, Fastener & Chain Machines Machines & End Working Machines Machines MachinesWAFIOS Machinery Corporation 27 NE Industrial Road, Branford, CT 06405WAFIOS Midwest Technical Center 9830 W. 190th Street, Mokena, IL 60448USA www.wafios.us / 203 481 5555 / sales@wafios.us see us at Booth C10652Canada www.wafios.ca / sales@wafios.ca November 6-8, 2018 Georgia World Congress CenterWAFIOS Machinery Corporation is a subsidiary of WAFIOS AG Atlanta, Georgia

NEWS WIREWinamac Coil Spring a clean environment inside and The Ulbrinox division has ad-Celebrates 70 Years outside the plant, heat recovery equipment and smart sensors as opted “The Ulbrich Philosophy” On August 31, 2018, Winamac well as a high-efficiency waterCoil Spring (WCS), Winamac, treatment plant. from its inception. And the com-IN, USA, celebrated its 70th anni- www.wabrasives.comversary with an employee appre- pany’s dedicated team of 30 em-ciation day. Festivities for the day Ulbrinox Celebrates included games, food, cash prizes, 20 Year Anniversary ployees strives to continuouslygifts and a memorial presentationfor the late, Joe Pesaresi. Ulbrinox, which is a division of improve, standardize operations Ulbrich Stainless Steels & Spe- Over the company’s 70 year cial Metals, Inc., North Haven, and put its customers first on ahistory, WCS has grown from a CT, USA, has been an importantone man shop with founder Walter point of sale for customers in the daily basis.Pesaresi, to a 180 employee strong Mexican and Central and Southcompany, that in 2017 shipped American markets since 1997. When Ulbrinox was opened forover 15 million pounds of springs Located in Queretaro, Mexico,around the globe. Ulbrinox provides quality material business by then CEO, Fred Ul- products including stainless steel According to the company, hav- strip, aluminum, red metals and brich Jr., production was smallering become a major OEM spring tube. Additionally, Ulbrinox’s slit-supplier to some of the world’s ting capabilities can reach 0.005\" in scale. However, the divisionmost recognizable brands in agri- in thickness.culture and the off-road industry has now developed into a high-has been quite an accomplishment Photos fromfor the rural Indiana, USA-based Ulbrinox 20 year tech manufacturing facility alongcompany. anniversary with robust slitting and inventory Company President, Tony celebration.Pesaresi, commented in a brief control capabilities.presentation, “We honor thosewho have gone before us and who Ulbrich offers congratulationshelped us get to where we aretoday, and we invite those of you to all Ulbrinox employees and tohere today to join alongside us tohelp take us on the journey over the entire company on 20 years ofthe next 70 years.” www.winamaccoilspring.com proudly serving Ulbrich’s custom-Winoa Opens ers in Mexico and beyond. AndEco-Friendly Steel Abrasives Plant Ulbrich said it looks forward to Winoa reports that the com- many more years! pany has recently opened theworld’s most eco-friendly steel www.ulbrich.com Continued...abrasives plant, which is locatedin Balmaseda, Spain. According to Winoa, this newhigh-tech production factory iscurrently the world’s most envi-ronmentally friendly steel shotmanufacturing facility. The Balmaseda site relies onthe most modern productiontechniques in order to reduce itsenvironmental footprint. Theseproduction techniques include adual purification system to ensure8 Wire Forming Technology International/Fall 2018

Corrosion has always been our favorite subject. Where does the unique quality of our products come from? It’s very simple: from our unique knowledge of corrosion. Bene t from the expertise, commitment and know-how of our globally networked team of engineers and corrosion experts. More about Dörken MKS – The Corrosion Experts at www.doerkenusa.com

Tool King Adds NEWS WIRE Shinko Machinery is Tensile Testing Now a Distributor ing center. A new air conditioning for Numalliance Tool King Inc., Wheeling, IL, system has also been installedUSA, reports that it has recently throughout the building. Shinko Machinery Co., Ltd.,acquired a tensile testing machine. headquartered in Osaka, Japan,This investment allows ToolK- The new dedicated work space is now the Japanese distributoring Inc. to now provide physical will accommodate five members of for the French bending machinetesting (tensile, yield and elon- the CAD design, production and manufacturer, Numalliance.gation) for any of the flat rolled material controls team. The teammetal products provided by the will be able to design components Numalliance is a long-estab-company. To obtain additional on new computers using the lat- lished manufacturer, and has ainformation on Tool King’s new est CAD tool design technology, solid reputation for new tech-tensile testing capabilities, visit which also links directly to the nologies. In addition to its springthe website below. EDM and machining center. processing technologies, now as awww.toolkinginc.com Numalliance distributor, Shinko Every single component is Machinery Co., Ltd. intends toHigh Export Sales designed and manufactured in- make various proposals for wireat Southern Springs dividually by SSP to suit the processing. www.shinko-mach.co.jpSpurs Investments requirements of customers. This new dedicated ‘design space’ Schnell to Supply South of England-based spring will enable the team to produce ArcelorMittal manufacturer, Southern Springs tailored designs in a modern and Zenica Plantand Pressings Ltd. (SSP), has spacious area.posted a record 52% increase in ArcelorMittal continues toexport sales in the company’s The new space will also allow invest in the Zenica mill not only2017/18 accounts. The increase in Production Manager, Mike Hales, in maintenance and revisions, butexports contributed to the com- to focus more on the production also in increasing the productionpany’s increase in turnover of 35% process throughout the factory, capacity and the environmentalin 2017/18, with pre-tax profits also as well as providing a dedicated protection, especially in dust emis-up by 80%. hub to source materials that meet sion reduction projects. customer requirements. Having secured more press The company’s CEO, Biju Nair,work throughout the last 12 SSP also celebrated 70 suc- has expressed satisfaction withmonths, the business has contin- cessful years of trading, having these projects, “For the citizens ofued to re-invest with a new tool opened its doors for the first time Zenica it is important to know thatdesign and production office. The in April 1948. With the contin- ArcelorMittal invests in the bestnew office will allow the team ued demand for press work, the and most advanced environmentalto design components using the company has purchased an addi- protection technology. The com-latest CAD tool design technol- tional two CNC Power Presses in pany is working full-time for itsogy, which will also link directly order to increase capacity and is historic generative review project.through to the EDM and machin- planning on increasing the work ArcelorMittal Zenica is a company space and machines in this area that invests in the future.” over the next year. There are also plans to purchase new ovens and In addition to the two environ- de-burring machines. mental protection projects, Arce- www.southernsprings.co.uk lorMittal Zenica continues with significant investments to increase Group photo at the production capacity. The new Southern Springs project, entrusted to Schnell SpA, includes the installation of a new and Pressings. line at the Factory for Construction Armature in Valjaonica, where10 Wire Forming Technology International/Fall 2018 completion is scheduled for Janu- ary 2019. The most important and em- blazoned European manufactur- ing companies of machines for the production of electro-welded

WIRE DIAMETERCMM-12-236 R 0.60 - 2.30 mmCMM-12-450 R 1.20 - 4.50 mmCMM-12-610 R 2.50 - 6.00 mmCMM-15-660 R 2.50 - 6.00 mmCMM-12-680 R 3.60 - 8.00 mm

mesh participated in the compe- NEWS WIRE Streit.tition for the assignment of the Mechatronics technicians in-project and the partner selection emony and best wishes for successcriteria by which ArcelorMittal for their start into a professional clude Patrizia Heizmann, Thomaswill work for the coming years career. Keller, Tobias Wagner and Sebas-have been numerous. tian Weizbauer. In his speech, he stressed the The first criteria taken into importance of training for Bi- Electronics technicians for au-consideration was the technical hler, “This year, we have further tomation technology include Josefcharacteristics of the machines and increased the number of newly Gebler and Felix Kraus.the expected production. The sec- recruited apprentices to counteractond criteria concerned the logistics the shortage of skilled workers. Industrial electricians includesolutions built upon a thorough We want to make sure that we David Brand, Dominik Frech andstudy of the plant layout, and can recruit an adequate number of Jonas Klatt.finally the environmental protec- specialists and managers from ourtion that has become an important own ranks and from the region for Technical product designersgoal for ArcelorMittal and which current and future tasks.” include Magnus Guggemos andSchnell has always pursued since Christian Hindelang.the adoption of servomotors mak- Currently, 78 young men anding its machines reliable, accurate, women are in their practical train- Industrial clerks include Annafast, low-noise and environmen- ing at the Bihler locations, Hal- Greisl, Angela Hämmerle andtally friendly. blech and Füssen. We are fortunate Selina Maier. www.bihler.de that this includes more and more The project includes the in- young women who are eager Orii & Mec Corporationstallation of the cold rolling line to learn a technical profession. Completes Change COLDRIVE MV 4/12, which will This year, 26 apprentices have in Parent Companyguarantee a constant and high- completed their training with fly-quality coil production, and that ing colors and all of them were In accordance with the Noticeof the Mesh Line CC 2500F, which permanently employed as highly of Change in Parent Company thatwill ensure the production level qualified specialists. was issued on August 8, 2018, therequired by ArcelorMittal. transfer of all shares in Orii & Mec The experienced and highly Corporation from Namura Ship- “With the installation of the motivated team of instructors en- building Co., Ltd. to AMADASchnell plant, the mesh production sures that Bihler trainees regularly HOLDINGS Co., Ltd. was com-in this factory will double,”said receive awards for their excellent pleted on October 1, 2018.ArcelorMittal’s Sales Deputy, results from the Chamber of In-Alena Kahrimanovic. dustry and Commerce. During Orii & Mec Corporation herebywww.schnellgroup.com the first days of their training, the announces that AMADA HOLD- new trainees receive an in-depth INGS is now the firm’s parentNew Apprentice introduction to their areas of re- company. www.oriimec.co.jpGroup at Bihler sponsibility and learn more about the company structures. A first Grueber Plant On September 3, 2018, 26 new highlight of this week are the two Now Certified to apprentices and two dual stu- team development days, where DIN EN ISA 9001:2015dents between the ages of 16 and the trainees grow together as a25 with all kinds of educational dedicated team. In August 2018, TÜV NORDbackgrounds started their exciting carried out another audit at thetraining with Bihler of Germany. Toolmakers include Franz Grueber plant in Hagen, Ger-Company Director, Mathias Bi- Bilger, Nikolaos Boldt, Lukas many, which again confirmed thehler, welcomed the young men Driendl, Florian Etschmann, company’s ISO certification. Theand women with an opening cer- Vincent Gierl, Lorenz Heringer, Grueber plant quality manage- Fabian Hipp, Megan Könne, ment system was certified accord- Johannes Lang, Nico Leitner, ing to DIN EN ISO 9001:2015 as Niklas Lochbihler and Sebastian part of the company’s consistent and reliable quality standards, Group and as result, the Grueber plant photo of can serve as a key factor for inter- apprentices national business relations. at Bihler. Interested parties can down-12 Wire Forming Technology International/Fall 2018 load the current ISO certificates in languages including German, English, Chinese, French or Ital-

NEWS WIREian, at the Grueber website below. are available in a variety of colors No Re-Election www.grueber.de such as yellow, purple, blue, red, green, gray and black. for SCHMOLZ + Fort Wayne Metals Wins New Patent Fort Wayne Metals Research BICKENBACH’s Eichlerfor Braiding Robbon Products Corp. is a leading manu- facturer of high-quality materials, The Chairman of the Board of Fort Wayne Metals, Fort Wayne, precision wire, strands, cables and Directors of SCHMOLZ + BICK-IN, USA, was recently awarded a component assemblies engineered ENBACH, Edwin Eichler, hassecond patent for its Endura® for medical devices and other de- a positive personal record afterbi-tapered bobbin. The specially manding applications. more than five years and will notdesigned bi-tapered flange feature www.fwmetals.com stand for re-election to the Boardhelps to prevent snags and breaks, of Directors at the next Annualand helps wire payoff the spoolmore easily, an improvement to TeILncehDDaniodsoueclbrolsgeytypical processing that providesreturns with less machine down- Jack and Jeff Shoemaker, second and third generationstime, higher product yields and continuing the tradition at Anchor Abrasives.overall cost savings for customers. Certified to ISO 9001 since 1994. “We created the Endura bi-tapered bobbin to help our cus- At Anchor Abrasives we specialize in the design andtomers,” said Product Manager, manufacture of resin, epoxy and oxychloride bonded nut insertedEric Dorman. “When we first pat- discs and cylinders...plus centerless and rollwheels.ented the technology for use withbraiding machines, we were able Today, in our modern manufacturing facility, we are ready toto offer customers a solution for continue our tradition of innovative quality products and unmatchedmany of the issues they encounter customer service. For more information contact Anchor Abrasivesin their processes. Being awarded Company, 7651 West 185th Street, Tinley Park, IL 60477 U.S.A.this second patent for the physical Phone: 708-444-4300; Fax: 708-444-1300.bobbin really speaks to the waythis technology contributes to the www.anchorabrasives.comindustry.” In 2015, Fort Wayne Metals de-veloped and patented Endura bi-tapered bobbin technology for usein conjunction with industry stan-dard braiding machines, provid-ing customers with ready-to-usebraiding bobbins already loadedwith high-quality wire. Now,Fort Wayne Metals has received asecond patent for the bobbin itself.When coupled with Fort WayneMetals’ technical experience andunderstanding of its materials,the Endura bi-tapered bobbin’sangled flange design helps to pre-vent pileup during spooling, andreduces the potential for flangetoe-in during payoff. The bobbins145821 ANCHR_DiscTechAd.indd 1 Fall 2018/Wire Forming Technology International 13 8/16/17 8:37 AM

NEWS WIREGeneral Meeting. meal in a relaxed setting. the North Atlantic Treaty Organi- Eichler has decided to leave the Architect Michael Frey of the zation (NATO).Board of Directors of the world’s Architectural Offices Schmelzle Between 2012 and 2015, Mercierleading special long steel producer & Partner had already been in was Chief of Staff of the Frenchbased in Lucerne at the next An- charge of the technical assembly Air Force. Since 2015, he has beennual General Meeting, scheduled center TECHNIKUM 1, the pro- NATO Supreme Allied Com-for April 30, 2019. Eichler has been duction department of the Test mander Transformation, a roleChairman of the Board of Direc- Systems Division as well as Lo- which ended in September 2018.tors of the company since 2013 and gistics. After this great success, hewould now like to turn to other will again be the Lead Construc- Mercier has received the awardsprojects. He explains the timing of tion Manager this time. of Grand Officier de la Légionthe announcement by stating that d’honneur (Grand Officer of thehe wants to give the company time With a groundbreaking cer- Legion of Honor) and Officier deand opportunity to find a suitable emony, President Felix Förster, l’Ordre national du Mérite (Officersuccessor. GM Thomas Himmler and Head of the National Order of Merit). of HR Dirk Heimann gave the www.fivesgroup.com Eichler draws a positive person- official go-ahead for constructional balance of his time on the Board to start working on the new com- EUROBEND of Directors and sees the sustained pany building. Architect Frey and Installs Welding good earnings development of Max Bachteler, Manager of the Line in Denmarkrecent years as well as the solid, civil engineering company, JMSfuture-oriented strategic position- GmbH & Co. KG, assisted with In addition to its broad range ofing of the company as the right their spades and Mr. Förster did welding lines for the production ofmoment for his personal farewell. not pass up the chance to excavate standard and specialized construc- some dirt with the big excavator tion mesh, engineering, precast or Until his departure, Eichler will shovel himself. architectural mesh, EUROBENDcontinue to fully perform his du- GmbH offers a full range of au-ties on the Board of Directors and The celebration concluded with tomatic welding machines for theaccompany the succession process. cool drinks and ice cream on this production of all types of bar spac-www.schmolz-bickenbach.com hot late summer afternoon. ers/supports, wall ties/girders and www.foerstergroup.com similar products.FOERSTER Expands & Modernizes HQ Denis Mercier to The latest installation of the Deputy GM at Fives company’s PLR TRUSS welding Institut Dr. Foerster GmbH line took place in Køge, Denmark,& Co. KG makes a major invest- Denis Mercier has joined Fives, for the customer,ment in the expansion and mod- Paris, France, in the newly created Pretec. Pretec hasernization of its headquarters in Deputy General Manager position, a strong presenceReutlingen, Germany, further following his career in the military.strengthening its development de- Directly reporting to Frédéric San-partment and giving its employees chez, Chairman of the Executivelong-term job security. Board, he will join the Group’s Executive Committee. The new building will be hometo the technical assembly center Mercier’s main du-TECHNIKUM 2 and the new ties will be supervis-cafeteria. TECHNIKUM 2 will ing all Fives func-host water-coupled ultrasonic tional departmentstest systems and other projects. involved in groupTo bring the development and transformation: Op-system engineering departments erational Performance, Humanup-to-date, the current offices will Resources, Communication, In-be remodeled and the hallway will novation, Strategy and Marketing,be transformed into a bridge creat- International Development and IT.ing direct access to the cafeteria.Acting as a social meeting place, Fives will benefit from Mer-employees and guests alike will cier’s extensive experience inhave the opportunity to wind implementing transformationdown from their busy schedules projects in complex environments,while enjoying a freshly cooked which he acquired throughout his career in the French Air Force and14 Wire Forming Technology International/Fall 2018

in Denmark as well as in Sweden, NEWS WIRE used in many industries includ-Finland and Norway, supplying ing oil and gas, food, agriculture,precast companies with a large from Tech-Mesh, the company building and construction, aero-selection of products, inclusive can fabricate its own demisting space and mining. CWI makesof the company’s wall ties, which products. And CWI can fabricate coalescers for refineries, filtrationwill be produced by the new PLR your unique demister because the systems for environmental con-TRUSS welding machine. company has the wire, the equip- cerns and ventilation for HVAC ment and the knowledge that will systems, indoor pools and restau- This latest machine version of allow it to provide precisely that rants. Causgrove is thrilled by thethe EUROBEND PLR TRUSS, is which is needed by the customer. variety as each industry will pres-also equipped with an automaticbundling unit. This capability allows Centralwww.eurobend.com Wire Industries to work closely with the end user of its materials.CWI Offers Wires for And the company wants to workMist Elimination even more closely with end users, and has the assets to foster that. Central Wire Industries (CWI)recently fully entered the demister CWI engineers, metallurgistsmanufacturing business. Previous- and welders stand at the ready toly, the company had been part of help clients determine what willthe industry as the provider of spe- best serve their needs and fit theircialty alloy wire for other compa- equipment.nies that make knitted mesh. NowCWI has acquired state-of-the-art Mick Causgrove, a CWI techni-equipment to use its high-quality cal sales pro in Houston TX, USA,wire to produce Tech-Mesh™, and leads the team. Causgrove is a chemical engineer with more than 10 years’ experience in separations technology. The Tech-Mesh product can be Barbed Wire System Chain Link Weaver-500 Fall 2018/Wire Forming Technology International 15

NEWS WIREent its own needs and challenges. solutions to its targeted markets and many material and finish op-It could be pulling the liquids from and customers. tions. Global flexibility means thatthe air, natural gas or other vapor wherever your design or produc-streams. Carpenter Technology Corpora- tion is based, Lee Spring can offer tion is a recognized leader in high- a service package from concept of “We want to make sure the performance specialty alloy-based new products to redesign of legacyproduct is right for you,” says materials and process solutions items. Many spring examples wereCausgrove. www.centralwire.com for critical applications in the on display at the show with expert aerospace, defense, transporta- engineers discussing applications.Carpenter Technology tion, energy, industrial, medical and consumer electronics markets. Based on its team of expertIs Now AS9100 www.cartech.com sales engineers, Lee Spring has become the UK supplier of choiceRev D Certified Lee Spring Exhibits for over 25,000 cataloged and at the Engineerng custom springs including com- Carpenter Technology Corpo- Design Show pression springs, torsion springs,ration, Philadelphia, PA, USA, a constant force springs, die springs,leading producer of premium spe- Lee Spring, Wokingham, Berk- Belleville spring washers, wavecialty alloy-based solutions for the shire, UK, presented its new springs, extension springs, batteryaerospace industry and other key catalog of over 25,000 standard springs and numerous specialitymarkets, recently announced that springs at the recent Engineering springs. Materials include steel,its additive manufacturing (AM) Design Show at the Ricoh Arena, stainless steel, cobalt/nickel alloy,production facility in Camarillo, Coventry, UK. bronze, brass, music wire andCA, USA (CalRAM LLC), has composite plastics. In addition,achieved AS9100 Rev D Certifica- Visitors were provided with Lee Spring offers extensive customtion for its Quality Management advice for their project at whatever design and manufacture servicesSystem. CalRAM is a leader in stage—whether back of the enve- for one-off/prototypes or ongoingpowder-bed fusion additive tech- lope or fully developed design. production requirements. nologies used to manufacture Design engineers, production www.leespring.co.ukparts for the aerospace, defense, engineers, manufacturers andpower generation and oil and gas fastener buyers were welcomed CASMI Dinner industries. to the booth. Meeting in November CalRAM previously achieved The new Lee Spring catalog CASMI invites you to joinNational Aerospace and Defense of over 25,000 standard parts in- your fellow CASMI membersContractors Accreditation Pro- cludes 2000+ new items including for the November Dinner Meet-gram (NADCAP) certification to 500+ new compression springs ing on Thursday, November 15,produce aerospace parts using in metric DIN-Plus dimensions, 2018, at Maggiano’s Little Italy,electron beam and laser powder- new extension springs in SS316, in Oak Brook, IL, USA. Up tobed fusion technologies. The new torsion springs in SS316 and three individuals from CASMIcombination of AS9100 Rev D and added High Pressure compres- member companies (Primary andNADCAP quality certifications sion springs including new 600 Associate) can attend at no cost.illustrates the company’s com- PSI designs. Additional individuals from themitment to achieving the highest same company can be registered atquality standards and continues to The Lee Spring philosophy the rate of US$50 per person. Thisdifferentiate Carpenter’s additive makes finding the right specifica- event is only available to membermanufacturing capabilities. tion simpler with many features companies and their employees. such as grinding and plating op- Carpenter also recently in- tions, alongside additional avail- The dinner schedule is cocktailsstalled a new Arcam EBM Q20plus able services such as first-article at 5:30 PM, a presentation at 6:30AM printer at the Camarillo site inspection, blanket agreements PM and dinner at 7:15 PM.to complement its existing port-folio of electron beam and laser Member Roundtables will fo-capabilities. Specifically designed cus on the competitive futurefor the efficient production of and members’ workforces. Dr.aerospace components, the high- David Boulay, President, Illinoispower electron beam technology Manufacturing Excellence Centerfeatures advanced controls and an (IMEC), will moderate this sessionincreased build envelope. With the of member roundtables address-deployment of this new printer, ing the skills gap challenge facingCarpenter Technology is now ableto deliver larger AM component16 Wire Forming Technology International/Fall 2018

manufacturers today. Boulay will NEWS WIRE during a six-day public hearingnot be presenting, but will helpthe audience, through breakout USTR Finalizes Tariffs in August. USTR engaged in aroundtable discussions, build on Chinese Productsupon the presentation and discus- thorough process to rigorouslysion that took place at CASMI’s The Office of the United StatesMarch 2018 meeting including Trade Representative (USTR), examine the comments and tes-why we face this challenge and Washington, DC, USA, releasedhow we can act both within our a list of US$200 billion worth of timony, and then determined tocompanies and together as an in- Chinese imports that will be sub-dustry to achieve success. ject to additional tariffs. Included fully or partially remove 297 tariff are springs, wire formed parts, As President of IMEC, a public- wire, rod, mesh, fencing, and pins. lines from the original proposedprivate partnership with the mis- By direction of President Trump,sion to be a catalyst for transform- the added tariffs became effective list. Included among the productsing the state of manufacturing, September 24, 2018, and initiallyDr. Boulay focuses his passion amount to 10%. On January 1, removed from the proposed listat the intersection between eco- 2019, the tariffs increase to 25%.nomic development, workforce are certain consumer electronicsdevelopment and manufacturing The list contains 5745 full orcompetitiveness. partial lines of the original 6031 products such as smart watches tariff lines that were on a pro- With more than 30 years’ of posed list of Chinese imports an- and Bluetooth devices; certainexperience in manufacturing, nounced on July 10, 2018. Changesuniversity and nonprofit settings, to the proposed list were made chemical inputs for manufacturedDr. Boulay brings a broad under- after USTR and the interagencystanding to his work. Section 301 Committee sought goods, textiles and agriculture;www.casmi-springworld.org and received comments over a six-week period and testimony certain health and safety products such as bicycle helmets and child safety furniture. In March 2018, USTR released the findings of its Section 301 investigation that found China’s acts, policies and practices related to technology transfer, intellectual property and innovation to be un- reasonable, discriminatory and restrictive to USA commerce. www.ustr.gov Continued... Fall 2018/Wire Forming Technology International 17

NEWS WIREAWI Shows Products Advanex to Open New Europe is proud to announce that the company has been success-for Aerospace Sector Site in Czech Republic fully verified in its transition to the new AS9100 Rev D standard—the The great/good of the world’s Advanex of the UK is pleased world’s most recognized qual-aerospace sector was out in force to confirm the opening of a new ity management standard in theat the Farnborough International Air- manufacturing site in the Czech aerospace industry. show 2018 and Alloy Wire Interna- Republic in Spring 2019. The new www.advanex.co.uktional (AWI) was grabbing some purpose-built 7300 m2 factory willof the supplier headlines with its be located in Horní Počernice. SECO-VACUUM speed of delivery and size of wire. Furnace Supplied to The new factory comes as Global Manufacturer Exhibiting at the show for the part of the company’s ambitiousfourth time, the company received growth plans in Europe. The new A global manufacturer hasnumerous inquiries for its high- factory will involve an investment chosen SECO/VACUUM, a SECO/performance alloys ranging in of €5 million in the Czech Republic WARWICK company, to supply aapplications from very fine wire over the next five years. second vacuum furnace to its USA-mesh, aircraft locking wire and based manufacturing operations.wire pins for electrical connectors As a leading supplier of preci- This second furnace, a vacuumto springs and electrical resistance sion components, this new factory temper furnace for tempering andwire for aircraft potentiometers. will be largely focused on manu- stress relieving metal parts, is part facturing precision deep drawn of the company’s new USA-based Stand visitors were impressed metal components, stampings, manufacturing expansion andwith the three-week lead time AWI springs and pressings. becomes a centerpiece in a newcould provide from taking the or- processing line for the company.der specification to delivering to Advanex is working closelyfactories all over the world. with P3 in Prague to ensure that This horizontal, front-loading the project management of the furnace is designed specifically “Over 80,000 trade visitors at- new factory runs seamlessly. for the customer needs with an all-tended Farnborough and we were The P3 logistics park on which metal hot zone for clean vacuumpositioned in a great location, with the new Advanex factory will be processing. The unit includes aPrime Minister Theresa May, located is the largest within the convection fan and a pressurizedMark Carney (the Governor of the Czech Republic. The facility will gas quench for quick cooling.Bank of England) and Astronaut be designed to accommodate twoTim Peake all visiting and making floors of office space and will have After weighing design, costspeeches in our hall,” explained state-of-the-art machinery and and delivery options from mul-Stephen Olley, Sales Executive production lines. The company tiple furnace manufacturers, theof AWI. “It created a lot of interest will embark upon a recruitment customer chose SECO/VACUUMand meant we had a lot of footfall drive boosting employment in this thanks to the company’s specialto the stand, which was ideal see- area of the Czech Republic.ing we were launching our firstever corporate film, showcasing And in other news, Advanexthe Alloy Wire operation and whatmakes us different in just three Vacuum temper furnace supplied by SECO-VACUUM forminutes. tempering and stress relieving of metal parts. “Everyone was impressed andit provoked conversation aboutthe size of our 200-ton stockhold-ing, our technical expertise andthe fact we can supply wire up to21 mm in diameter. Some peopleeven questioned whether that wasstill wire. “The event was great for catch-ing up with existing clients andalso for meeting potential newcustomers, the latter were imme-diately impressed with the factwe hold the AS9100 Aerospace &Defense approval.” www.alloywire.com18 Wire Forming Technology International/Fall 2018

vacuum temper furnace design, NEWS WIRE site in Redruth fromcompetitive pricing and timely Indian Queens—delivery. SECO/VACUUM offers 4000 m2 with the purchase of new we then extendedvacuum furnaces of all type, sizes premises in Penryn, Cornwall. that factory to meetand capabilities from vacuum demand, and haveoil quenching and low-pressure Michael Gibbs, Managing been rapidly out-carburizing to high-pressure gas Director of European Springs & growing our cur-quench. Even basic units such as Pressings in Cornwall said, “Pur- rent premises ever since. And thisthe vacuum temper are part of the chasing the new Penryn-based year we have invested more thanbroad range of offerings. factory is a really exciting new £3 million in new infrastructure,www.secovacusa.com chapter for everyone in European machinery and technologies, Springs & Pressings and a fantastic which is a strong indicator ofEuropean Springs & achievement in our 70th year. This the strength of manufacturing inPressings Expands significant investment allows for the region and we’re delightedwith Third Factory continual growth across our in- to be further investing in, and dustrial and automotive product supporting, the southwest’s £14 European Springs & Pressings, divisions and affords new oppor- billion manufacturing industry.”one of the UK’s leading spring and tunities for expansion across the www.europeansprings.compressing suppliers, has doubled sites in Redruth and Penryn.”the size of its Cornwall, UK opera- Asterion Announcestion with the purchase of a new The new site will specialize in QMS Certification &2000 m2 site. The spring manufac- the industrial element of the busi- New Appointmentsturer, with factories in Redruth, ness, supplying springs to sectorsCornwall and Beckenham near ranging from aerospace to rail to Asterion, LLC, Indianapolis,London, has multiplied the size the food and drink sector. IN, USA, has announced certifi-of its southwest operation to over cation to the ISO 9001:2015 Qual- Gibbs concluded, “In the last year, turnover in Cornwall has in- creased by 40% and we’ve grown from a team of 43 to over 60. Five years ago we relocated to a larger Fall 2018/Wire Forming Technology International 19

NEWS WIREity Management System (QMS). strate testing and analysis. uniformity of ±0°F at 425°F wasVerisys Registrars conducted theindependent, third party certifica- Also, Graham Torr has been documented to meet AMS 2750E,tion and issued Certificate Num-ber A101013. appointed Director of Technical Class 2 furnaces and instrumenta- ISO 9001:2015 certification de- Services by Asterion, tion Type C requirements.notes that Asterion is compliantto the International Standards LLC. Torr is responsi- “For this project, heating capa-Organization (ISO) quality man-agement system and has demon- ble for the direction of bility was a top priority. To ensurestrated its ability to consistentlyprovide products and services the Asterion technical that the heating performancefocused on enhancing customersatisfaction. It is the only standard services team includ- provided optimal part results, wein the ISO 9000 family againstwhich third-party certification can ing the company’s provided product testing per ourbe carried. advanced analytical laboratory, customer’s load specifications,” Blair Vandivier, President andCEO of Asterion said, “Earning customer product training, ap- said Gene Vetter, Senior Applica-ISO 9001:2015 certification dem-onstrates Asterion’s firm com- plication support and installation tions Engineer.mitment and robust capabilitiesto provide best-in-class plating, of Asterion® pretreatment, plating Unique features of this temper-pretreatment and applicationssolutions to the surface finishing and powder coatings processes. ing conveyor oven include guar-industry.” Prior to joining Asterion, Torr anteed temperature uniformity of Asterion, and formerly Bench-mark Products, has been continu- was the U.S. national sales man- ±0°F at 425°F, one profile openingously registered to ISO 9001 (vari-ous iterations) since 1986. ager for a global provider of deco- for each end, one personal access Asterion products and services rative, functional and specialty door in each zone (two total),are backed by an advanced ana- coaPtrinesgss.Release programmable temperature con-lytical laboratory, which performsa range of chemical analyses that Additionally, Heather Lemieux troller with auto-tune and over-comply with industry standards hasWjoisincoendsiAn sOtveernioSnh’ispsgTroemwpinerging CotnevmeypoerraOtvuerne tporTooteocltMioann.ufacturerand government regulations. Con-ducted by the company’s highly teaEmastoTfrotye,cWhIn–iAcuaglussat 2l1e,s20e1n8g, Winiseceornssi.ntrained team of quality and techni-cal services engineers, testing in- Oven CorporaLtioenmanineouunxceidsthreesshippmoenn-t ofcludes chemical composition and camonanenvuleefycaotcrrticuoarvellery.ntshTotieohbmaealteebetdeofrlosotltvcaraonancnddlvraueeerdyeqaouttrtwiiphonomvrgzeeoonncuntwuegilslh-betrace analysis to determine com- used to tempetrhsteeeslaplaertss aannddhassethreviceposition, impurities and overallchemical quality for a diversity of capability to heoaft 1,t8h00epocuondms opf satenelyfr’osmapplications. The laboratory also 70° F to 425° Fpwl aithtiinnagonep(r1)ohcoeurstsimeeshouses instrumentation to quickly period. ,identify and resolve contamina-tion issues, determine sample pre-treatment chemistries andmake-up and provide metal sub- poTdwihmedetneesmriopnecsroinoagf 3to’i0vne” nwgihdsaesixwn3o4r’Ok0”chhloainmogbaeanrdn1d’6” Kenhigtuh cakndya. LmeamximiuemuxopceoramtinegstetmopAersattuer-e rioonf 5w00it°hF.aGduairvaentreseed bteamcpkergartuoreuunndifoirnmity This belt conveyor oven was tecohfn±1o0l°oFgayt 4a2n5°dF cwuasstdoocmumeernsteedrtvoimceee, t AMS 2f7u5l0lEy, Cfalacssto2rfyurntaecsetseadndaInnsdtrumadenjtuatsiotned whTiycphe iCnrcelquuidreemsenfitsv.e years of expe- prior to its shipment. All safety rwiewnpwrco“.eFvaiodsirenttdehrtiosihpoptenirmosojaetilcclpt.,caahrontemradetisnguglatscGsawepienanebpdirVliotueyvtsitwdetearr,dsySpa.erontodiopurcpAtriptoeioprnsilptitcytina.eegtTrriooplanoeetsrcinEooksununsrgrecianauterhsneeatordtmcthheterhe’hsceelokaateeindqdgsuppfeeiopcrfriofmircpmaertainoonncptse.ei”sr- operated at the normal and maxi- Wisconsin OvenUnique features of this tempering conveyor oven inmcluudem: operating temperatures. • Guaranteed temperature uniformity of ±10°AF ant 4e2x5°teFnsive quality-assurance Supplies Tempering• • Conveyor Oven• One (1) profile opening for each end wzoitnhectah(hutwteeoo-cetuktoqntleauils)ipt wmaesnctommeptleatlel dWtoisecnosnusirne One (1) personal access door in each Programmable temperature controller Wis• coOnvesr itenmpOeravtuerenproCteoctriopn ora- Oven quality standards. This tion, East Troy, WI, USA, has equipment is backed by Wisconsin ealnenTaAcnhltoldrissuiamcbfneeaatlxcltyilemcyinodutnemhvretleooyhacpokeetrseroaadsvtriehnengsictwptheaaemmnsckpdfeeueadlnrlayrfttodfuarrocepttsfrowo.rpAyaoentner-esoxtpeteedrnaastniivodOeendaqavduenjeuandslnittttyhee’edsadsepsqErTiuuohxrirapcrtnmoelcesueenh-cstiYphiismevecoeaekpnreltiasrWfartnotwemOddasoaWuUtcroth™fmnaecppnillweiorttyreeam.dcra--l zontoeecnsounrevteheyoeqruiopmvennt mtoet alltWooiscloannsindOven quraalintytsyta(npdaarrdtss. Tohnisleyq)u.ipment is backed by equWiipscmonesinntOmvean’ns uExfcalcutsuivreearn.d Unprecedentedw3-wYewar.wWiOsWov™enw.acroramnty (parts only). The belt conveyor oven will be used to temper steel parts and FENN Welcomes New has the capability to heat 1800 lb Account Managers of steel from 70°F to 425°F within a one hour time period. FENN Sales Manager, Mike The tempering oven has work Geiger, has announced the ad- chamber dime2n67s5iMoAnINsSToRfEE3T '│0E\"ASwT TRidOWYe,IWSIO53V1E20NUd.CSiAOt│iMoT. n262o.64f2.A393c8c│oF.u26n2.t363M.40a18nager, John x 34'0\" long and 1'6\" high and a Cravaack, to the sales team. maximum operating temperature Cravaack brings over 30 years of 500°F. Guaranteed temperature of valuable metals experience to20 Wire Forming Technology International/Fall 2018

FENN, and will be responsible NEWS WIRE across a variety of industries. Tofor the midsection of the USA, learn more about FENN, visit:spanning from the upper midwest mercial role, while covering the www.fenn-torin.comdown to Texas. east coast and western regions of the USA. His territory expands New at wire 2020: Prior to his new to international territories where Special Section forrole, Cravaackserved FENN does not already have a des- Fasteners & Springsas Regional Sales ignated representative. Addition-Manager for Hynes ally, Campion manages the TSP A new feature at wire 2020, In-Industries, where he product line throughout the USA. ternational Wire and Cable Traderepresented products Fair, will be the separate fasten-from all the Hynes company di- Prior to his position as FENN’s ers and springs exhibition areas.visions including Hynes Steel, Account Manager, Campion most Exhibitor registration starts at theHynes Formed Products and recently held positions at Ulbrich end of January 2019.Rolled Wire Products. Stainless Steel & Special Metals as a Product Manager, Bekaert wire 2020 will take place from Cravaack will be joining FENN Corporation as the Market Manag- March 30, 2020 to April 3, 2020,Account Manager, Kevin Cam- er of North America for Swaging at the fairgrounds in Düsseldorf,pion. Campion joined the FENN Wire & Stainless Steel, and Car- Germany.team in 2017 and brought over 36 penter Technology as a Product Manager for Wire & Rod Group. Messe Düsseldorf, the orga- years of manufactur- nizer of wire 2020, observed the ing industry sales Based in East Berlin, CT, USA, developments in the national and experience to the FENN is a global supplier of cus- international markets for some company, with 34 of tomized metal forming machinery time and talked to exhibitors and those years being in including rolling mills, wire flat- potential customers—always the metals industry. tening and shaping lines, swagers, with a view to being close to theIn his position, Campion brings Turks heads, drawbenches and market and able to respond to cur-a technical perspective to a com- spring coilers. Each product line serves a multitude of applications Fall 2018/Wire Forming Technology International 21

NEWS WIRErent needs of the wire and cable springs, torsion springs, disc by the Spring Manufacturersindustries. With these two new springs and helical springs used Institute (SMI) and led by chairsfasteners and springs exhibition in the automotive industry, me- Chris M. Fazio, GM, Pittsburghareas, Messe Düsseldorf responds chanical engineering, the electrical plant, Diamond Wire Spring; Kel-to market requirements while clos- industry, building technology, op- ley L. Christy, Director of Sales/ing the gap between machinery, tics, office equipment, toys and in Marketing and I.T., Diamondplant, raw materials and finished the fittings industry. These various Wire Spring; and Daniel Pierreproducts at the same time. spring types will also be on dis- III, President of JN Machinery in play at wire 2020 for the first time. East Dundee, IL, USA. “The finished products fasten-ers and springs are especially ideal The global spring market is “With two shows under ourcomplements for the machinery, expected to have had a volume of belt, the trade show committee isequipment and raw materials slightly more than US$20 billion not set to just repeat/regurgitatewe presented at wire in Düs- in 2016 and to grow at an aver- what we did in previous shows,”seldorf so far. This expansion of age annual growth rate of 5.1% to explained Pierre. “We have care-the product range guarantees more than US$32 billion between fully read all the comments (bothwire an additional mainstay with 2017 and 2025. positive and negative) from previ-growth potential from 2020,” ous shows, and we are workingstated Friedrich-Georg Kehrer, The German Spring Federation on several changes and improve-Global Portfolio Director Metals (Verband der Deutschen Federn- ments based on this feedback.”and Flow Technologies at Messe industrie e.V. (VDFI)) reports thatDüsseldorf. the output of industrial springs David L. Lawrence Convention in Germany in 2017 amounted to Center, venue for the 2019 SMI Fasteners at wire 2020: The mar- some 440,000 tons with a value ofket volume for fasteners des- €2.3 billion. 355,500 tons of these Metal Engineering eXpo™.tined for the automotive industry were exported. The German springalone is expected to have reached industry consists of around 180 Metal Engineering eXpo hasaround US$20 billion globally in spring factories employing 12,500 developed two distinct strengths:2017, almost US$21.5 billion in people. exhibitors showing new equip-2018 and to grow at an average ment and the Technical Symposia.annual growth rate (CAGR) of An on-line video describing the2.4% to over US$25 billion by 2025. potential of the industrial fastener “We will work with presenters and spring industries can be found in conjunction with our education According to the Deutscher at the website below: and technical committees to tailorSchraubenverband e.V. (DSV– www.wire.de/fastener_springs content specific to the needs ofGerman Screw Federation), springmakers,” said Pierre. “We796,000 tons of fasteners worth For further information on are also finding new ways to help€3.3 billion were produced in Ger- visiting or exhibiting at wire 2020,many in 2017, one of the leading contact Messe Düsseldorf Northproducing and exporting coun- America (MDNA), 150 Northtries for screws and fasteners. Of Michigan Avenue, Suite 2920,these, 794,000 tons (€4.5 billion) Chicago, IL 60601, USA.were exported. The same year thecountry imported 895,000 tons Call +1 312 781 5180, send a faxof fasteners. The German screw- to +1 312 7815188, send an emailmaking industry comprises some to [email protected] or visit the50 manufacturers with a total of websites listed below. about 8000 employees. www.wire-tradefair.com www.mdna.com Apart from the automotive in-dustry and its OEMs, the principal Plans Taking Shape buyers of fasteners are producersof household appliances, electri- for 2019 SMI Metal cal equipment and furniture andthe construction industry as well Engineering eXpo™as machinery, apparatus andsteel engineering. These are also Gary McCoy, Managing Edi-new target groups with different tor, Springs, reports that with lessdemands. than a year to go, plans are being finalized for the 2019 SMI Metal Industrial Springs at wire 2020: Engineering eXpo™, October 1 toIndustrial springs included coil 3, 2019, at the David L. Lawrence Convention Center in Pittsburgh, PA, USA. The expo is sponsored22 Wire Forming Technology International/Fall 2018

exhibitors highlight ‘what's new,’ NEWS WIRE • October 3: 9 AM to 9:50 AM,whether it is a new machine, a new Technology Track, “Newfunction, or even new personnel.” erating Excellence…A Quest Developments for the En- for a Higher Performance Or- hancement of Producing Wire The 2019 eXpo Technical Sym- ganization”, by Vince Bovino, Forms”, by Dr. Peter Weig-posia features a variety of topics Bovino Consulting Group. mann, WAFIOS.surrounding the design, engineer- • October 2, 9 AM to 9:50 AM,ing and production of springs, the Manufacturing Track, Off-site networking events havewireforms and stampings. Several “Crawl-Walk-Run Your Way been a popular feature of the SMIspeakers have already been con- into Additive Manufactur- Metal Engineering eXpo. The 2019firmed. These are as follows: ing”, by Timothy Simpson, eXpo event will continue this• October 2: 8 AM to 8:50 AM, Ph.D., The Pennsylvania tradition with a networking event State University. taking place at the Senator John Business Practices Track– • October 2: 9 AM to 9:50 AM, Heinz History Center from 5:30 “Tax Reform and Its Impact Materials and Testing Track, PM to 7:30 PM on Wednesday, Oc- on Manufacturing”, which is “Bodycote Kolsterising®”, by tober 3. Additional details on this being presented by Michael Derek Dandy, Kolsterising. event will soon be available. Devereux II, Mueller Prost. • October 2: 9 AM to 9:50 AM.,• October 2: 8 AM to 8:50 AM, Technology Track, “New De- The trade show in Pittsburgh, Materials and Testing Track, velopments for Enhancement PA, USA, in October 2019 will “Evaluation of Stress Concen- of Spring Production”, by Dr. mark the third time the SMI Metal trators and Their Effect on Fa- Peter Weigmann, WAFIOS. Engineering eXpo has been held for tigue Life”, by Jason Sicotte, • October 3: 9 AM to 9:50 AM, the North American engineered Associated Spring. Materials and Testing Track, spring and precision metal com-• October 2: 9 AM to 9:50 AM, “Nitinol Shape Memory Al- ponents industries. Business Practices Track, loy”, by Dave Plumley, Fort “Breaking Boundaries for Op- Wayne Metals. For additional informationvisit: www.metalengineeringexpo.org ANBAO Zn-5%Al-Alloy coating or Zn-10% Al coating (GALFAN) wireDiameter1.2 -5.0mm; Coating: 150-400g /m2; Packing: coils or reels Tensile strength: 350-1620Mpa (with low carbon steel and high carbon steel material)ANBAO CORP. www.witels-albert-usa.comAdd: No.33 Qinhuangxi Street, Qinhuangdao, P.R.China, 066000 Fall 2018/Wire Forming Technology International 23Tel: +86-335-3893600 Fax: +86-335-3870760Email: [email protected] Website: www.anbao.net

CASMI News & Events Updateby: Chicago Association of Spring Manufacturers, Inc. Michael Bandy Chicago Association of Spring Manufacturers, Inc. (CASMI) 350 S. Poplar Avenue Elmhurst, IL 60126 USA www.casmi-springworld.orgCASMI Hosts SuccessfulSPRING WORLD® in RosemontSPRING WORLD® 2018 took place October 3 to 5,2018, at the Donald E. Stephens Convention Centerin Rosemont, IL, USA. SPRING WORLD, which ispresented by the Chicago Association of SpringManufacturers, Inc. (CASMI) every other year,provides a unique opportu-nity for spring manufacturers,wire formers, OEMs and theirsuppliers to network including one-on-one discus-sions with colleagues to share challenges, discusssolutions and provide new insights for business.Total registered attendance for SPRING WORLD2018 was approximately 2200. The trade show floorwas comprised of 111 exhibiting companies occupy-ing 31,800 ft2 net of exhibit space. The ratio of buy-ers to exhibitor personnel was up 2% for SPRINGWORLD 2018 when compared to the 2016 event.CASMI is currently conducting an exhibitor sur-vey, and while results aren’t final, exhibitors arereporting brisk sales and meaningful contacts withboth current and potential customers. Addition-ally, preliminary results indicate this year’s showwas successful in meeting or exceeding exhibitorexpectations.In addition to the trade show itself, the event fea-tured several educational sessions—presented byindustry personnel and exhibiting companies—inthe education theater on the show floor, an open-ing reception and an Oktoberfest, sponsored byWAFIOS Machinery Corp., on the trade show floor.SPRING WORLD 2020 will take place October 7 to9, 2020, again at the Donald E. Stephens ConventionCenter in Rosemon. Preliminary information includ-ing the exhibitor floor plan, contract and rules andregulations, are available on the CASMI website at:www.casmi-springworld.orgNext Membership MeetingIs November 15, 2018CASMI will host its next Membership Dinner Meet-ing November 15, 2018, at Maggiano’s Little Italy,Oak Brook, IL, USA.24 Wire Forming Technology International/Fall 2018

This will be a follow-up to the organiza- tion’s March 2018 meeting, where members enthusiastically suggested that CASMI host future moderated roundtable discussions on the topic of “Our Competitive Future and Our Workforce”. The discussion will address the skills gap challenge facing manufactur- ers today. The moderator, David Boulay, President, IMEC, will not be presenting, but will help the audience, through breakout roundtable discussions, build upon the pres- entation and discussion from the previous meeting including why manufacturers face this challenge, and how they can act both within their companies and together as anindustry to achieve success.Details are available on the CASMI website listedbelow, or by calling the office at +1 630 359 4273.CASMI to Host Annual Holiday Party This DecemberCASMI will hold its Annual Holiday Party on Thurs-day, December 13, 2018, in a private dining roomat Carlucci in Rosemont, IL, USA. Members willparticipate in an informal evening of networkingand great food. Each member and guest is askedto contribute a US$5 donation at the door, with theproceeds to be given to the Mercy Home for Boysand Girls to assist the less fortunate during theHoliday season. Details are available on the CASMIwebsite listed below, or by calling +1 630 359 4273.www.casmi-springworld.org WFTI See pages 44-48 for a “Straight FromThe Show” Report on SPRING WORLD® 2018More About CASMI:CASMI was founded in 1944 as an independ-ent, not-for-profit trade association dedicated tothe development of good business practices, andsharing of technical information through ongo-ing communications among the job-shop springmanufacturers in the greater Chicago, IL, USAarea. While membership is predominantly locatedin Illinois, Indiana and Wisconsin, the organiza-tion provides support to spring manufacturer andsupplier members throughout the USA. AlthoughCASMI works closely on several issues with theSpring Manufacturers Institute (SMI), a na-tional organization, both organizations are inde-pendent of one another, with unique missions,programs, services, and members. CASMI spon-sors the SPRING WORLD® Trade Show everytwo years. www.casmi-springworld.orgFall 2018/Wire Forming Technology International 25

All Things by: Springs Randy DeFord, Engineering Manager Mid-West Spring & Stamping 105 Etna St. Mentone, IN 46539  USA E-mail: [email protected] www.mwspring.comUp Against a Wahl Another key indicator of this work is the endorsement by the Spring Manufacturers Institute, which is theFor those familiar with spring design, A.M. Wahl’s key governing body relating to design and tolerancing“Mechanical Springs” is still considered to be the con- for a number of springmakers, both USA and foreign.summate resource for the design of springs. The text Their opening remarks include the comment, “Mr.is a rather complete mathematical explanation of all Wahl’s fine work has endured over the years andfactors related to spring design as well as examples. remains today the standard of Excellence for theAlso, just about every type of spring imaginable is spring industry.”explained including hot coil, volute and cantileversprings. The comment is then signed-off by the SMI Technol- ogy Committee members of the time of the book’sThe book is divided into four sections. printing.Part 1—Spring Materials and General Considerations The next thorough spring design resource is SAE’s Society of Automotive Engineers (SAE), “SpringPart 2—Practical Design of Helical Compression Design Manual”. This work has its primary focus on and Extension Springs stresses as seen by automotive and vehicular appli- cations. It also has a lot of data on leaf springs sincePart 3—Design of Other Types of Springs those suspension methods are still a large part of the automotive and fleet trucking business.Part 4—Basic Theory for Mechanical Spring DesignOne of the better aspects of this text is the treatment It also has data on both torsion bars and stabilizerof what constitutes optimal designs—what’s good and bars, which have special applications in automotivewhat’s not so good. All the theory on the planet is of and trucking as well as real-world application history.little use without warnings and limitations of the basic Information on shot peening as it relates to largedesign consideration to what’s safe and long-lasting. compression springs is concise and extensive. It isCritical applications hinge on the limits that define also extremely well illustrated.what will function in both force and stresses/life. Speaking of illustrations, one of my favorite resourcesThe first printing of “Mechanical Springs” was in1944 and the second printing was in in 1963. When is “Spring Design and Application” as published byI searched Amazon, it listed 1980, so I do not knowif there was yet another printing. All my copies show McGraw-Hill, 1961, and authored by Nicholas P.1963. What I do know is that the text is rooted firm inboth practical and theoretical approaches, which tran- Chironis. This reference is akin to the favorite bookscend times and dates. The latest updates includedadditions of new materials at the time, which are still you had as a child, that you never get over. This bookrelevant. That is another up-side of this text—sincedesigns are rooted in mature mathematics, applying is aged, but imaginative. It’s quite clinical in its math-new material modulus and heat treatment shouldyield pertinent results. ematics, but has a charm and more great applications and drawings as no other spring-related text. It’s just visually chocked full of things to look at and after 25 years of searching its pages, I still find something new as well as unique, creative applications from days gone by…if you can find a copy. If you can, buy it!! www.mwspring.com WFTI Randy DeFord is the Engineering Manager at Mid-West Spring & Stamping, a custom spring manufacturer that offers custom spring design, stock springs and metal stamping services. The company is multi-plant spring manufacturer and leadingsupplier of auger springs and metal stampings. For more information, call +1 574 353 7611, Ext. 231, fax to +1 574 353 7388, email [email protected] or visit www.mwspring.com. The company is also the home of Landrum Performance coil and leaf springs for racing applications, call +1 866 703 3154 or visit www.landrumspring.com.26 Wire Forming Technology International/Fall 2018

SEE WHY WE ARE SH-8II THANKS FOR VISITING US AT:WH-16 CLS-16II A DIVISION OF www.oriimec.comFor all your MEC Machine & Tooling needs contact:Rick BrayOriimec Corporation of America1840 Airport Exchange Blvd., Suite #200, Erlanger, KY 41018Email: [email protected]: 859-746-3318 ext. 15Mobile: 859-801-8112

European Perspectives developments in the UK and between the UK government and the EU on the UK’s withdrawal from the EU, the “Brexit”. by: Two years after the Brexit referendum, and after more than Dipl.-Ing. Konrad Dengler a year of negotiations between the UK and the EU, signifi- Industrial Journalist cant uncertainty remains for the industry. While the two part- Finkenweg 6 ners have agreed in principle on a transition period from the D 91091 Grossenseebach UK’s formal exit date until December 2020, there is still no Germany clearly defined, jointly approved vision for the future EU-UK [email protected] economic and trade relationship beyond that date. A survey of CLEPA’s membership identifies this uncertainty as a keyUseful Information About the European Union concern for business.The “Eurostat regional yearbook 2018”, published by the EUstatistics office, Eurostat, in September, makes available CLEPA has published a position paper on Brexit and makesdata for all 28 member states of the EU and where possible, recommendations on a future trade relationship betweenregions in the EFTA and candidate countries. Readers learn the EU and the UK for the consideration of policy makers.essential details about the economic situation of the EU and It takes into account essential aspects such as frictionlessother countries. In 2017, gross domestic product (GDP) per trade, market access, harmonization, continued collabora-capita in purchasing power standards (PPS) ranged from tion on automotive innovation priorities, access to talent and49% to 253% of the EU average (100%). On the top of the explains basics and interrelationships.list: Luxembourg with a value of 253%, followed by Ireland(184%). Third on the list are Austria and the Netherlands with The UK is one of Europe’s top automotive manufacturing128% each, closely followed by Denmark (125%), Germany countries and plays an important role for this sector, with man-(123%) and Sweden (122%). The other countries above the ufacturers and suppliers highly integrated across Europe.EU average were Belgium (117%), Finland (109%), the UK(105%) and France (104%). Between 2010 and 2016, UK car production increased byGDP per capita was slightly below the EU average in Italy 5.9% per year on average, up to 1.7 million cars in 2016.(96%), Malta (96%) and Spain (92%). The two countries with However, in 2017, production decreased by 3%, certainlythe lowest GDP per head in terms of the EU average were linked to the economic uncertainties created by Brexit.Croatia (61%) and Bulgaria (49%).Countries outside the EU with a high GDP per capita were In 2017, 80% of UK car production was exported, with theIceland (130%), Norway (150%) and Switzerland (158%). majority (54%) to the EU, way ahead of any other market (theThe yearbook also contains chapters on regional policies and USA came second with 16%). The UK is also the EU’s sec-European Commission (EC) priorities as well as statistics ond largest car market. In 2016, the UK imported more thanon population, health, education and training, labor market, 2.4 million cars, 82% of which came from other EU Membereconomy, structural business statistics, research and inno- States. Taking these figures into account, it is clear that thevation, digital economy and society, tourism, transport and automotive sector will be highly affected by the outcome ofagriculture. The yearbook answers questions such as: How the Brexit negotiations.much entrepreneurial activity takes place in the different re-gions, what are the employment rates in rural areas and in The European automotive sector employs more than 12 mil-towns and suburbs, what is the quality of life in the regions? lion people, produces a quarter of the world’s vehicles eachHow much money is invested in research and innovation? year and represents more than 6% of the EU’s GDP. Euro-Which region has the highest Internet use? And what about pean automotive suppliers invest over €22 billion in RDI perthe life expectancy in different regions of the EU? year. They are the biggest private investor into research andThe paper version of the “Eurostat regional yearbook 2018” innovation. Per year, 18 million vehicles are manufactured incan be ordered free of charge from the EU Bookshop, PDF Europe, contributing to the stability and growth of the Euro-version and a set of statistics explained articles, containing pean economy.the underlying data, are available on the Eurostat website. www.clepa.euhttps://ec.europa.eu/eurostat/documents /2995521/9102834/1-13092018-AP-EN/70330485- Certain British Firms Could be Allowed 4978-481c-b81f-dad2930ded9b to Convert to Being German after Brexit Around 10,000 German-based businesses are registeredThe European Automotive Industry and the Brexit under British rules. Germany has proposed new legislationThe EU’s Single Market is fundamental to the growth of the to allow such SMEs to become German. The new legisla-European automotive industry and it will remain a key prior- tion was adopted by Germany’s cabinet in October, writesity for CLEPA, the European Association of Automotive the journalist, Chloe Taylor, who works for the CNBC busi-Suppliers and its members. The automotive suppliers’ in- ness news group. The draft bill put forward by the Germandustry relies on frictionless trade between the UK and the Federal Ministry of Justice and Consumer Protectionrest of the EU and is therefore in urgent need of clarity with was adopted by the government and must still pass throughregards to potential changes to the current framework to im- the parliament.plement strategic business decisions. CLEPA is following the Under EU freedoms, businesses being based in Germany were able to register their firms under British rules. This was considered relatively cheap and simple. According to current laws, small firms, which want to receive the status of a Ger- man limited liability company must have a minimum share capital of €25,000 (US$29,000)—higher than the share capi- tal required to register as a British limited company. Under the new regulation, companies registered as British would be able to convert without increasing their capital. The new leg-28 Wire Forming Technology International/Fall 2018

islation guarantees firms under British rules also the freedom of establishment Focusing on peening, blasting, cleaning andin Germany after the UK’s withdrawal from the EU.https://www.cnbc.com/2018/10/10/thousands-of-british-firms-could-be- vibratory finishing!allowed-to-convert-to-being-german-after-brexit.htmlhttps://www.bundesregierung.de/breg-de/suche/bundesregierung- Vol. 15erleichtert-wechsel-der-rechtsform-1536710 September Metal Finishing NewsFasteners and Springs at the wire 2020 Trade Fair IssueThe wire Düsseldorf trade fair is now expanding its portfolio to include the whole Year 2014 Publication for the Peening, Blasting, Cleaning and Vibratory Finishing Industries Nadcap COLUMN: Competency Counts page 58world of fasteners and springs forming independent exhibition areas under theroof of wire 2020. With these two new exhibition areas, Messe Düsseldorf re-sponds to market needs while closing the gap between machinery, raw materials 14th MFN Asian Shot Peening Workshop & Trade Show in Singapore 11th-13th Nov. 2014 (see page 27)and end products.“The finished products fasteners and springs are especially ideal complements Optional practical evening classesfor the machinery, equipment and raw materials we have presented at wire in MFN Shot Peening Workshop in Germany 14th-16th October, 2014 (see page 65)Düsseldorf so far. This extension of ranges guarantees wire an additional pil- Dry and Wet Blasting Almen Saturation Curve From A Machines made in India Statistical Perspective (p. 18-20) page 28lar with growth potential from 2020,” explains Friedrich-Georg Kehrer, Global www.mfn.liPortfolio Director Metals and Flow Technologies. MFN INTERNATIONAL is distributed in 67 countries and published 6 times a yearAs every technical system needs fasteners and springs to work, the extensionof the trade fair portfolio will further enhance the significance of the wire Düs- www.mfn.liseldorf trade fair. According to market surveys, the market volume for fastenersearmarked for the automotive industry alone is thought to have amounted to 第二卷 中 2015年3月 国some US$20 billion in 2017 and it is expected to reach almost US$21.5 billion in 春季刊 金属表面处理杂志2018 and rise to over US$25 billion by 2025 with an average compound annual MFN中国主要内容growth rate (CAGR) of 2.4%. The volume of the global spring market, on the 是抛丸、喷丸强化及 成形，抛丸、喷丸、 喷砂清理，振动研磨、 抛光、工业涂装等 金属表面处理资讯other hand, is thought to have totalled slightly over US$20 billion in 2016 and is 5月11-13日，广州国际表面处理展 典型汽车零件的X射线应力 www.sf-expo.cn 检测技术 (第24-27页)expected to rise to over US$32 billion between 2017 and 2025 with an average MFN 是 SF Expo 的官方合作伙伴annual growth rate of 5.1%. Nadcap专栏：Also, the figures related to Germany, one of the leading producing and exporting Nadcap改变了人们的countries both for fasteners and springs, are impressive. According to the Ger- 态度 第10页 科学新讯： 使用载荷控制型弯板 疲劳试验机对空化喷 丸处理不锈钢的裂纹 萌生和扩展进行评估 第6-8页man Fasteners Federation DSV, 796,000 tons of fasteners worth €3.3 billionwere produced in 2017. Of these 794,000 tons (€4.5 billion) went to exports. MFN抛喷丸强化 训练课程在中国The same year the country imported 895,000 tons of fasteners. The German 2015年5月15-17日 www.mfn.li/cnfastener manufacturing industry comprises some 50 manufacturers with a to- MFN CHINA is exclusively for the Chinesetal of 8000 employees. The association of the German Spring Industry VDFI market and published 4 times a yearreports that the output of technical springs in 2017 amounted to some 440,000 www.mfn.li/cntons with a value of €2.3 billion, and 355,500 tons of these were exported. The MFN offers courses for:German spring industry encompasses some 180 spring factories employing to ▪ Shot & Flap Peening ▪ Industrial Paintingthe tune of 12,500 staff. ▪ Mass FinishingThe wire 2020 trade fair will take place from March 3, 2020 to 3 April 3, 2020, ▪ Shot Blasting ▪ Residual Stress Measurementsand the start of registration for potential exhibitors is by end of January 2019.www.wire-tradefair.comVideo: www.wire.de/fastener_springs WFTIDipl.-Ing. Konrad Dengler is an industrial journalist and Training in 9 languages!specialized translator serving the wire/cable technology, tubetechnology, materials and production technology and quality MFN is a Partner in MFN is an Officialtesting industries. Education in Nadcap Collaboration Partner of FEMSHe can be reached by phone at +49 9135 6982 or email at MFN is a Media Partner of [email protected]. MFN is the Official Cooperation Partner of Metal & Steel MFN Headquarters Switzerland www.sf-expo.cn MFN is the Official Cooperation Partner of SF EXPO Fall 2018/Wire Forming Technology International 29

The Strength by: of Steel Dr. Roger N. Wright Roger N. Wright, LLCDeformation Heating – Part VI 600 State Street Lawrenceville, IL 62439  USA E-mail: [email protected] www.rnwinc.comThe following column and previous column will sa is the average flow stress of the wire and r is thebe difficult reading for those not really familiarwith the subject. If the subject matter is partic- decimal reduction of the pass. This may be dividedularly important to you, the reader, please ac-quire the earlier columns for a careful review. by (Cr) to yield the adiabatic drawing temperatureI am always available for questions and be as-sured that this is important material. increase associated with uniform work, or Tuw. That is, Tuw = sa ln[1/(1-r)]/ (Cr). (1) In the previous columns, we considered the deforma- The heating contribution of redundant or nonuniform,tion heating in simple upsetting, as well as some sub- work. The redundant work contribution to the adiaba-tleties of deformation heating, particularly the roles of tic drawing temperature increase is:uniform work, redundant work and friction, in the well-worked-out cases of rod and wire drawing. Moreover,    Trw = (F-1) sa ln[1/(1-r)]/ (Cr)], (2)we introduced concepts of temperature equilibration,downstream from the die. This time, we will break where F is the redundant work factor, equal to aboutdown wire drawing deformation temperature compo- [0.8 + D/(4.4)], with D being the deformation zonenents into the contributions of uniform work, redun- shape factor or about (a/r)[1 + (1- r)½]2.dant work and friction. The total contribution of deformation work to the tem-The heating contribution of uniform work. The draw- perature increase associated with the drawing pass.ing stress (equivalent to the work per unit volume) The total contribution, then, of plastic deformation toinvolves contributions of uniform work, nonuniform the wire temperature in a drawing pass is: Tw = F sa ln[1/(1-r)]/ (Cr)]. (3)(or redundant) work and friction. It is instructive to ex- Redundant work increases somewhat with radial po-amine the contributions of each of these three to the sition in drawn wire, but this variation is beyond thedrawing temperature increase in the pass, acknowl- scope of this analysis.edging that, together, all three add up to [sd /(Cr)], Friction work. Friction work and related heating iswhere sd is drawing stress, C is the specific heat ofthe wire and r is the density of the wire. a complicated and nonetheless important matter,First, let us consider the contribution of uniform de- and cannot be glossed over, particularly in view offormation to the drawing temperature increase. Now, the high transient surface temperatures that may bethe uniform deformation is simply sa[ln(1/(1-r)], where reached. In this context, we plan to devote all of the next column to this subject. Good luck!!!! WFTIThe WireDrawing 101® short course, presented and developed by Roger N. Wright, LLC., and Wire & Cable Technology International magazine, is the comprehensive two-day course that teaches the fundamentals of wire drawing to manufacturers of ferrous and nonferrous wire. WireDrawing 101 features a unique handbook, with practical process design and trouble-shooting exercises suitable for work-a-day formats and continuing study. WireDrawing 102™ will be offered in the future. www.wiretech.com / www.rnwinc.com30 Wire Forming Technology International/Fall 2018

THE ONLY RK ServiceTEOVEORL NYEOEUD’LL 847-640-9771 CallingAt RK Trading, we’re here for you, every day, just in case—because your business depends onreliable service. That’s why we start by selling quality Herdon machinery, but we don’t stop there. Our commitment toyou is through the life of the machine. With our U.S.-based service and the extensive tooling and parts inventory youneed, we aren’t across the ocean—we’re just a phone call away, which means less downtime for you. Quality productswith quality customer care mean you will be up and running for years to come. That’s why over 90% of our customersbuy their next machine from us.

Wire by:Product Alan Thomas, Marketing DepartmentTesting Zwick Roell Limited Southern AvenueThe Importance of Reliable Test LeominsterResults in Mechanical Testing Herefordshire HR6 0QH United Kingdom www.zwick.com selves the following questions: • Are the test results truly accurate? • Are the results repeatable? • Are they reproducible, comparing similar measuring equipment? • Is it possible to trace who has done what, when and how? • And finally, does the measurement equipment that is used fulfil all required regulations and standards?To gain a competitive advantage in today’s envi- Measurements That Areronment of rapid technological advancement, de- Precise and True Are Accuratesigners and engineers are routinely pushing thelimits of physics in developing new and enhanced Precision is the closeness of agreement betweenmaterials. individual test results obtained under stipulated conditions.At the same time, globalization has led to inter-national supply chains and the separation of re- This means: Individual test results which aresearch from production facilities. close to each other are precise, while individual test results, which are not close to each other areConsequently, it is absolutely essential for both not precise.quality assurance and R&D that test results be ac-curate, repeatable, reproducible and traceable—in a word, they must be reliable!With every test performed on material specimensor parts, the same questions keep cropping up:Is the value obtained really accurate, are the re-sults repeatable, are they reproducible compar-ing similar measuring equipment, is it possible totrace who has done what, when and how, and fi-nally does the measurement equipment used fulfilall required regulations and standards?Reliable Test Results DefinedWhether running highly standardized tests or de-signing completely custom solutions, ZwickRoellapproaches each challenge in materials testingwith the same motivation—to achieve the mostreliable results possible, and to do so we ask our-32 Wire Forming Technology International/Fall 2018

Trueness describes the closeness of agreement • Where was the measurement performedbetween the average of individual test results anda reference value. • And by whomThis means: The result is true when the average Commitment to Reliabilityvalue of individual test results is close to the ref- When a customer purchases a machine fromerence value, and not true when there is a high ZwickRoell, the customer gets not only a testingdifference between average value and reference machine of the highest quality, but also a partnervalue. with more than 160 years of experience in materi- als and component testing.Individual test results, which are close to each The goal of ZwickRoell is to provide its custom-other and in average are close to the reference ers with the most reliable test results, and this isvalue, are accurate. a mindset that is deeply ingrained in all facets of our business.‘Repeatability’ is PrecisionUnder Repeat Conditions:• The same measurement procedure• The same operator For further discussion, contact the author at• The same measuring equipment• The same location Zwick Roell Limited in the UK or visit: www.zwick.com WFTI• And the same test conditions• The repetition of measurements within short Zwick/Roell AG, one of the world’s lead- intervals of time is the only variable factor ing suppliers of materials and component testing systems, supplies both standard‘Reproducible’ is Precision and tailor-made solutions for the mostUnder Reproducible Conditions: demanding requirements—in research• The same measurement procedure and development, production and quality• Similar measuring equipment assurance—across more than 20 industry• Generally at different locations sectors. Privately held, the company’s• With multiple operators consistent focus on innovation and commit-• Under varying test conditions ment to outstanding quality has supported• As well as performing measurements over its growth in markets worldwide. Additional information about Zwick/Roell lengthy periods of time AG may be found at: www.zwick.com‘Traceable’ Refers to the Full and CompleteDocumentation of a Measurement Result:• How the test result was determined• Under which conditions• When was it determined Fall 2018/Wire Forming Technology International 33

Two New Chain Link Weaving Machinesby: Gregory Jendreas, President Bergandi Machinery Company, Inc. 1689 S. Parco Ave. Ontario, CA 91761  USA www.bergandi.comBergandi Machinery introduces two new, world- Bergandi WVR-A6 machine.class chain link weaving machines, designated theL7 and A6. The machines have been designed to world market. With more than 90 years’ experienceallow manufacturers across the world access to designing and building fence related machinery, theUSA engineered and USA manufactured machin- company has more than 2500 machines in operation inery at a price point that will achieve significant more than 65 countries around the world. It is wortheconomic benefit. noting that virtually ALL the chain link manufactured in the United States, the world’s largest manufacturerThe L7 machine will be available in 2 to 3.6 m and consumer of chain link, is made on Bergandi chainheights, run wire diameters from 1.8 to 3.15 mm link weaving machines.and mesh sizes from 45 to 63 mm. Additional meshsizes are also available. Output rates will reach Along with its flagship chain link weavers, the com-160 m2 per hour. pany also produces High Speed (Iowa Style) (Continu- ous Twist) barb wire machines, High Tensile ReverseThe A6 machine will be available in 1.8 to 3.6 m heights, Twist barb wire machines, PVC extruders for use in therun wire diameters from 1.8 to 3.90 mm and mesh sizes manufacture of color chain link, Fuse Bonded systemsfrom 45 to 63 mm. Additional mesh sizes are also avail- to produce thermally fused organic coated wire forable. Output rates will reach 260 m2 per hour. chain link, Concertina/Razor Wire Systems and other related equipment.New Control System The machinery is manufactured in Ontario, CA, USA,The machines are equipped with a new Smart Tech-nology control system featuring a fully integrated where the company is headquartered. Bergandi main-machine control system, combining machine drive andPLC functions into a single unit. A lower price point tains a full complement of spare parts in Californiahas been achieved by reducing the 500’s complexity;the turrets for example are now pneumatically oper- with same-day or next-day shipping and providesated, eliminating dozens of precision machined parts. ongoing customer support for all its machinery fromThe new end finish system (knuckle and barb) will beeasier to adjust for height changes, reducing set-up the same location. Factory trained technicians aretime, maintenance time and maintenance expense, andto improve machine uptime. The end finish operation commonly deployed from Bergandi headquarters tois signaled from the HMI, replacing a series of me-chanical linkages that required adjustment and parts customer locations throughout the world. replacement as well as required considerable skill. Visit Bergandi at: www.bergandi.com WFTITake-Up Integrated in Main Frame Company Profile:The take-up system has been integrated into the main Bergandi is a global leader in state-of-the-art equipment for pro-frame of the machine, reducing the number of parts, ducing chain link fencing, concertina wire, barbed wire, extrudedsimplifying the operation and reducing the footprint of PVC coated wire, security wire mesh and wire products for thethe machine by 30%. The take-up will be closer to the construction industry. For over 90 years, Bergandi has been man-weaving section of the machine that in effect “tightens” ufacturing machinery to create a wide variety of fencing. From athe process, reducing mis-weaves and significantly al- barbed wire machine to a tie wire machine, Bergandi has a bit oflowing for higher standard operating speeds. everything for sale. We also offer engineering, consulting, techni- cal services and training to help improve your profitability. Experience in Fence-Making Technology www.bergandi.comBergandi Machinery is the leading provider of chainlink weaving and other fence related machinery to the34 Wire Forming Technology International/Fall 2018

WFTI EMPHASIS: Fence MakingRun the Machines, Attract because you are making parts faster. You can fill& Retain Factory Workers rush orders faster.by: • New machines run more consistently. Less un- Greg Jendreas, President planned downtime, more reliable production. Bergandi Machinery Company, Inc. Production managers can spend more time tak- 1689 S. Parco Ave. ing care of customers rather than working on their Ontario, CA 91761  USA machine repair strategy. www.bergandi.com • New machines are safer to operate. With constantManufacturers throughout the world continue to face repair requirement of old machines, there are sig-a shortage of skilled labor to run their manufacturing nificantly more operator-machine interactions withequipment. This skills shortage cuts across just about old machinery. Every time you need to make anall industrial enterprises and can be found in many, adjustment or a repair, it is one more opportunitymany countries. for injury. Significantly reduce these interactions with new machinery.I have read many articles advising the best way to at-tract and retain factory workers. • New machines lead to fewer machines. Fewer machines provide a more efficient factory layoutMost of the articles mention the basics, pay, job se- that reduces material handling as well as improvescurity, benefits, training, recognition initiatives, etc. I the ability to properly segregate pedestrians andhave seldom, if ever, heard anyone suggest that the fork lifts.purchase of new machinery will help solve the laborshortage problem. Yes, replace old machinery with • Lower maintenance expenses. High quality newnew machinery to support your recruitment and reten- machines typically will not require repairs for astion challenges. long as 5 years if maintained and cleaned prop- erly. Save time not buying replacement parts.Old, worn out machines are a major frustration for Streamline your business.well-intentioned factory workers. Good factory workersare mobile, the demand is high and the supply is low. • With less maintenance, the maintenance staffGood factory workers will naturally seek out compa- may be reduced, not only reducing cost but alsonies that provide them with the tools where they can eliminating an employee retention problem. Yoube most productive. don’t need to recruit and retain if you don’t need the person in the first place.Most workers take pride in the work they produce. Oldmachines inhibit productivity—often machine opera- • Tax benefits in many, many countries. Reducetors need to tinker with their machine all day long just your tax bill when you buy new equipment.to keep them running. This creates a level of frustrationfor them and dissatisfaction for their job. • Versatility, new machines typically have a wide range of capability that old machines do not.Most new machinery today is so automated and made You will be able to run more variety of parts onwith greater precision components, that they are much newer models compared to old model machines.easier to operate and keep running all day. Workers Changeover times will be faster too.can concentrate on making product rather than work-ing on a machine up-time strategy. There’s nothing like Overall and in summary, the key to success in manu-putting a lot of product on the ground to make a worker facturing is very simple: “Run the Machines!”feel good. You will have a much better result “running the ma-In addition to the “attract-and-keep-workers” benefit, chines” with new machinery rather than with old, worn-new machines offer a plethora of other benefits. out machinery. Your employees will thank you, your customers will thank you and your bottom line willThese include: thank you.• New machines are faster than their old coun- You can contact the author at [email protected]. terparts. More production at the end of the day. Means you need fewer people and less inventory Or visit: www.bergandi.com WFTI Fall 2018/Wire Forming Technology International 35

Automatic Wire Fence Manufacturing Machinesby: M. Demirci, Mgr. Exp. Dept. Demirci Makina Co. Ahi Evran OSB Mah. Ural Cad.No:12, 06935 Sincan/Ankara, Turkey www.demircimakina.com.trDemirci Makina Co. of Turkey, has been a designer Model ADF 3 double spiral fully automatic chain link fenceand manufacturer of automatic wire fence making machine (front view above and back view below).machines since 1988. The company has developed itsautomatic mesh technology to a high degree over theyears. Demirci Makina Co. has also developed auto-matic hexagonal wire mesh machines. The companymanufactures these machines in its 12,000 m2 factoryand employs some 40 people.Approximately 1600 set Demirci Makina machines arecurrently in use and operating in 80 countries. Demircimachines are widely used in the world. This is espe-cially true of the Model ADF 3 double spiral automaticchainlink fence wire mesh machine, which offers asimple design, ease of use and a great price advantagedue to the great interest by foreign companies.To interested customers, Demirci Makina can providereferences for companies using its machines in theircountry of origin or in nearby countries.Double Spiral Chain Link Fence TechnologyThe Model ADF 3 double spiral fully automatic chainlink fence machine is the most popular product offeredby Demirci Makina. The company manufactures twoModel ADF 3 versions, the Eco and the Pro. The ModelADF 3 machines are available in 2, 3, 4 and 6 m sizes.The advantages of the Model ADF 3 double spiral fullautomatic chain link machine include easy installationand commissioning, easy operation and a low price.Wire Plastic Fence Coating Technology Model FDE 2 automatic wire plastic coating machine (front view above and back view below).In 2009, the company completed the design and testingof a plastic coating machine. An advanced model of the The advantages available with the Model FDE 2 ma-plastic coating machine was offered for sale in 2010. chine are the same as those provided with the Model ADF 3 automatic chain link fence machine.Offered is the Model FDE 2 automatic wire plasticcoating machine. The Model FDE 2 is a machine andnot a line.Demirci Makina attaches great importance to im-proving the quality and technical properties of itsmachine products. In addition to this, the companyis continuously working to design new machines thatare required by the industry.Demirci Makina aims to become a world-renownedbrand in the field of wire processing machines througha high level of quality and balanced progress in design,production, promotion and after-sales support.36 Wire Forming Technology International/Fall 2018

WFTI EMPHASIS: Fence Making Chain Link Fence Weight Calculation Module M2 Video Available Fence makers can easily calculate the average weight of the chain link fence Interested customers can watch a by using the company’s m² weight calculation module, which is available video of the machines available from online at www.demircimakina.com.tr/en/after-sales/m2-weight-calculation/. Demirci Makina. And they can re- quest an appointment for “a live A sample screen capture from the online module is shown in the image below. video conversation” with the Demirci Makina sales team by Whatsapp: +905321385472 (in English or Arabic). Demirci Makina shows its machines under operation. Demirci Makina Co. guarantees that customers will be shocked by the price of its fence making machines and technology. www.demircimakina.com.tr WFTI Company Profile: Demirci Makina Co. designs, manufactures and supplies the global industry with ad- vanced wire mesh machines and fence making equipment. The wire mesh and fence manufac- turing machines available from the company include automatic chain link fence machines, PVC wire coating machines, hexagonal wire netting machines, chain link fence compact roll machines, support equipment and engineering service. www.demircimakina.com.tr Technology for the wire, cable, wire product & fastener industries... FFAALLLL 22001188 SSEEPPTTEEMMBBEERR//OOCCTTOOBBEERR 22001188 SPRING GRINDING...P. 64 OOCCTTOOBBEERR//NNOOVVEEMMBBEERR 22001188 WWW.WIREFORMINGTECH.COM SSeerrvviinngg MMaannuuffaaccttuurreerrss,, DDiissttrriibbuuttoorrss aanndd EEnndd UUsseerrssSEPTEMBER/OCTOBER 2018 WWW.WIRETECH.COM OCTOBER/NOVEMBER 2018 WWW.FASTENERTECH.COM SSeerrvviinngg mmaannuuffaaccttuurreerrss,, pprroocceessssoorrss,, Serving Manufacturers of Springs, Wire Roundup Articles: ddiissttrriibbuuttoorrss aanndd uusseerrss ooff wwiirree aanndd ccaabbllee Formed Parts, Wire Mesh and Rebar Products COATING & PLATING..P. 64-77 • Packaging...102 • Aerospace...112 Reels...P. 96 Trade Show Coverage...pagesWIRE & CABLE TECHNOLOGY INTERNATIONAL 24, 44, 60 & 70 FASTENER TECHNOLOGY INTERNATIONAL Preview Articles: PROCESS CONTROL...114 IWCS 2018™...62-95 wire China 2018...106-129 P. 121 Fastener October/November 2018 Wire Harness & Focus Cable Connector Focused News, Information and Products for Presented by... TAPES, YARNS & Fastener Distributors, Importers, Manufacturer’s www.fastenertech.com STRENGTH MEMBERS..130 P. 143 Representatives, OEMs and End Users. Focused News, Information and Products for Presented by... In this issue... Wire & Cable Processors, Distributors and End Users. FF News & Info September/October 2018 www.wiretech.com Quiet Segment Feeder ReducesVol. XLVI, No. 5 Inside this issue... COATING & PLATING...P. 50 Vol. XLI, No. 5 Abrasive Wear on Screws: Automatic Positioning & • News & Info: Page 144 Separation • Wire Harness Business & Volt Industrial Plastics: Strategy Column: The “V.I.P.” Treatment Handshake or Contract?: Providing Solutions for 70 Years, Page 154 and By the Way, Did You Know? • Wire Processing Essentials Spotlight on International Column: Part 33: Fastener Expo Exhibitors The “Rut” in Routine: TESTING..P. 58 IFE LAS VEGAS PREVIEW: PAGES 78-98 & 152-160 The Development of Page 156 EMPHASIS ON FENCE MAKING...P. 34-37 Anti-Pigtail Fasteners COMPANY PROFILES...P. 77-94 • Ultrasonic Wire Splicer Tracking Your Fasteners: Improves Output, The Amazing Apple Watch Industry Take-Over Repeatability & Quality of Wire Harnesses: FF Products Page 158 • Adding Benefit to Manufacturer’s Slogan: “We Make the Connection” — A Case Study: Page 160 • Checking Twist Pair Relationships in Cables as Short as Six Feet: Page 162 • New Products: Page 164 For manufacturers, processors, For manufacturers and users of springs, For manufacturers, distributors and distributors and users of all types wire formed products, wire mesh users of all types of fasteners and rebar products. and precision formed parts. of wire and cable: electrical, communication and mechanical Subscribe @ www.wireformingtech.com Subscribe @ www.fastenertech.com Subscribe @ www.wiretech.com Fall 2018/Wire Forming Technology International 37

The Sucess Story Continues with the Introduction of the Two-Plate Variantby: This new spring end grinding machine features Simon Haase the company’s latest innovation, which aims WAFIOS AG to strengthen its market position in grinding. Silberburgstrasse 5 72764 Reutlingen, Germany www.wafios.comFollowing the success of the one- Fig. 1 — New two-plate variant of the WAFIOSplate variant model introduced in G 450 spring end grinding machine.2017, WAFIOS AG is now offeringthe two-plate variant of its G 450spring end grinding machine (seeFigure 1). As with the G6 series,which was introduced in 2012, thislatest innovation aims to strengthenthe company’s market position inrelation to spring end grinding.For the first time in the history ofWAFIOS, the entire production andassembly process was transferred tothe company’s own production plantlocated in Zhangjiagang, China.Meanwhile, the development anddesign work as well as the qualitymanagement checks continued tobe carried out at the parent plant inReutlingen, Germany.Standard Features Maintained the dressing units in all WAFIOS grinding machines have been designed as slide solutions from the latestAs is the case with other machines from WAFIOS AG, generation, leading to increased rigidity and improvedthe G 450 spring end grinding machine is installed dressing results.with the latest version of the WAFIOS WPS EasyWay3.2 control program. Easy to use and boasting a high The basic scope of the G 450 grinding machine has alsolevel of operational safety, the WPS 3.2 EasyWay is also been enhanced in comparison to the previous machineready for operation in future Industry 4.0 applications model, meaning that even the standard version nowsuch as predictive maintenance. constitutes a fully functioning machine capable of carrying out the majority of applications commonlySuccessful features of the G6 series have also been required in the industry. These applications includeadopted and refined in the new G 450 grinder includ- spring length measurement and active process cool-ing iQtemperature and the particulate deflector. With ing. While the former measures the uncoiled springiQtemperature, the temperature of the workpieces can lengths at the end of the grinding process to guaranteebe measured and the process instructions controlled the minimum batch tolerance, active process coolingaccordingly while the machine is “in process”, for ensures the safe removal of the grinding deposit inexample, during the grinding process (see Figure 2). the grinding room.This significantly increases production rates while alsoguaranteeing that quality standards are met. In a nutshell, the main technical features of the com- prehensive standard equipment package comprise theAlongside this patented unique selling point, the ma- WPS 3.2 EasyWay programming system, the specifiedchines also include the WAFIOS particulate deflector, a options and production and assembly at the WAFIOSspecial coating of the extraction channel that effectively plant in China, based on the design expertise gatheredminimizes soiling, grinding deposits and other dirt, by WAFIOS over many years.thereby reducing both maintenance and repair costs. Taken together, these features make the WAFIOS G 450And in contrast to previous models such as the FEL 62, spring end grinding machine an attractive proposition38 Wire Forming Technology InternationalFall 2018

Fig. 2 — Active process cooling and “in-process” spring length measurementincluded as standard in the WAFIOS G 450 end grinding machine series.in terms of value for money. Company Profile:To find additional information and technical speci- WAFIOS AG serves the worldwide wire and tube industry, and is one of the globally leading manufacturers of wire and tubefications on the WAFIOS G 450 spring end grinding working machines with many activities also in the cold forming industry. The WAFIOS Group employs approximately 1100machines, contact the author in Germany, or visit the employees around the world. www.wafios.comWAFIOS website listed below.www.wafios.com WFTI060-6000-0113-08.indd 1 10/24/18 2:38 PM Fall 2018/Wire Forming Technology International 39

Only the Music May Swing by: Ralf Jaenicke, Head of Sales Federnwerke J.P. GRUEBER GmbH & Co. KG Buschmühlenstrasse 28 58093 Hagen, Germany grueber.deThe Elbphilharmonie (also called “Elphi” by the lo-cals) was completed in November 2016 and opened inJanuary 2017. The concert hall in Hamburg, Germany,was planned with the aim of creating a new landmarkfor the city and a “cultural monument for everyone”. Positioning of compression springs with wire diameters from 4 to 25 mm and rod diameters up to 65 mm (above) for isolation of the two concert halls to prevent transmission of vibrations (below). The Elbphilharmonie (“Elphi’) Concert Hall in Hamburg In particular, vibrations from ships and from the (Photo Copyright © mstein / Fotolia). nearby underground must not be transmitted to theRising 110 m above Hamburg’s HafenCity district,the building is located on the banks of the Norderelbe building, let alone the concert halls. For only the musicbetween the mouths of the Sandtorhafen and Gras-brookhafen docks. The brick body of the former Kais- may swing here. grueber.de WFTIpeicher A warehouse, built in 1963, was incorporatedinto the building. It provides the base on top of which Your source for Vibration Controla modern structure with a glass façade resembles sails, Solutions & Partner for Foundation Designwater waves or a quartz crystal.The concept of the concert hall is based on an idea by GERB Vibration Control Systems, Inc., also known as GERBHamburg project developer, Alexander Gérard. USA, was founded in Chicago, IL, USA in 1988. In 2000, GERBThe design and the planning of the Philharmonic Hall relocated to Lisle, a Chicago suburb. For 30 years, GERB USAwere largely the work of the architecture firm, Herzog has worked successfully with machine& de Meuron. and equipment makers, engineers, ar-The building was constructed by Hochtief. On behalf chitects, consultants and other partnersof our partner, GERB, we at Federnwerke J.P. GRUE- to provide innovative solutions to many vibration, seismic andBER GmbH & Co. KG developed precision springs for settlement problems. The company is a subsidiary of GERB incomplete elastic suspension and isolation of the two Germany, and over 100 years of global experience internation-concert halls to prevent the transmission of vibrations ally, GERB can solve your vibration problems.from the environment. Company Profile: Compression springs manufactured by GRUEBER for Federnwerke J.P. GRUEBER GmbH & Co. KG currently has the elastic bedding of the two concert halls. almost 200 years of experience in metal processing and spring production. With 180 employees, the company produces about40 Wire Forming Technology InternationalFall 2018 10,000 tons of steel springs and bent parts yearly at the Hagen location. There are GRUEBER springs and bent parts for a wide variety of applications and in a broad range of sizes—with rod diameters up to 65 mm and unit weights up to 200 kg. grueber.de

Plan now to participate in SpringWorld® 2020!Join your colleagues at the industry’s premier event.SpringWorld provides a unique opportunity to network with other spring manufacturers, wire formers, and OEMs.• The premiere spring show since 1960. • One-on-one discussions with others who share your concerns offering new insights• A global showcase for suppliers to the spring and wire for your business. form industry featuring attendees from 18 countries. • Attend free educational seminars offered by• See the newest technology available to improve your exhibitors and industry experts. productivity, quality and service.We’ll see you at presented by www.casmi-springworld.orgSpringWorld® 2020October 7-9Donald E. Stephens Convention CenterRosemont, IL

Spring Manufacture HelpsMonitor Health of a Nationby: Production processes facilitate healthcare Stuart McSheehy, Managing Director advancement from prototype stage through European Springs & Pressings Ltd. to high-volume production. Chaffinch Business Park, Croydon Road Beckenham, Kent BR3 4DW UK www.europeansprings.comOne million patients are seen every 36 hours by the Supporting a Vision for HealthcareNHS with 40% more operations being undertaken inrecent years. Sanandco, Cambridge, UK, and the com- Julian Holmes, who is the Chief Executive Offier atpany’s MonitorMe product, with springs supplied by Sanandco, commented, “Our corporate vision is toEuropean Springs & Pressings, is working on easing transform the way healthcare is delivered and man-this NHS headache. aged, improving quality of life and reducing the bur- den on the NHS.Healthcare Monitoring SupportedEngineering & Production Excellence “Our health and well-being can be transformed by wide-spread deployment of low-cost integrated medi-Sanandco brings healthcare monitoring to the masses, cal devices, capable of collecting granular patient datataking advantage of technology including cloud stor- and transfering it to cloud-based centers for analysis.age and big data. And the analysis by the MonitorMe system compares the vital signs with previous records from a patient andThe company develops simple-to-use, reliable and can raise an alert to a medical professional in the eventclinically proven devices, which both their users andhealthcare professionals can rely upon. And Sanand-co’s MonitorMe product, supported with engineeringexcellence and spring production from the Beckenham,UK, factory of European Springs & Pressings Ltd., hasbeen designed to reduce the more than £120 billionbudget of the NHS.MonitorMe system Spring components supplied by European Springs from Sanandco, & Pressings for the MonitorMer system. with spring technology from European Springs & Pressings Ltd.The Sanandco MonitorMe system is a vital-signs moni-toring device and telephone. The MonitorMe telephonehandset is equipped with sensors that send tempera-ture level, heart rate, blood oxygenation and a proxyfor blood pressure, together with symptom-basedhealth questionnaire responses, via the telephone lines,to a patient’s digital record.The patient’s well-being can be monitored from thepatient’s home, reducing the likelihood of serioushealth exacerbations and alleviating the need for longpost-operative stays in the hospital.The capabilities of the MonitorMe system improve thepatient’s quality of life and benefit society by freeingup hospital facility bed space and allowing NHS staffto focus on those most in need.42 Wire Forming Technology InternationalFall 2018

that changes are identified. This is highly effective, To learn more about the products and technical pro-confident monitoring, but from the home, surroundedby friends and family, in an environment that can only duction capabilities available from European Springsencourage a quicker recovery. & Pressings Ltd., visit the company’s website.“This truly is the future of medical healthcare moni-toring and we’re delighted to have European Springs www.europeansprings.com WFTI& Pressings as a key player of the team,” concludedHolmes. Company Profile:Multiple Samples Offered European Springs & Pressings Ltd. maintainsat the Prototype Product Stage sites in Cornwall, London and Yorkshire in the UK. European Springs & Pressings is a part ofThe production processes at European Springs & the Lesjofors parent company with 28 springPressings’ Beckenham location enable the company to manufacturing companies across Europe, Amer-supply multiple sample options at the prototype stage. ica and Asia. All of the company’s sites supportThese advanced production processes also allow for customers found in the automotive, telecommuni-small and high-volume production levels and it was cations, aerospace, defense, hydraulics, domesticthis methodology that won MonitorMe. appliances, nuclear, electrical switch gear, light- ing, controls, scientific medical and pharmaceu-So often the work done at European Springs & Press- tical industries. European Springs & Pressingsings for the medical sector is hushed by confidentiality Ltd. offers the UK’s widest range of compressionagreements, so according to the company, it is wonder- springs, tension springs, torsion springs and gasful to share the success of MonitorMe. The impact of springs. Also offered are high-speed press com-Sanandco technology cannot be undervalued and we ponents up to 130 tons with a full in-house toolat European Springs & Pressings are really proud to room. www.europeansprings.combe part of this company’s incredible team. Fall 2018/Wire Forming Technology International 43

Straight From The Show News and images from SPRING WORLD® 2018SPRING WORLD® 2018October 3-7, 2018,Donald E. Stephens Convention CenterRosemont, IL, USAKinefac Had Great Feedback on its New KINECOIL 6 Axis CNCSince the acquisition of Sleeper and Hartley (S&H) in of a petri dish and magnify the1991, Kinefac Corporation located in Worcester, MA, dust to reveal actual coils madeUSA, has applied advanced engineering to expand on with 0.001\" wire coiled to anthe S&H product line. Now operating under KINECOIL O.D. of 0.005\".Division, Kinefac Corporation, we were very pleased toexhibit at SPRING WORLD® and see all the vendors and KineCoil continues tothe number of live demonstrations available to visitors of provide Sleeper and Hartleythe show. We experienced a constant stream of booth mechanical spring coilerstraffic. It was obvious from the high attendance that the as well as parts and servicespring industry continues to be quite strong in the USA. support. We look forward to working with the spring industryKINECOIL Division looks forward to expanding its and attending future shows toofferings and working closely with existing and new share our product offerings.customers in the industry. SPRING WORLD 2018 To learn more, please give aprovided us with a great venue to introduce our NEW phone call to Mark RussellKine-Coiler 6 Axis CNC to the industry and received at +1 508 754 6891 x661, or visit: www.kinecoil.compositive feedback. The Kine-Coiler has a wire capacityrange from 0.005\" to 0.034\" and offers both single pointand 2-point coiling options to meet all your coiling needs.The system can also be changed-over to produce bothRH and LH coils further expanding on flexibility.In addition, KINECOIL also offers a unique Micro-Coilerthat is capable of producing very precise coils with wiresize ranging from 0.001\" to 0.006\" in diameter as wellas shaped wire for special medical device and miniatureelectronic applications. At the show, we displayedseveral Micro-Coil samples under a live microscope. It’salways a pleasure to see a person’s reaction when youshow what appears to be specs of dust in the bottom Kinefac's Dave Willens (left) and Jean Allain (right).44 Wire Forming Technology International/Fall 2018

Larson Systems Unveils Pass Through TestingLarson Systems Inc. had an exciting and successful begins to wrap up, we look forward to another successfulCASMI SPRING WORLD 2018. We were very pleased year of business with the fabulous folks in the springto showcase our brand-new software option for the first industry. We hope to see you all again and meet eventime at the show—Pass Through Testing, available on more great new people at SPRING WORLD 2020!our SDHT GEN 2 model testers, allows the capture ofone or two data points in one fluid deflection of the spring Call us at +1 763 780 2131 to place an order or iffor much faster testing repetition. Show attendees who you have questions about any of our products—andwatched the demonstration were very interested in this don’t forget to check our website listed below oftennew feature and the time it can save their operations. to see what’s new. We’re always working on newWe think this is something everyone will want to include and innovative products and features to help you findwith their SDHT testers going forward. Give us a call success in testing! www.larsonsystems.comtoday for more information!In addition to our newest software feature running onan SDHT, Larson Systems also showcased some of ourmost popular compression/extension and torsion springtesters including the FLASH 24, FLASH 25, SDHT 2000and TST.We’d like to thank everyone who stopped by our booth Always a great week for WIRE CUTTER STORE at CASMI Show! We get to see customer base thatthis year. We met a lot of great people, learned about understands value of quality cutting tools at show. Many of our tools are designed for cutting Springyour unique testing needs and interests and closed on Wire and related products. Many customers come looking for our booth to buy hand tools at the show.tester sales with some of you, too. It was great to see We sold around 100 tools at the show and have had a bunch of purchases on Wire Cutter Store websiteyou all face-to-face at the show, and we appreciate your since the show from attendees!business at show and throughout the year.2018 was a fantastic year for Larson Systems and as itAnother Great Week for Die Quip’s Wire Cutter StoreWe successfully debuted the new KNIPEX 10” Mini-Bolt Cutters and Angled Head versions of Mini-BoltAt the show, Die Quip Corp., Bethel Park, PA, USA, got PCAeuottpdelreds.ciuWttitoeinfngeaastpulrrlienydg,twhwiereKelRoEvNewNtheBeorhletaCrduaettneberdsle6w2itHhsRreeCptbl-alaucdepeasb.lea3p-spideodicnutttmingebnladtess, wfrhoichmwere a hit!to see the customer base that understands the value the show to demonstrate the KTR-19 Electro-Hydraulicof quality cutting tools. Many of our tools are designed Wire Cutter This unit cuts wire up to 5/8\" 48 HRC andfor cutting spring wire and related products. At SPRINGWORLD 2018, many customers come looking for our ½\" 52HRC.AlwbaoysoatghreaitnweoekrdforeWrIRtEoCUbTTuEyR ShTOaREnadt CAtoSMoIlSshoaw!t Wthe geetstohseoewcu.stoWmeer bsasoe tlhdat Customers at this year’s SPRING WORLD show wereunaderrostaunndsdval1ue0o0f qutoaliotylcsuttaintg ttohoels ast shhooww. Maannydof ohuar tvooels ahreaddesiagnebdufonr ccuthtinog Sfpring also asking to see the RAPID CUT line of PneumaticWWiepresuoalrndcdarhreolauantsedde1p0sr0otdoouoncltssWa. tMthiareneyshcoCuwstuoamnttdeehrsarcvoSemhtaeodloraoebkuinwngchfeoorbfospuurirtbceohoastsheistnoocnbueWyihrteahnCedutttoseorhlsSotaotwrethewsehboswite.sinfcreothme shaowttefronmdaetteendse!es! Cutters for the cutting of smaller spring wire sizes. These TlHinhweaeivsreiougrfsneePoittn-nceuuuupotpmsampwapttiiorocieciCnuu5tpmtpt/tee3onnrs5t2es/fo8\"furr”oct4mmuo8tttHaihnRet5gCissc/ham1noadwc6ll½eu\"t”rots5idtpn2eerHimnrR5gosCnw2. siCtcrreuHaasstteiRnozetmhsCe.ebrTKsehTdaeRrsee-ue1a9peslsrEeoegleoandcnstokdroimnfi-gonHictyrgcodurstacetoueeulrnitschtcWteatinhnRirAehegPaCInDudtCtleeUrwTire ump too5d/3e2”ltoyo5/u16”gine5t2.HRC depending on the model you get.Always a great week for WIRE CUTTER STORE at CASMI Show! We get to see customer base thatunderstands value of quality cutting tools at show. Many of our tools are designed for cutting SpringWire and related products. Many customers come looking for our booth to buy hand tools at the show.We sold around 100 tools at the show and have had a bunch of purchases on Wire Cutter Store websitesince the show from attendees!WeAsulsccoessfuallyt deSbuPtedRthIeNneGw KNWIPEOX 10R” MLiDni-Bo2lt C0u1tte8rs,anDd AinegledQHeuadipversCionos orfpM.ini-BoltPCeusottpuelresc.ccuWteteinsfgesastfpuurrienldglytwhierdeKleRoEvbNeNuthBteeohltdaCrduetttnheerdes 6w2intHheRreCwpblalacdKeeasNb.leI3P-sEideXd cu1tt0ing\"blMadeisn, wi-hBichowltere a hit! Cutters as well as Angled Head versions of Mini-BoltCutters. We featured the KRENN Bolt Cutters with WcuD2ett0leioer2oska0QtfowrCuwwiawApr.dwStCiorMeeocxuhIrttipbeSir.tsiPntlogorRaeot.cI2okN0ms2G0ofrCoAcWoSrnMwtOaI caSthRrdodiwrLe!cDttPoaletatesrsmeaxavdhxiswieitebollui@strihdwnieoegqbwusiiatp!e.gctooamse,ine41t2ha-e8st3e3tt-ho1u6eg6h2 durablereplaceable 3-sided cutting blades, which were a hit!WPeesuoccpeslsefulliyndveboutlecdethde nienw KtNhIPeEX c10u” tMtiinni-gBoltoCfuttserps rainndgAngwledirHeeadlovevrseiontshofeMini-BoltPCheuotatperlreds.cueWttneinefgedastpur6riend2g twhHiereKRlRoEvCNeNthbBeolhaltaCrddueettneserds. with replaceable 3-sided cutting blades, which were a hit! Please visit our website below to see these tough 62 HRC blades . durable cutters.Have set-up appointments from the show to demonstrate the KTR-19 Electro-Hydraulic Wire Cutter Or you can contact us directly via emailing ScottThis unit cuts wire up to 5/8” 48 HRC and ½” 52HRC. Customers are also asking to see the RAPID CUT Maxwell at [email protected] or by telephoningline of Pneumatic Cutters for cutting smaller spring wire sizes. These ergonomic cutters can handle wire him +1 412 833 1662.up to 5/32” to 5/16” in 52 HRC depending on the model you get. www.wirecutterstore.comHave set-up appointments from the show to demonstrate the KTR-19 Electro-Hydraulic Wire Cutter Continued...This unit cuts wire up to 5/8” 48 HRC and ½” 52HRC. Customers are also asking to see the RAPID CUT Fall 2018/Wire Forming Technology International 45line of Pneumatic Cutters for cutting smaller spring wire sizes. These ergonomic cutters can handle wireup to 5/32” to 5/16” in 52 HRC depending on the model you get.

Straight From The Show...Continued News and images from SPRING WORLD® 2018Alloy Wire International: Sample supply it and how fast we can get it to our customers—Box Impressed Hundreds of Visitors everyone is extremely busy at the moment and they require their material on time so they can meet theirSize was a major talking point for Alloy Wire own orders.”International at CASMI SPRING WORLD 2018, whichwas held recently in Chicago, IL, USA. Olley continued: “We also had Pete Lambe, Technical Director, on the stand and this proved very popular, as heThe company, which had representatives from the was able to talk in detail with visitors about how we couldUSA and UK manning its stand, impressed hundreds support them on exciting projects for the aerospace,of visitors with its sample box that showcased its ability nuclear and oil and gas sectors.to manufacture wire in sizes starting from 0.001\" (twotimes smaller than a human hair) right up to 0.827\". “The spring making industry represents a huge opportunity for us, with customers using our wire toOver the course of the two days, lots of enquiries were produce compression springs, tensions springs, torsiontaken from spring makers looking for high performance springs and formed parts for use in critically demandingnickel alloys to be delivered on time and within three environments like aircraft engines—where other wire justweeks…still the fastest lead times in the industry. does not perform under such conditions.”“SPRING WORLD is different to other shows we attend Operating across 55 countries worldwide, Alloy Wire’sacross the world in that everyone walking through 60 different ‘High Performance’ alloys are all DFARSthe doors is a potential customer for us and that was and EU compliant and can be supplied in quantitiesreflected in footfall to our stand over the course of the from 3 m to 3 tons.2.5 days,” explained Stephen Olley, Sales Executivefor Alloy Wire International. “There was a lot of interest For further information, please visit www.alloywire.comin our range of wire, the varying ways in which we can or follow @alloywire on twitter.OMCG’s Cutting Edge CNC Wire Forming TechnologyOMCG, Inc. supplies cutting-edge bending technology. Compatibility (P8 or P16) is standard for all CNCOur Minimalist 6, a CNC front feed wire forming machine Machines via our CNC controller. Complimented byfeatures simple tooling, three-to-six bend radii capability, OMCG mechanical slide-forming machines’ capabilityand generation for rings and large radii. Wire sizes range to 300 ppm. OMCG is your “One Source, Onefrom 1 to 6 mm maximum. Our CNC 31 Model has our Responsibility”. www.omcg.comnew CNC eccentric bend head allowing bends to beformed traditionally or out of sequence; available from10 to 18 mm maximum wire sizes.The “Turbo” includes two bend heads, one manipulatoror reconfigured with two manipulators and two bendheads and a programmable transfer as a “Turbo X”for maximum flexibility. All Models are equipped withEZ program to draw on screen, simulate forming andestimate completion time, OR design on CAD, downloadthe DXF or STEP and EZ program automaticallyconverts to make your part or plot part coordinates asX, Y, Z and Radii points, and the program creates thebending program. Accurex Automatic Part Inspection46 Wire Forming Technology International/Fall 2018

Alex Industries & Fortuna Federn: CNC Wire Forming & Spring Coiling Alex Industries and Fortuna Federn exhibited at production menu makes production very comfortable. SPRING WORLD 2018 in booth 1526. Alex Industries It shows progress indicator, current position indication is the Sales Representative in the USA, and Fortuna and sample counter. Federn is the manufacturer of spring manufacturing machinery in Austria and Croatia. Also offered is the DTL-R CNC fully automatic, servo- controlled CNC double torsion coiling machine. The Offered by Alex Industries and Fortuna Federn is the machine is designed specially for the production of BEM CNC semi-automatic, servo-controlled CNC spring tines (double torsion springs) by one robotized wire forming machine designed for very easy and fast line. Using our developed new IPC CNC control unit with production of bent parts from round wire (strip with the 3D SpringDesigner software makes programming additional accessories on request). Programming is fast very user friendly and easy. New integrated adjustment and accurate. Control is very easy and with push buttons options make the programming and operating on the you can start each bending action very easily. Through whole line comfAourtaomblaet,icadnoudblyeotourscioannsparcinhgiecovileingdreosbioret d combination of up to 8+1 separate bending segments with variable speed adjustment you are able to work very supported line efficiently. Bending angle for each segment is unlimited and speed can beWairdejubsenteddinfgrommach1i%nestoup10to02%0,.00Nmumber DTL-R CNC series of active segments is set BonElMy wCitNhConseeraicetsion. Intuitive DTL-12 R CNC (symbol picture) repeatability and productivity. ToAdvreanctaegieve additional information and technical specificationsin flexible solutions on the BEM CNC semi-automatic, servo- of automatization controlled CNC wire forming machine and the DTL-R BEM-20 CNC CNC fully automatic, servo-controlled CNC double (symbol picture) wtDcmooTanwrcLtshr-owiRinlolee.snda.CTNlhceeCCoNmxCiamlacirnhediangoefruuskbmlallyre.euadaecsutsothiorgs•mniioneawndteicswp,ceosvwceiiliarinsvl.lgoyfiot tr3htDueSnpwarienfebgDdseietseirgnsne.bcr eolmow. for the production of spring tines (doubleBEM CNC semi automatic servo controlled torsion springs) by one robotised line.CNC wire forming machine is designedfor very easy and fast production of bent Using own developed new IPC CNC control The line can be equipped on demandparts from round wire (strip with additional unit with the 3D SpringDesigner software with two coiling stations which will on makes programming very user friendly and customer demand increase the produc-accessories on request). Programming is fast easy. New integrated adjustment options make tivity up to 400 pieces/hour. The stand-and accurate. Control is very easy and with the programming and operating on whole ard line with one coiling station reaches line comfortable and you can achieve desired ~ 200 pieces / hour.Pensa’s Desktop CNC Wire Benderpushbuttons you can start each bending action repeatability and productivity.very easily . Through combination of up to The cost effectiveness is very good.8sp+e1esdepaMadrjauatsetrmbceennodt iynoPguseaergremraeybnltesowtofithwPovarekrinvaebsrleya & Pensa Labs, Brooklyn,iesffuicnileimntiNltye.dYB,aennUddiSnspgAeea,dngcrleaenfpobroeearadtcsjhusstteehdgamfroetnmtthe DIWire Bender is the first jewelry, architecture models, design prototypes, art,1-100%.dNeusmkbteor pofCaNctiCve swegimreenbtseisnsdeet r. ABEnMeCwNCatrocuhchetcyopnterolfournidt eLEsNkZtEop fuMrondietul re,WsIMm-4aMlloWcdeIrMla-f8ts,WsIMu-r1g2icWaIlMi-Dm1T4Lp-1la2-nR tCsN,CoWrtIMh-o36donture,only wmimthakaeosnneuprfaoacdtuicocntti.uoInnrtiuvnietigrvye caopmrnofdodurtcatbriolaen.pidtvo8up0c0rhoissctgroeeetnnyerwpaititihnonbgiog,f ahtnihgdhec-lreeasDrolIuWtionire lighting, staENg10e270-s1 DeHtpsh , puppetry, ro6b- o12tmicms, signage andmenu tlmahsaeenlruiscftaucgtttoeuerrs(MPiscrnaao. dx1cg3o.u0scr0tpnietNvriio/tn.myag,mopWOt²c)eslD/hfhoopurirlleamn3eaDsn,ippDudreiIplneWandtstefriiornm.r2eqms13gu306ai.nn0”9it.f-lis3mt2yio.74no0m’7f’0tra2edhm”d.soepe.rvaotioonns lluymdeesskatnodpIint dsihcaotwiotasnrpsaraosnngdersesmsfasombirpnmlldeeicdcsaotuodtnrot,reacrum.wrreannkt pecousijtruivosnetsalcibonoaomtdoumptarobnagdernabnmuyttstthowwniinstih,rgieto.insltyIehtaosancyetatotncosuaacvbnhe.eobnr ed various metals and plastics, allowing for output to be By being transportable, accessible and affordable, 1 usedMaosdtehle final pBroEMd-u1c2t. BEM-14 BEM-16 BEM-20 DIWire bridges the market gap between time-consumingThe DIWire’s fastWire diameter acc. to EN 10270-1 DH ph a4 -n12dmmac* cur5a- 1t4emmou* tpu6 t- 1e6 mnma*bles6 a- 2n0 mymo*ne hand-bending and large scale, mass production CNCto explore their creativity.(ASTM A228 Music Wire - ca. 1300 N/mm²) .157” - .472” Po.19t7e” -n.5t5i1a” l us.23e6”s- .6in29c” lud.e236s” -p.7r8i7n” g wire bending. Other CNC wire benders are not usedforms, shortMax. wire diameter of soft wire run w1i5remmf*orms1,8 pmmro*totyp2e2 msmf*or an2te4 mnmn*as, for short runs because they are 10 times as large, 30(p.E. 50CrV4) .590” .708” .866” .944” times as expensive and take* depends of the bent radius 1 trained personnel to run. The DIWire changes the dynamics of local, mass customized, prototype and just-in-time (JIT) manufacturing. When combined with other fabrication tools, the possibilities are endless. The revolutionary machine is fast, accurate and repeatable. Suddenly, saving time and effort got so much easier. To learn more, visit the websites below. www.PensaLabs.com www.PensaNYC.com Continued... Fall 2018/Wire Forming Technology International 47

Straight From The Show...Continued News and images from SPRING WORLD® 2018Bihler’s 4-Slide-NC Machine “Both set-up and changeovers can be completed in a fraction of the time compared to older four slideThe Bihler 4 Slide-NC is a joint venture of Bihler of machines,” commented Max Linder, Director of SalesAmerica and Otto Bihler Maschinenfabrik, Germany, and Marketing for Bihler of America. “Plus, you simplyboth world leaders in developing and producing don’t have to manage and look after these machinestechnology and machinery for forming, assembly and like you had to do with the older four slide models. Thewelding processes, for a wide range of global industries. new, easier-to-operate Bihler 4 Slide-NC machine frees up senior personnel to give their time and attentionAccording to Bihler, many experienced plant operations to production tasks that require more experience.personnel in manufacturing industries are at or near The number one benefit with the Bihler 4 Slide-NCretirement age. The Bihler 4 Slide-NC offers an ideal machine that all customers have been talking about issolution to this problem. Due to the ease of operation the reduction in set up time.”of a Bihler 4 Slide-NC machine, a newly-hired machineoperator can be trained to use it in less than a day. Other advantages of the Bihler 4 Slide-NC include: • Highly efficient production of strip and wire parts, even in small batch sizes. • Rapid response for short-term customer requests. • Lot sizes processed in half the time. • Reduced tool costs and debugging time. • Full tool compatibility with select mechanical 4 Slide machines. • Storage for multiple tool setups and configurations. • Integrated process and production monitoring. The Bihler 4 Slide-NC was exhibited in booth 504 at SPRING WORLD. www.4slide-nc.com WFTISPRING WORLD® 2020, October 7 to 9, 2020, Donald E. Stephens Convention Center, Rosemont, IL, USA.48 Wire Forming Technology International/Fall 2018